Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|013720
Gene name
Locationscaffold_01a:3182527..3182967
Strand+
Gene length (bp)440
Transcript length (bp)279
Coding sequence length (bp)279
Protein length (aa) 93

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger 2.7E-22 1 76
PF12678 zf-rbx1 RING-H2 zinc finger domain 1.3E-14 34 70

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT86|APC11_SCHPO Anaphase-promoting complex subunit 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apc11 PE=1 SV=1 1 85 2.0E-21
sp|Q9M9L0|APC11_ARATH Anaphase-promoting complex subunit 11 OS=Arabidopsis thaliana GN=APC11 PE=1 SV=2 1 77 4.0E-19
sp|Q9CPX9|APC11_MOUSE Anaphase-promoting complex subunit 11 OS=Mus musculus GN=Anapc11 PE=3 SV=1 1 77 4.0E-18
sp|Q3ZCF6|APC11_BOVIN Anaphase-promoting complex subunit 11 OS=Bos taurus GN=ANAPC11 PE=3 SV=1 1 77 8.0E-18
sp|Q5R8A2|APC11_PONAB Anaphase-promoting complex subunit 11 OS=Pongo abelii GN=ANAPC11 PE=3 SV=1 1 77 9.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT86|APC11_SCHPO Anaphase-promoting complex subunit 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apc11 PE=1 SV=1 1 85 2.0E-21
sp|Q9M9L0|APC11_ARATH Anaphase-promoting complex subunit 11 OS=Arabidopsis thaliana GN=APC11 PE=1 SV=2 1 77 4.0E-19
sp|Q9CPX9|APC11_MOUSE Anaphase-promoting complex subunit 11 OS=Mus musculus GN=Anapc11 PE=3 SV=1 1 77 4.0E-18
sp|Q3ZCF6|APC11_BOVIN Anaphase-promoting complex subunit 11 OS=Bos taurus GN=ANAPC11 PE=3 SV=1 1 77 8.0E-18
sp|Q5R8A2|APC11_PONAB Anaphase-promoting complex subunit 11 OS=Pongo abelii GN=ANAPC11 PE=3 SV=1 1 77 9.0E-18
sp|Q9NYG5|APC11_HUMAN Anaphase-promoting complex subunit 11 OS=Homo sapiens GN=ANAPC11 PE=1 SV=1 1 77 9.0E-18
sp|Q54L48|APC11_DICDI Anaphase-promoting complex subunit 11 OS=Dictyostelium discoideum GN=anapc11 PE=3 SV=1 1 73 6.0E-15
sp|Q12157|APC11_YEAST Anaphase-promoting complex subunit 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APC11 PE=1 SV=1 1 73 3.0E-13
sp|Q20052|APC11_CAEEL Anaphase-promoting complex subunit 11 OS=Caenorhabditis elegans GN=apc-11 PE=1 SV=1 1 77 1.0E-11
sp|Q23457|RBX1_CAEEL RING-box protein 1 OS=Caenorhabditis elegans GN=rbx-1 PE=1 SV=1 2 73 1.0E-09
sp|Q8QG64|RBX1_SALSA RING-box protein 1 OS=Salmo salar GN=rbx1 PE=2 SV=2 2 73 3.0E-09
sp|P62878|RBX1_MOUSE E3 ubiquitin-protein ligase RBX1 OS=Mus musculus GN=Rbx1 PE=1 SV=1 2 73 4.0E-09
sp|P62877|RBX1_HUMAN E3 ubiquitin-protein ligase RBX1 OS=Homo sapiens GN=RBX1 PE=1 SV=1 2 73 4.0E-09
sp|Q54K33|RBX1_DICDI RING-box protein 1 OS=Dictyostelium discoideum GN=rbx1 PE=3 SV=1 2 73 4.0E-09
sp|Q9NHX0|RBX1B_DROME RING-box protein 1B OS=Drosophila melanogaster GN=Roc1b PE=2 SV=2 2 74 5.0E-09
sp|O13959|RBX1_SCHPO RING-box protein pip1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pip1 PE=1 SV=2 2 73 5.0E-09
sp|Q9W5E1|RBX1A_DROME RING-box protein 1A OS=Drosophila melanogaster GN=Roc1a PE=1 SV=1 2 73 6.0E-09
sp|Q940X7|RBX1A_ARATH RING-box protein 1a OS=Arabidopsis thaliana GN=RBX1A PE=1 SV=1 2 73 3.0E-08
sp|Q9M2B0|RBX1B_ARATH RING-box protein 1b OS=Arabidopsis thaliana GN=RBX1B PE=2 SV=1 2 73 3.0E-07
sp|Q08273|RBX1_YEAST RING-box protein HRT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRT1 PE=1 SV=1 2 76 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0061630 ubiquitin protein ligase activity Yes
GO:0005680 anaphase-promoting complex Yes
GO:0097602 cullin family protein binding Yes
GO:0008270 zinc ion binding Yes
GO:0031145 anaphase-promoting complex-dependent catabolic process Yes
GO:0005488 binding No
GO:0005515 protein binding No
GO:0044265 cellular macromolecule catabolic process No
GO:0043169 cation binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0046872 metal ion binding No
GO:0019538 protein metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0004842 ubiquitin-protein transferase activity No
GO:0044238 primary metabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:1990234 transferase complex No
GO:0009056 catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process No
GO:0032991 protein-containing complex No
GO:0061659 ubiquitin-like protein ligase activity No
GO:0008152 metabolic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0019941 modification-dependent protein catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0030163 protein catabolic process No
GO:0008150 biological_process No
GO:0046914 transition metal ion binding No
GO:1902494 catalytic complex No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006511 ubiquitin-dependent protein catabolic process No
GO:0043167 ion binding No
GO:0044237 cellular metabolic process No
GO:1901575 organic substance catabolic process No
GO:0000152 nuclear ubiquitin ligase complex No
GO:0006508 proteolysis No
GO:0009057 macromolecule catabolic process No
GO:0044248 cellular catabolic process No
GO:0071704 organic substance metabolic process No
GO:0000151 ubiquitin ligase complex No
GO:0140513 nuclear protein-containing complex No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0010498 proteasomal protein catabolic process No
GO:0019787 ubiquitin-like protein transferase activity No
GO:0031461 cullin-RING ubiquitin ligase complex No
GO:0140535 intracellular protein-containing complex No
GO:0009987 cellular process No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|013720
MKVTIKHWHAVAQWRWDTGKSEPNSDDSEGDVCGDDCPLIWGECTHIFHMHCLLKWLGTAASKQQCPMDRRTWVT
AERKVAESDTSTTTNSS*
Coding >Agabi119p4|013720
ATGAAAGTCACCATCAAGCACTGGCATGCGGTAGCACAATGGCGATGGGATACCGGAAAGTCTGAGCCGAATAGC
GATGACAGCGAGGGCGATGTTTGTGGAGACGATTGTCCTTTGATTTGGGGAGAATGTACCCATATATTTCACATG
CATTGCCTCCTCAAATGGCTAGGTACTGCCGCGTCTAAACAACAATGCCCGATGGACCGCAGAACTTGGGTTACT
GCGGAGCGGAAGGTGGCGGAGTCCGATACATCGACTACTACCAATTCTTCGTGA
Transcript >Agabi119p4|013720
ATGAAAGTCACCATCAAGCACTGGCATGCGGTAGCACAATGGCGATGGGATACCGGAAAGTCTGAGCCGAATAGC
GATGACAGCGAGGGCGATGTTTGTGGAGACGATTGTCCTTTGATTTGGGGAGAATGTACCCATATATTTCACATG
CATTGCCTCCTCAAATGGCTAGGTACTGCCGCGTCTAAACAACAATGCCCGATGGACCGCAGAACTTGGGTTACT
GCGGAGCGGAAGGTGGCGGAGTCCGATACATCGACTACTACCAATTCTTCGTGA
Gene >Agabi119p4|013720
ATGAAAGTCACCATCAAGCACTGGCATGCGGTAGCACAATGGCGATGGGATACCGGAAAGTCTGAGCCGAATAGC
GATGACAGCGAGGGCGATGTTTGTGGTATTTGTCGCGTACCTTTTGAAGGGTGTTGTCCAACTTGTAAAATGCCA
GGAGACGATTGTCCTTTGAGTGAGTGCGTTACTTCTTGCTGTAATGCAAATGGACTGATAGGATGTCGACAGTTT
GGGGAGAATGTACCCATATATTTCACATGCATTGCCTCCTCAAATGGCTAGGTACTGCCGCGTCTAAACAACAAT
GCCCGATGGACCGCAGAACTTGGGGTATGCCCACGAAGTTTTCACTGGTGGCAGTTCCATGCTGATAATTGACTG
AACTAGTTACTGCGGAGCGGAAGGTGGCGGAGTCCGATACATCGACTACTACCAATTCTTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail