Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|013700
Gene name
Locationscaffold_01a:3176019..3177297
Strand-
Gene length (bp)1278
Transcript length (bp)1218
Coding sequence length (bp)1218
Protein length (aa) 406

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01755 Glyco_transf_25 Glycosyltransferase family 25 (LPS biosynthesis protein) 4.4E-12 73 338

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.5

Transmembrane Domains

Domain # Start End Length
1 20 37 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|013700
MVLTLFPRLKFTGRARRISLPTVVLFLLGFLLWMANFPNLDAHFPRPFFTATEAGISSTVVSDSDATALEVAQNI
YMLSLPARFDRRARMEILRKALGLQWTYVDALPGTNELTQRIWEWVMRVRDGKPIILNPNDNSHDRPSLGQVRFS
WPDHIDQLAVSLSPIDFWAHTVWSTPILVHNPAPYRPTGCAMDDYRILNFSVELPEHLILTRARIACWYSHVSVL
HKIANNKHQDLDSTYIILEDDIDMEKDISQRLASLWKSLPSDWDMVFLGHCWSNEETHPPLPNVYSQASNEGKNS
SFAKPVRTIHRLHPSFKPKCTHAYAISKGGARRLLLHLRYPPFAYSRAIDQAIAWLIEQGRIKSYTVIPSLVIQT
KTDLSDIAPGNGNDWGAQLEDGVLGGRLSV*
Coding >Agabi119p4|013700
ATGGTTCTTACTTTATTTCCTCGCTTAAAGTTCACAGGAAGGGCCCGCCGTATCTCTCTACCCACTGTCGTCCTA
TTTTTATTGGGATTTCTCCTCTGGATGGCCAATTTCCCGAATCTTGATGCTCATTTCCCACGTCCGTTCTTTACT
GCGACAGAAGCTGGGATATCATCCACTGTCGTTTCCGACAGTGACGCTACAGCATTGGAAGTGGCTCAGAACATT
TACATGCTATCTCTCCCCGCAAGGTTTGACAGACGTGCTCGAATGGAGATCTTGCGAAAGGCGTTGGGCTTGCAG
TGGACATACGTGGACGCACTTCCAGGCACAAATGAACTAACGCAAAGAATCTGGGAATGGGTCATGCGAGTGCGC
GATGGGAAGCCGATCATACTTAACCCCAATGATAACTCACACGACCGTCCATCCTTGGGGCAAGTTCGATTTTCC
TGGCCGGACCACATTGACCAATTAGCGGTATCCTTATCACCTATCGATTTTTGGGCCCATACTGTATGGTCAACT
CCTATATTGGTTCATAACCCCGCACCTTATCGACCAACCGGGTGTGCAATGGATGACTATCGTATCCTCAACTTC
AGTGTTGAATTGCCTGAACATTTGATCCTCACTCGCGCTCGGATTGCCTGTTGGTACTCGCATGTCTCAGTTCTC
CATAAGATAGCCAACAACAAACATCAGGACCTGGATAGCACGTATATCATATTGGAAGACGATATCGATATGGAA
AAAGACATCAGCCAGCGGCTCGCCAGCCTGTGGAAATCGCTTCCCTCGGATTGGGATATGGTATTCTTAGGCCAC
TGCTGGTCCAATGAGGAAACTCATCCACCACTCCCGAATGTGTATTCACAAGCTTCCAACGAAGGAAAAAATTCA
TCTTTCGCAAAACCTGTTCGAACTATTCATCGCCTTCATCCTTCTTTCAAGCCGAAATGCACTCATGCATATGCT
ATTTCTAAAGGTGGGGCTCGGAGGTTACTCTTACACCTCCGATATCCCCCATTTGCGTATTCGCGTGCTATTGAT
CAAGCTATCGCTTGGCTGATCGAGCAAGGAAGGATTAAAAGTTACACCGTGATACCTAGTTTAGTCATCCAAACA
AAAACGGACCTTAGCGATATAGCACCCGGAAACGGGAACGACTGGGGTGCGCAACTAGAAGATGGTGTTCTTGGT
GGACGACTTTCAGTGTAG
Transcript >Agabi119p4|013700
ATGGTTCTTACTTTATTTCCTCGCTTAAAGTTCACAGGAAGGGCCCGCCGTATCTCTCTACCCACTGTCGTCCTA
TTTTTATTGGGATTTCTCCTCTGGATGGCCAATTTCCCGAATCTTGATGCTCATTTCCCACGTCCGTTCTTTACT
GCGACAGAAGCTGGGATATCATCCACTGTCGTTTCCGACAGTGACGCTACAGCATTGGAAGTGGCTCAGAACATT
TACATGCTATCTCTCCCCGCAAGGTTTGACAGACGTGCTCGAATGGAGATCTTGCGAAAGGCGTTGGGCTTGCAG
TGGACATACGTGGACGCACTTCCAGGCACAAATGAACTAACGCAAAGAATCTGGGAATGGGTCATGCGAGTGCGC
GATGGGAAGCCGATCATACTTAACCCCAATGATAACTCACACGACCGTCCATCCTTGGGGCAAGTTCGATTTTCC
TGGCCGGACCACATTGACCAATTAGCGGTATCCTTATCACCTATCGATTTTTGGGCCCATACTGTATGGTCAACT
CCTATATTGGTTCATAACCCCGCACCTTATCGACCAACCGGGTGTGCAATGGATGACTATCGTATCCTCAACTTC
AGTGTTGAATTGCCTGAACATTTGATCCTCACTCGCGCTCGGATTGCCTGTTGGTACTCGCATGTCTCAGTTCTC
CATAAGATAGCCAACAACAAACATCAGGACCTGGATAGCACGTATATCATATTGGAAGACGATATCGATATGGAA
AAAGACATCAGCCAGCGGCTCGCCAGCCTGTGGAAATCGCTTCCCTCGGATTGGGATATGGTATTCTTAGGCCAC
TGCTGGTCCAATGAGGAAACTCATCCACCACTCCCGAATGTGTATTCACAAGCTTCCAACGAAGGAAAAAATTCA
TCTTTCGCAAAACCTGTTCGAACTATTCATCGCCTTCATCCTTCTTTCAAGCCGAAATGCACTCATGCATATGCT
ATTTCTAAAGGTGGGGCTCGGAGGTTACTCTTACACCTCCGATATCCCCCATTTGCGTATTCGCGTGCTATTGAT
CAAGCTATCGCTTGGCTGATCGAGCAAGGAAGGATTAAAAGTTACACCGTGATACCTAGTTTAGTCATCCAAACA
AAAACGGACCTTAGCGATATAGCACCCGGAAACGGGAACGACTGGGGTGCGCAACTAGAAGATGGTGTTCTTGGT
GGACGACTTTCAGTGTAG
Gene >Agabi119p4|013700
ATGGTTCTTACTTTATTTCCTCGCTTAAAGTTCACAGGAAGGGCCCGCCGTATCTCTCTACCCACTGTCGTCCTA
TTTTTATTGGGATTTCTCCTCTGGATGGCCAATTTCCCGAATCTTGATGCTCATTTCCCACGTCCGTTCTTTACT
GCGACAGAAGCTGGGATATCATCCACTGTCGTTTCCGACAGTGACGCTACAGCATTGGAAGTGGCTCAGAACATT
TACATGCTATCTCTCCCCGCAAGGTTTGACAGACGTGCTCGAATGGAGATCTTGCGAAAGGCGTTGGGCTTGCAG
TGGACATACGTGGACGCACTTCCAGGCACAAATGAACTAACGCAAAGAATCTGGGAATGGGTCATGCGAGTGCGC
GATGGGAAGCCGATCATACTTAACCCCAATGATAACTCACACGACCGTCCATCCTTGGGGCAAGTTCGATTTTCC
TGGCCGGACCACATTGACCAATTAGCGGTATCCTTATCACCTATCGATTTTTGGGCCCATACTGTATGGTCAACT
CCTATATTGGTTCATAACCCCGCACCTTATCGACCAACCGGGTGTGCAATGGATGACTATCGTATCCTCAACTTC
AGTGTTGAATTGCCTGAACATTTGATCCTCACTCGCGCTCGGATTGCCTGTTGGTACTCGCATGTCTCAGTTCTC
CATAAGATAGCCAACAACAAACATCAGGACCTGGATAGCACGTATATCATATTGGAAGACGATATCGATATGGAA
AAAGACATCAGCCAGCGGCTCGCCAGCCTGTGGAAATCGCTTCCCTCGGATTGGGATATGGTATTCTTAGGCACG
TCAATGACAGGGTCATCACATCACATTATCTTGTTGCTCTAACGCCCACAACTAGGCCACTGCTGGTCCAATGAG
GAAACTCATCCACCACTCCCGAATGTGTATTCACAAGCTTCCAACGAAGGAAAAAATTCATCTTTCGCAAAACCT
GTTCGAACTATTCATCGCCTTCATCCTTCTTTCAAGCCGAAATGCACTCATGCATATGCTATTTCTAAAGGTGGG
GCTCGGAGGTTACTCTTACACCTCCGATATCCCCCATTTGCGTATTCGCGTGCTATTGATCAAGCTATCGCTTGG
CTGATCGAGCAAGGAAGGATTAAAAGTTACACCGTGATACCTAGTTTAGTCATCCAAACAAAAACGGACCTTAGC
GATATAGCACCCGGAAACGGGAACGACTGGGGTGCGCAACTAGAAGATGGTGTTCTTGGTGGACGACTTTCAGTG
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail