Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|012350
Gene name
Locationscaffold_01a:2963511..2966568
Strand-
Gene length (bp)3057
Transcript length (bp)2547
Coding sequence length (bp)2547
Protein length (aa) 849

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04097 Nic96 Nup93/Nic96 6.8E-124 229 706
PF04097 Nic96 Nup93/Nic96 1.9E-24 710 837

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P34077|NIC96_YEAST Nucleoporin NIC96 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NIC96 PE=1 SV=2 10 846 1.0E-81
sp|O94418|MUG87_SCHPO Meiotically up-regulated gene 87 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug87 PE=1 SV=1 11 847 3.0E-79
sp|G0S024|NIC96_CHATD Nucleoporin NIC96 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NIC96 PE=1 SV=1 192 841 3.0E-68
sp|Q7ZU29|NUP93_DANRE Nuclear pore complex protein Nup93 OS=Danio rerio GN=dye PE=2 SV=1 23 844 6.0E-64
sp|A5PJZ5|NUP93_BOVIN Nuclear pore complex protein Nup93 OS=Bos taurus GN=NUP93 PE=2 SV=1 23 844 2.0E-61
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P34077|NIC96_YEAST Nucleoporin NIC96 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NIC96 PE=1 SV=2 10 846 1.0E-81
sp|O94418|MUG87_SCHPO Meiotically up-regulated gene 87 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug87 PE=1 SV=1 11 847 3.0E-79
sp|G0S024|NIC96_CHATD Nucleoporin NIC96 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NIC96 PE=1 SV=1 192 841 3.0E-68
sp|Q7ZU29|NUP93_DANRE Nuclear pore complex protein Nup93 OS=Danio rerio GN=dye PE=2 SV=1 23 844 6.0E-64
sp|A5PJZ5|NUP93_BOVIN Nuclear pore complex protein Nup93 OS=Bos taurus GN=NUP93 PE=2 SV=1 23 844 2.0E-61
sp|O14310|NP106_SCHPO Nucleoporin npp106 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=npp106 PE=1 SV=1 11 839 6.0E-61
sp|Q8BJ71|NUP93_MOUSE Nuclear pore complex protein Nup93 OS=Mus musculus GN=Nup93 PE=1 SV=1 23 844 3.0E-60
sp|Q66HC5|NUP93_RAT Nuclear pore complex protein Nup93 OS=Rattus norvegicus GN=Nup93 PE=1 SV=1 23 844 3.0E-60
sp|Q8N1F7|NUP93_HUMAN Nuclear pore complex protein Nup93 OS=Homo sapiens GN=NUP93 PE=1 SV=2 23 844 7.0E-60
sp|Q5R822|NUP93_PONAB Nuclear pore complex protein Nup93 OS=Pongo abelii GN=NUP93 PE=2 SV=2 23 844 3.0E-59
sp|Q6NX12|NUP93_XENTR Nuclear pore complex protein Nup93 OS=Xenopus tropicalis GN=nup93 PE=2 SV=1 23 844 1.0E-56
sp|Q7ZX96|NUP93_XENLA Nuclear pore complex protein Nup93 OS=Xenopus laevis GN=nup93 PE=2 SV=1 23 844 4.0E-56
sp|O22224|NP93A_ARATH Nuclear pore complex protein NUP93A OS=Arabidopsis thaliana GN=NUP93A PE=1 SV=2 23 696 2.0E-26
sp|F4J284|NU93B_ARATH Nuclear pore complex protein NUP93B OS=Arabidopsis thaliana GN=NUP93B PE=1 SV=1 23 718 9.0E-25
[Show less]

GO

GO Term Description Terminal node
GO:0017056 structural constituent of nuclear pore Yes
GO:0005643 nuclear pore Yes
GO:0005198 structural molecule activity No
GO:0032991 protein-containing complex No
GO:0140513 nuclear protein-containing complex No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|012350
MADLAAVLNASKNLNSHLNRPGLPAVTLSLDQIEAQSRRLVSRLPGTSADADRANFLLAQAHVDAPALTSSIAHL
NTSTTFTPLQALQDTDIAGYLRHAHEQNLISTIEEGRKETQEEFYRVLEERSQKDWEAKKKRLFEEIGGRVGADN
KALELKKSTHGKSTLLGASSSSSTPTLTLQMQSKMMAYDRVVSEFNTSRLKGTSYPIIHSFIDASLPLSASDPRV
LQTAQAFHILARITDEPPALPPIEHAGAHILNAPVFERKYARTYLGDPESRDAVALRKQIARGAREALEEQYWDM
LERTVQSRPTEARLGGDPSVHNKVRAFLAVRFYRNGEWEDRIELVAGQPIWAKLYFLVRTGHVQEALQEALQNQQ
IIEHREASFFSHFKTWIESPERKLPKAHRDHLQTVYNAHMLHSSTADPFKLALYKLMGKLEPSRRNVPQVTTTTE
DWIWLQLAMIDEDEDGGLRAFAEVLLGYGERHFDGPPNQPGRKVWPSVLLMCGQFERAVAALWENSETEIEAVHL
AIALAYHGLLRVPSRSETSDVSPLSIVPGLPPALSFSTLIWRYVRQFVKMDAKEALQYVCTVCLSADQGEAGKEQ
VEIAWDLVRRIIVLANSGPAWEELVGGFRADGSRFSGVIEQGAPLLCLTDAKQYSEHILVRAARHSEEDDRIAEA
IKLYNLAGDYSTVVACLATALGNTIAQPGPDEKARGIERTNRDAVVKLLRIREAIEAKENGKPEVALEVLESTDL
IPLSGDVARVTKRAEEFKDLHESLQRNLQVYLPLTMDALAGVHQKVKSTMVADATRQMTLASIRKKSRSLMVFAG
ILKYRMSPDVYSYLARLDVEIAL*
Coding >Agabi119p4|012350
ATGGCAGACCTTGCAGCAGTCCTCAATGCGTCCAAAAACCTGAATAGCCATCTCAACAGACCTGGCCTCCCCGCC
GTCACCCTCTCGCTCGACCAGATCGAGGCCCAGTCTCGCCGTCTCGTTTCTCGTCTACCAGGCACTTCCGCCGAT
GCAGACCGCGCAAATTTCCTCCTTGCCCAGGCTCACGTCGATGCACCTGCGTTGACCAGTTCCATCGCCCACCTC
AACACCTCGACCACTTTCACCCCCCTCCAGGCCCTCCAGGACACGGACATCGCGGGCTACCTCCGTCATGCACAC
GAACAGAACCTCATCTCTACCATCGAGGAAGGAAGAAAAGAGACCCAGGAAGAGTTTTACAGAGTCCTCGAAGAG
AGAAGTCAAAAGGACTGGGAGGCAAAGAAGAAACGCCTCTTTGAGGAAATTGGCGGACGCGTCGGTGCCGATAAC
AAGGCCCTCGAGCTCAAGAAAAGCACCCATGGAAAGAGCACTCTCCTGGGTGCAAGTTCGTCCTCCAGCACCCCC
ACTCTGACACTACAGATGCAAAGCAAAATGATGGCCTACGACCGCGTAGTCTCAGAATTTAATACTTCTCGCCTC
AAAGGCACATCCTATCCCATTATCCACTCTTTCATCGATGCATCTCTCCCCCTCTCTGCCTCAGACCCTCGCGTC
CTTCAAACCGCCCAAGCGTTCCATATCCTTGCTCGAATCACAGACGAACCCCCCGCCCTCCCACCTATCGAACAC
GCCGGTGCCCATATCCTCAACGCGCCCGTGTTTGAACGTAAATATGCCCGTACTTATCTTGGCGATCCCGAATCT
CGCGACGCAGTCGCTCTCCGTAAACAAATCGCGCGTGGTGCCAGAGAAGCATTAGAAGAACAATATTGGGATATG
TTGGAACGGACCGTTCAATCTCGTCCTACAGAAGCCCGATTGGGTGGCGACCCCAGTGTACACAACAAAGTTCGG
GCTTTCTTGGCTGTCAGATTTTATAGGAATGGAGAATGGGAGGATCGTATTGAGCTGGTTGCCGGTCAGCCCATA
TGGGCCAAGCTCTACTTCCTGGTTCGGACGGGCCATGTGCAGGAAGCCCTGCAGGAGGCGCTGCAAAATCAGCAA
ATCATTGAACATCGAGAGGCCAGCTTTTTTAGTCATTTCAAAACTTGGATCGAGTCCCCCGAGCGCAAACTTCCG
AAAGCGCATAGGGATCACCTACAGACAGTATACAATGCACACATGTTGCATTCATCAACTGCTGACCCTTTCAAG
TTGGCGTTGTACAAACTCATGGGCAAACTTGAGCCCTCGAGAAGGAATGTCCCTCAGGTTACCACGACCACTGAA
GATTGGATATGGCTGCAGTTGGCAATGATCGATGAGGACGAAGATGGTGGCCTTCGAGCATTTGCCGAGGTCTTG
CTCGGGTACGGCGAACGTCATTTCGATGGACCTCCCAACCAACCCGGAAGGAAAGTTTGGCCTAGTGTGCTACTC
ATGTGTGGACAATTTGAGCGCGCCGTGGCTGCACTATGGGAGAACTCGGAGACTGAAATTGAAGCCGTTCATCTA
GCTATTGCTTTGGCGTATCACGGTCTGTTGCGTGTTCCTTCCCGCTCGGAGACTTCAGATGTGTCACCACTTTCC
ATTGTCCCTGGTTTACCTCCTGCTTTGAGCTTCTCGACGTTAATTTGGCGCTATGTACGCCAATTTGTCAAAATG
GATGCGAAAGAAGCGTTGCAATACGTGTGTACTGTGTGTCTCTCTGCGGATCAAGGCGAGGCGGGTAAGGAGCAA
GTTGAAATTGCTTGGGATCTTGTGAGAAGAATCATAGTTTTGGCGAATAGTGGACCTGCTTGGGAGGAACTTGTC
GGAGGATTCAGAGCTGATGGATCACGATTCAGTGGTGTTATCGAACAAGGCGCACCCTTACTTTGTCTCACCGAT
GCCAAACAATATAGTGAACATATCCTTGTCCGTGCGGCCCGACACTCGGAAGAGGACGACCGGATTGCGGAAGCT
ATCAAACTTTATAACCTTGCAGGCGATTACAGCACCGTCGTAGCTTGCCTTGCTACCGCACTAGGCAACACTATA
GCCCAACCAGGACCAGACGAAAAGGCACGTGGTATCGAAAGAACTAACAGAGATGCGGTAGTGAAGTTGTTGAGG
ATCAGAGAGGCAATTGAAGCTAAAGAGAATGGGAAACCGGAAGTGGCTTTGGAGGTGTTGGAATCCACGGATTTG
ATACCGTTGAGTGGGGATGTGGCTAGGGTTACGAAGAGGGCGGAGGAGTTTAAGGATTTGCATGAGAGTTTGCAG
AGGAATTTGCAGGTGTATTTGCCTTTGACGATGGATGCGCTTGCGGGTGTGCATCAAAAAGTGAAGAGTACAATG
GTTGCGGATGCAACGAGACAGATGACGCTAGCATCAATTCGCAAAAAGTCGCGTTCGTTGATGGTGTTTGCTGGT
ATACTCAAATACCGCATGTCACCGGATGTGTATTCATACCTTGCTCGATTGGACGTGGAAATTGCGCTCTAA
Transcript >Agabi119p4|012350
ATGGCAGACCTTGCAGCAGTCCTCAATGCGTCCAAAAACCTGAATAGCCATCTCAACAGACCTGGCCTCCCCGCC
GTCACCCTCTCGCTCGACCAGATCGAGGCCCAGTCTCGCCGTCTCGTTTCTCGTCTACCAGGCACTTCCGCCGAT
GCAGACCGCGCAAATTTCCTCCTTGCCCAGGCTCACGTCGATGCACCTGCGTTGACCAGTTCCATCGCCCACCTC
AACACCTCGACCACTTTCACCCCCCTCCAGGCCCTCCAGGACACGGACATCGCGGGCTACCTCCGTCATGCACAC
GAACAGAACCTCATCTCTACCATCGAGGAAGGAAGAAAAGAGACCCAGGAAGAGTTTTACAGAGTCCTCGAAGAG
AGAAGTCAAAAGGACTGGGAGGCAAAGAAGAAACGCCTCTTTGAGGAAATTGGCGGACGCGTCGGTGCCGATAAC
AAGGCCCTCGAGCTCAAGAAAAGCACCCATGGAAAGAGCACTCTCCTGGGTGCAAGTTCGTCCTCCAGCACCCCC
ACTCTGACACTACAGATGCAAAGCAAAATGATGGCCTACGACCGCGTAGTCTCAGAATTTAATACTTCTCGCCTC
AAAGGCACATCCTATCCCATTATCCACTCTTTCATCGATGCATCTCTCCCCCTCTCTGCCTCAGACCCTCGCGTC
CTTCAAACCGCCCAAGCGTTCCATATCCTTGCTCGAATCACAGACGAACCCCCCGCCCTCCCACCTATCGAACAC
GCCGGTGCCCATATCCTCAACGCGCCCGTGTTTGAACGTAAATATGCCCGTACTTATCTTGGCGATCCCGAATCT
CGCGACGCAGTCGCTCTCCGTAAACAAATCGCGCGTGGTGCCAGAGAAGCATTAGAAGAACAATATTGGGATATG
TTGGAACGGACCGTTCAATCTCGTCCTACAGAAGCCCGATTGGGTGGCGACCCCAGTGTACACAACAAAGTTCGG
GCTTTCTTGGCTGTCAGATTTTATAGGAATGGAGAATGGGAGGATCGTATTGAGCTGGTTGCCGGTCAGCCCATA
TGGGCCAAGCTCTACTTCCTGGTTCGGACGGGCCATGTGCAGGAAGCCCTGCAGGAGGCGCTGCAAAATCAGCAA
ATCATTGAACATCGAGAGGCCAGCTTTTTTAGTCATTTCAAAACTTGGATCGAGTCCCCCGAGCGCAAACTTCCG
AAAGCGCATAGGGATCACCTACAGACAGTATACAATGCACACATGTTGCATTCATCAACTGCTGACCCTTTCAAG
TTGGCGTTGTACAAACTCATGGGCAAACTTGAGCCCTCGAGAAGGAATGTCCCTCAGGTTACCACGACCACTGAA
GATTGGATATGGCTGCAGTTGGCAATGATCGATGAGGACGAAGATGGTGGCCTTCGAGCATTTGCCGAGGTCTTG
CTCGGGTACGGCGAACGTCATTTCGATGGACCTCCCAACCAACCCGGAAGGAAAGTTTGGCCTAGTGTGCTACTC
ATGTGTGGACAATTTGAGCGCGCCGTGGCTGCACTATGGGAGAACTCGGAGACTGAAATTGAAGCCGTTCATCTA
GCTATTGCTTTGGCGTATCACGGTCTGTTGCGTGTTCCTTCCCGCTCGGAGACTTCAGATGTGTCACCACTTTCC
ATTGTCCCTGGTTTACCTCCTGCTTTGAGCTTCTCGACGTTAATTTGGCGCTATGTACGCCAATTTGTCAAAATG
GATGCGAAAGAAGCGTTGCAATACGTGTGTACTGTGTGTCTCTCTGCGGATCAAGGCGAGGCGGGTAAGGAGCAA
GTTGAAATTGCTTGGGATCTTGTGAGAAGAATCATAGTTTTGGCGAATAGTGGACCTGCTTGGGAGGAACTTGTC
GGAGGATTCAGAGCTGATGGATCACGATTCAGTGGTGTTATCGAACAAGGCGCACCCTTACTTTGTCTCACCGAT
GCCAAACAATATAGTGAACATATCCTTGTCCGTGCGGCCCGACACTCGGAAGAGGACGACCGGATTGCGGAAGCT
ATCAAACTTTATAACCTTGCAGGCGATTACAGCACCGTCGTAGCTTGCCTTGCTACCGCACTAGGCAACACTATA
GCCCAACCAGGACCAGACGAAAAGGCACGTGGTATCGAAAGAACTAACAGAGATGCGGTAGTGAAGTTGTTGAGG
ATCAGAGAGGCAATTGAAGCTAAAGAGAATGGGAAACCGGAAGTGGCTTTGGAGGTGTTGGAATCCACGGATTTG
ATACCGTTGAGTGGGGATGTGGCTAGGGTTACGAAGAGGGCGGAGGAGTTTAAGGATTTGCATGAGAGTTTGCAG
AGGAATTTGCAGGTGTATTTGCCTTTGACGATGGATGCGCTTGCGGGTGTGCATCAAAAAGTGAAGAGTACAATG
GTTGCGGATGCAACGAGACAGATGACGCTAGCATCAATTCGCAAAAAGTCGCGTTCGTTGATGGTGTTTGCTGGT
ATACTCAAATACCGCATGTCACCGGATGTGTATTCATACCTTGCTCGATTGGACGTGGAAATTGCGCTCTAA
Gene >Agabi119p4|012350
ATGGCAGACCTTGCAGCAGTCCTCAATGCGTCCAAAAACCTGAATAGCCATCTCAACAGACCTGGCCTCCCCGCC
GTCACCCTCTCGCTCGACCAGATCGAGGCCCAGTCTCGCCGTCTCGTTTCTCGTCTACCAGGCACTTCCGCCGAT
GCAGACCGCGCGTAGGCATTGTCTGCTCTAATCTAACCTCACATAACTCATTCTTTTCCCAGAAATTTCCTCCTT
GCCCAGGCTCACGTCGATGCACCTGCGTTGACCAGTTCCATCGCCCACCTCAACACCTCGACCACTTTCACCCCC
CTCCAGGCCCTCCAGGACACGGACATCGCGGGCTACCTCCGTCATGCACACGAACAGAACCTCATCTCTACCATC
GAGGAAGGAAGAAAAGAGACCCAGGAAGAGTTTTACAGAGTCCTCGAAGAGAGAAGTCAAAAGGACTGGGAGGCA
AAGAAGAAACGCCTCTTTGAGGAAATTGGCGGACGCGTCGGTGCCGATAACAAGGCCCTCGAGCTCAAGAAAAGC
ACCCATGGAAAGAGCACTCTCCTGGCAAGTGCTTCACGTTCTCTCACCAGACTTATCCTAACCCTTCTGTAGGGT
GCAAGTTCGTCCTCCAGCACCCCCACTCTGACACTACAGATGCAAAGCAAAATGATGGCCTACGACCGCGTAGTC
TCAGAATTTAATACTTCTCGCCTCAAAGGCACATCCTATCCCATTATCCACTCTTTCATCGATGCATCTCTCCCC
CTCTCTGCCTCAGACGTGCGTAAACTACTAACCATTTGCCAATGACCTGACATGATCAACCGCAGCCTCGCGTCC
TTCAAACCGCCCAAGCGTTCCATATCCTTGCTCGAATCACAGACGAACCCCCCGCCCTCCCACCTATCGAACACG
CCGGTGCCCATATCCTCAACGCGCCCGTGTTTGAACGTAAATATGCCCGTACTTATCTTGGCGATCCCGAATCTC
GCGACGCAGTCGCTCTCCGTAAACAAATCGCGCGTGGTGCCAGAGAAGCATTAGAAGAACAATATTGGGATATGT
TGGAACGGACCGTTCAATCTCGTCCTACAGAAGCCCGATTGGGTGGCGACCCCAGTGTACACAACAAAGTTCGGG
CTTTCTTGGCTGTCAGATTTTATAGGAATGGAGAATGGGAGGATCGTATTGAGCTGGTTGCCGGTCAGCCCATAT
GGGCCAAGCTCTACTTCCTGGTTCGGACGGGCCATGTGCAGGAAGCCCTGCAGGAGGCGCTGCAAAATCAGCAAA
TCATTGAACATCGAGAGGCCAGCTTTTTTAGTCATTTCAAAACTTGGATCGAGTCCCCCGAGCGCAAGTACGTTT
CCATAGTCGTCAGTAGACTTATTTGTACTCAATGGCCATTTATAGACTTCCGAAAGCGCATAGGGATCACCTACA
GACAGTATACAATGCACACATGTTGCATTCATCAACTGCTGACCCTTTCAAGTTGGCGTTGTACAAACTCATGGG
CAAACTTGAGCCCTCGAGAAGGAATGTCCCTCAGGTTACCACGACCACTGAAGATTGGATATGGCTGCAGTTGGC
AATGGTGTGTAGAATAACTAAGACACTATCAACACTCAACAAGTTCCTTTAGATCGATGAGGACGAAGATGGTGG
CCTTCGAGCATTTGCCGAGGTCTTGCTCGGGTACGGCGAACGTCATTTCGATGGACCTCCCAACCAACCCGGAAG
GAAAGTTTGGCCTAGTGTGCTACTCATGTGTGGACAATTTGAGCGCGTAAGTAGGATGACTTTGCCATGATAACA
TCTAATGCTCTTCTAGGCCGTGGCTGCACTATGGGAGAACTCGGAGACTGAAATTGAAGCCGTTCATCTAGCTAT
TGCTTTGGCGTATCACGGTCTGTTGCGTGTTCCTTCCCGCTCGGAGACTTCAGATGTGTCACCACGTACGCACTT
GATCTTTTTTTTTTTTCCTTTTTTTGCTTATACCTTGATTTTCAGTTTCCATTGTCCCTGGTTTACCTCCTGCTT
TGAGCTTCTCGACGTTAATTTGGCGCTATGTACGCCAATTTGTCAAAATGGATGCGAAAGAAGCGTTGCAATACG
TGTGTACTGTGTGTCTCTCTGCGGATCAAGGCGAGGCGGGTAAGGAGCAAGTTGAAATTGCTTGGGATCTTGTGA
GAAGAATCATAGTTTTGGCGAATAGTGGACCTGCTTGGGAGGAACTTGTCGGAGGATTCAGAGCTGATGGATCAC
GATTCGTACGTTACGGTCATCCTTTAATCCCCTCTACTGACTTCTCCCTCACAGAGTGGTGTTATCGAACAAGGC
GCACCCTTACTTTGTCTCACCGATGCCAAACAATATAGTGAACATATCCTTGTCCGTGCGGCCCGACACTCGGAA
GAGGACGACCGGATTGCGGAAGCTATCAAACTTTATAACCTTGCAGGCGATTACAGCACCGTCGTAGCTTGCCTT
GCTACCGCACTAGGCAACACTATAGCCCAACCAGGACCAGACGAAAAGGCACGTGGTATCGAAAGAACTGCAAGT
GAAATTCTACGACACTACGAGCGCACCAATAGGGCTGTTGGTAAGAACAGAGATGCGGTAGTGAAGTTGTTGAGG
ATCAGAGAGGCAATTGAAGCTAAAGAGAATGGGAAACCGGAAGTGGCTTTGGAGGTGTTGGAATCCACGGATTTG
ATACCGTTGAGTGGGGATGTGGCTAGGGTTACGAAGAGGGCGGAGGAGTTTAAGGATTTGCATGAGAGTTTGCAG
AGGAATTTGCAGGTGTATTTGCCTTTGACGATGGATGCGCTTGCGGGTGTGCATCAAAAAGTGAAGAGTACAATG
GTTGCGGATGCAACGAGACAGATGGTGCGTGTTTTCTACTTCTGGTTCGGAAGAACCTGATATTGACGGATTACT
CGTTCTTAGACGCTAGCATCAATTCGCAAAAAGTCGCGTTCGTTGATGGTGTTTGCTGGTATACTCAAATACCGC
ATGTCACCGGATGTGTATTCATACCTTGCTCGATTGGACGTGGAAATTGCGCTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail