Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|012240
Gene name
Locationscaffold_01a:2942304..2945694
Strand-
Gene length (bp)3390
Transcript length (bp)2871
Coding sequence length (bp)2871
Protein length (aa) 957

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03635 Vps35 Vacuolar protein sorting-associated protein 35 0.0E+00 11 881

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74552|VPS35_SCHPO Vacuolar protein sorting-associated protein 35 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps35 PE=1 SV=2 12 943 7.0E-172
sp|Q9EQH3|VPS35_MOUSE Vacuolar protein sorting-associated protein 35 OS=Mus musculus GN=Vps35 PE=1 SV=1 4 317 4.0E-109
sp|Q2HJG5|VPS35_BOVIN Vacuolar protein sorting-associated protein 35 OS=Bos taurus GN=VPS35 PE=2 SV=1 4 317 1.0E-108
sp|Q96QK1|VPS35_HUMAN Vacuolar protein sorting-associated protein 35 OS=Homo sapiens GN=VPS35 PE=1 SV=2 4 317 1.0E-108
sp|Q54C24|VPS35_DICDI Vacuolar protein sorting-associated protein 35 OS=Dictyostelium discoideum GN=vps35 PE=3 SV=1 4 309 9.0E-95
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74552|VPS35_SCHPO Vacuolar protein sorting-associated protein 35 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps35 PE=1 SV=2 12 943 7.0E-172
sp|Q9EQH3|VPS35_MOUSE Vacuolar protein sorting-associated protein 35 OS=Mus musculus GN=Vps35 PE=1 SV=1 4 317 4.0E-109
sp|Q2HJG5|VPS35_BOVIN Vacuolar protein sorting-associated protein 35 OS=Bos taurus GN=VPS35 PE=2 SV=1 4 317 1.0E-108
sp|Q96QK1|VPS35_HUMAN Vacuolar protein sorting-associated protein 35 OS=Homo sapiens GN=VPS35 PE=1 SV=2 4 317 1.0E-108
sp|Q54C24|VPS35_DICDI Vacuolar protein sorting-associated protein 35 OS=Dictyostelium discoideum GN=vps35 PE=3 SV=1 4 309 9.0E-95
sp|F4I0P8|VP35B_ARATH Vacuolar protein sorting-associated protein 35B OS=Arabidopsis thaliana GN=VPS35B PE=1 SV=1 7 305 5.0E-93
sp|Q2HJG5|VPS35_BOVIN Vacuolar protein sorting-associated protein 35 OS=Bos taurus GN=VPS35 PE=2 SV=1 406 932 3.0E-89
sp|Q96QK1|VPS35_HUMAN Vacuolar protein sorting-associated protein 35 OS=Homo sapiens GN=VPS35 PE=1 SV=2 406 932 7.0E-89
sp|Q9EQH3|VPS35_MOUSE Vacuolar protein sorting-associated protein 35 OS=Mus musculus GN=Vps35 PE=1 SV=1 406 928 2.0E-88
sp|P34110|VPS35_YEAST Vacuolar protein sorting-associated protein 35 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS35 PE=1 SV=2 15 316 3.0E-88
sp|A8R7K9|VP35C_ARATH Vacuolar protein sorting-associated protein 35C OS=Arabidopsis thaliana GN=VPS35C PE=2 SV=1 5 309 3.0E-85
sp|Q7X659|VP35A_ARATH Vacuolar protein sorting-associated protein 35A OS=Arabidopsis thaliana GN=VPS35A PE=1 SV=1 7 310 2.0E-82
sp|Q7X659|VP35A_ARATH Vacuolar protein sorting-associated protein 35A OS=Arabidopsis thaliana GN=VPS35A PE=1 SV=1 411 889 9.0E-69
sp|F4I0P8|VP35B_ARATH Vacuolar protein sorting-associated protein 35B OS=Arabidopsis thaliana GN=VPS35B PE=1 SV=1 411 885 8.0E-68
sp|Q54C24|VPS35_DICDI Vacuolar protein sorting-associated protein 35 OS=Dictyostelium discoideum GN=vps35 PE=3 SV=1 407 882 1.0E-59
sp|A8R7K9|VP35C_ARATH Vacuolar protein sorting-associated protein 35C OS=Arabidopsis thaliana GN=VPS35C PE=2 SV=1 423 896 3.0E-58
sp|P34110|VPS35_YEAST Vacuolar protein sorting-associated protein 35 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS35 PE=1 SV=2 410 890 7.0E-50
[Show less]

GO

GO Term Description Terminal node
GO:0015031 protein transport Yes
GO:0030906 retromer, cargo-selective complex Yes
GO:0042147 retrograde transport, endosome to Golgi Yes
GO:0006810 transport No
GO:0005575 cellular_component No
GO:0033036 macromolecule localization No
GO:0051641 cellular localization No
GO:0032991 protein-containing complex No
GO:0071705 nitrogen compound transport No
GO:0098796 membrane protein complex No
GO:0046907 intracellular transport No
GO:0051649 establishment of localization in cell No
GO:0009987 cellular process No
GO:0008104 protein localization No
GO:0051179 localization No
GO:0016197 endosomal transport No
GO:0045184 establishment of protein localization No
GO:0071702 organic substance transport No
GO:0051234 establishment of localization No
GO:0016482 cytosolic transport No
GO:0016192 vesicle-mediated transport No
GO:0070727 cellular macromolecule localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|012240
MALPAPEEGKLLSEALNTVKIQVQQMKRHLELDQLMDALKSASLMLAELRTSSLSPKQYYELYMAVFDALRHLSN
YLYDAHTQGRHHLADLYELVQYASNILPRLYLMITVGSVYMSIPDAPVKEIMKDMMEMSRGVLHPIRGLFLRHYL
SGQTRDNLPIASEPGPTGNLQDSISFVLTNFIEMNKLWVRLQHQGHSRDREKREMERRELRILVGTNLVRLSQLD
GVDLDLYQKTILPSILEQVVSCKDVIAQEYLMEVVIQVFTDEFHLHSLGPFLSSTAQLHPKVNIKQIVIALIDRL
AAYAAREAETEDPEETKRQEEAAAKRLAEKVKEQKKSRQNGSSQPSPMSPTNSEANAWAATPTSPTIESSASSGP
EKSSVSGSPATSNIELKGKEKEASPVRKFRGVPDNVRLFEVFWQQVVELIKARPDLSIQDITALFVSLTNLSVSC
YPDRLEYVDQILGFTAEKIKEYSDNPDLHAQQTSSNLQALLVAPINSYQSVLTLLAIPNYVPLLTRQLFSTRRSI
AHSIISSVLKNETIIETPEDVDGVLELCHVLIKDQSDFASNQSTSIGQQGHIREVRRQGPYFVEREEMAEEQGWV
ARMVHLFRAESLDTQFELLQIARRHFETGGDRMRFTFPALITSSIKLCRRYKNRAEEESDWQTKVSTILKFIRQL
TSILATQVEAPSIALRLFLLTAQIADECGFEDLTYDFYVQAFTVYEDSISESRAQLQAITLIIGTLAGAKVFGVD
NYDTLITKAALHGAKLLKKSHQATAVGLASHLWWQEVVGGESDDVEKEKSETPPAKGDDSEDTTKAYPHRDSKRV
LECLQKSLRIANSAIEEIVTIQLYCDTLDQYLYYFDHGAPAVAPKFVNSLVELITSSIDSISSPDVHPSQRAPPG
LVEGVQTPEMITRHFRNTLLHIQRRKAAATGGDSDIDSRWNEVEVVGAFLKMGITR*
Coding >Agabi119p4|012240
ATGGCACTACCAGCACCAGAGGAGGGCAAGCTCCTCAGTGAAGCACTCAACACCGTCAAAATCCAGGTGCAACAA
ATGAAGCGACACCTTGAACTGGATCAGCTGATGGATGCTCTCAAAAGTGCAAGTTTAATGCTTGCAGAATTGAGG
ACTTCGTCCCTGTCGCCTAAGCAATACTATGAGCTGTACATGGCCGTGTTCGACGCTCTTCGTCATCTATCCAAT
TATCTCTATGATGCTCACACCCAAGGCCGACATCATCTTGCAGATCTGTATGAACTTGTCCAATACGCCAGCAAT
ATCCTTCCCCGTCTCTACCTCATGATCACTGTTGGCTCCGTTTACATGTCGATACCAGATGCACCCGTCAAGGAG
ATAATGAAGGATATGATGGAAATGTCCAGAGGAGTTTTGCACCCTATCAGAGGCCTCTTTTTGCGTCATTATCTA
AGTGGACAAACGAGGGACAACTTGCCCATTGCGTCAGAACCAGGCCCTACTGGGAACTTACAGGACTCAATATCT
TTCGTATTGACCAATTTCATTGAAATGAATAAATTATGGGTACGTCTACAACATCAGGGTCATTCTCGCGATCGT
GAGAAGCGCGAAATGGAACGACGCGAGCTTCGCATCCTCGTTGGTACCAACCTTGTGCGGCTTAGCCAACTAGAT
GGTGTAGACTTGGACCTCTACCAGAAGACTATCCTTCCGAGCATTCTGGAACAAGTCGTCAGTTGCAAAGACGTC
ATTGCTCAAGAATACCTGATGGAGGTCGTGATTCAGGTTTTCACCGATGAATTCCACCTTCACAGTCTTGGGCCT
TTCCTTTCCTCTACCGCCCAACTCCACCCAAAAGTGAATATCAAACAAATTGTCATCGCTCTCATTGACCGACTT
GCGGCGTATGCTGCCCGAGAAGCCGAGACTGAAGATCCAGAGGAGACCAAACGACAAGAGGAGGCTGCCGCTAAA
CGCTTGGCGGAAAAGGTGAAAGAGCAGAAGAAATCCAGACAAAATGGCAGTTCTCAACCATCCCCGATGTCACCC
ACGAATTCCGAGGCTAACGCTTGGGCGGCCACCCCAACATCACCTACTATCGAGTCATCAGCCTCGAGCGGTCCG
GAAAAATCTTCAGTTTCCGGATCTCCTGCGACTTCTAACATAGAATTGAAGGGCAAAGAAAAAGAAGCGTCGCCT
GTCCGAAAATTCAGAGGTGTCCCGGATAATGTTCGATTGTTTGAAGTTTTCTGGCAACAAGTTGTAGAACTCATC
AAGGCTCGTCCAGATCTCTCAATCCAGGACATAACCGCCCTCTTTGTTTCTCTCACCAACCTTTCCGTCAGCTGC
TATCCCGACCGGTTGGAATATGTGGACCAAATTCTCGGTTTTACGGCCGAGAAGATCAAAGAATATAGTGATAAT
CCGGATTTGCATGCCCAACAAACATCATCGAATCTCCAAGCCCTACTTGTGGCGCCAATCAATTCCTATCAATCT
GTCCTTACATTACTCGCCATACCCAACTACGTACCCCTGCTAACGCGACAGCTGTTTTCCACGCGCCGTTCAATA
GCACATTCCATCATATCCTCGGTACTTAAGAATGAAACAATTATTGAGACGCCAGAAGATGTGGACGGTGTTTTG
GAGCTGTGTCACGTTCTAATCAAGGACCAATCTGATTTTGCATCCAATCAAAGTACGTCAATCGGTCAACAGGGT
CACATCAGGGAGGTGCGAAGACAAGGACCATATTTTGTGGAAAGAGAGGAGATGGCAGAGGAACAAGGATGGGTA
GCACGAATGGTTCATCTTTTCCGTGCAGAATCTCTTGACACACAGTTCGAGTTGTTACAAATTGCTCGTCGACAT
TTCGAAACTGGAGGTGACAGAATGCGGTTCACTTTCCCTGCTCTCATCACTTCATCTATTAAGCTTTGTCGACGT
TATAAGAACCGTGCGGAAGAGGAAAGCGACTGGCAGACTAAAGTGTCAACTATCTTGAAATTCATTAGGCAACTT
ACATCCATCCTAGCGACGCAAGTGGAAGCGCCCTCAATTGCTCTGCGGCTATTCCTTCTGACGGCACAGATTGCC
GACGAGTGTGGATTTGAGGACTTGACATATGACTTCTATGTGCAAGCCTTTACAGTTTACGAAGATAGCATCTCG
GAGTCTCGAGCTCAGCTCCAGGCTATAACGCTCATTATCGGTACCTTGGCCGGTGCAAAAGTCTTCGGTGTCGAC
AATTACGACACGCTCATCACTAAAGCAGCATTGCATGGTGCCAAGCTCTTGAAAAAGAGCCACCAAGCGACTGCT
GTAGGGCTTGCAAGTCATTTGTGGTGGCAGGAAGTTGTTGGGGGAGAATCTGACGACGTTGAGAAGGAGAAATCT
GAGACGCCACCAGCCAAGGGGGATGATTCAGAAGATACCACGAAGGCTTACCCACATCGGGACAGCAAACGGGTC
CTTGAATGTCTCCAAAAATCTCTTCGAATAGCCAATTCGGCTATTGAAGAGATTGTGACAATTCAATTGTACTGT
GATACCCTTGATCAATACCTCTACTACTTTGACCATGGTGCACCAGCTGTTGCACCCAAGTTTGTCAATAGTCTC
GTGGAACTCATAACTTCAAGTATCGACAGCATCTCTTCGCCCGATGTGCACCCCTCTCAGCGTGCTCCTCCTGGC
CTTGTTGAAGGTGTGCAAACGCCTGAGATGATTACGCGACATTTCCGGAATACCCTGTTACACATTCAACGAAGA
AAGGCCGCTGCGACGGGTGGGGATTCAGATATTGACTCGAGGTGGAACGAAGTTGAAGTGGTGGGCGCATTTCTA
AAGATGGGTATTACGCGGTGA
Transcript >Agabi119p4|012240
ATGGCACTACCAGCACCAGAGGAGGGCAAGCTCCTCAGTGAAGCACTCAACACCGTCAAAATCCAGGTGCAACAA
ATGAAGCGACACCTTGAACTGGATCAGCTGATGGATGCTCTCAAAAGTGCAAGTTTAATGCTTGCAGAATTGAGG
ACTTCGTCCCTGTCGCCTAAGCAATACTATGAGCTGTACATGGCCGTGTTCGACGCTCTTCGTCATCTATCCAAT
TATCTCTATGATGCTCACACCCAAGGCCGACATCATCTTGCAGATCTGTATGAACTTGTCCAATACGCCAGCAAT
ATCCTTCCCCGTCTCTACCTCATGATCACTGTTGGCTCCGTTTACATGTCGATACCAGATGCACCCGTCAAGGAG
ATAATGAAGGATATGATGGAAATGTCCAGAGGAGTTTTGCACCCTATCAGAGGCCTCTTTTTGCGTCATTATCTA
AGTGGACAAACGAGGGACAACTTGCCCATTGCGTCAGAACCAGGCCCTACTGGGAACTTACAGGACTCAATATCT
TTCGTATTGACCAATTTCATTGAAATGAATAAATTATGGGTACGTCTACAACATCAGGGTCATTCTCGCGATCGT
GAGAAGCGCGAAATGGAACGACGCGAGCTTCGCATCCTCGTTGGTACCAACCTTGTGCGGCTTAGCCAACTAGAT
GGTGTAGACTTGGACCTCTACCAGAAGACTATCCTTCCGAGCATTCTGGAACAAGTCGTCAGTTGCAAAGACGTC
ATTGCTCAAGAATACCTGATGGAGGTCGTGATTCAGGTTTTCACCGATGAATTCCACCTTCACAGTCTTGGGCCT
TTCCTTTCCTCTACCGCCCAACTCCACCCAAAAGTGAATATCAAACAAATTGTCATCGCTCTCATTGACCGACTT
GCGGCGTATGCTGCCCGAGAAGCCGAGACTGAAGATCCAGAGGAGACCAAACGACAAGAGGAGGCTGCCGCTAAA
CGCTTGGCGGAAAAGGTGAAAGAGCAGAAGAAATCCAGACAAAATGGCAGTTCTCAACCATCCCCGATGTCACCC
ACGAATTCCGAGGCTAACGCTTGGGCGGCCACCCCAACATCACCTACTATCGAGTCATCAGCCTCGAGCGGTCCG
GAAAAATCTTCAGTTTCCGGATCTCCTGCGACTTCTAACATAGAATTGAAGGGCAAAGAAAAAGAAGCGTCGCCT
GTCCGAAAATTCAGAGGTGTCCCGGATAATGTTCGATTGTTTGAAGTTTTCTGGCAACAAGTTGTAGAACTCATC
AAGGCTCGTCCAGATCTCTCAATCCAGGACATAACCGCCCTCTTTGTTTCTCTCACCAACCTTTCCGTCAGCTGC
TATCCCGACCGGTTGGAATATGTGGACCAAATTCTCGGTTTTACGGCCGAGAAGATCAAAGAATATAGTGATAAT
CCGGATTTGCATGCCCAACAAACATCATCGAATCTCCAAGCCCTACTTGTGGCGCCAATCAATTCCTATCAATCT
GTCCTTACATTACTCGCCATACCCAACTACGTACCCCTGCTAACGCGACAGCTGTTTTCCACGCGCCGTTCAATA
GCACATTCCATCATATCCTCGGTACTTAAGAATGAAACAATTATTGAGACGCCAGAAGATGTGGACGGTGTTTTG
GAGCTGTGTCACGTTCTAATCAAGGACCAATCTGATTTTGCATCCAATCAAAGTACGTCAATCGGTCAACAGGGT
CACATCAGGGAGGTGCGAAGACAAGGACCATATTTTGTGGAAAGAGAGGAGATGGCAGAGGAACAAGGATGGGTA
GCACGAATGGTTCATCTTTTCCGTGCAGAATCTCTTGACACACAGTTCGAGTTGTTACAAATTGCTCGTCGACAT
TTCGAAACTGGAGGTGACAGAATGCGGTTCACTTTCCCTGCTCTCATCACTTCATCTATTAAGCTTTGTCGACGT
TATAAGAACCGTGCGGAAGAGGAAAGCGACTGGCAGACTAAAGTGTCAACTATCTTGAAATTCATTAGGCAACTT
ACATCCATCCTAGCGACGCAAGTGGAAGCGCCCTCAATTGCTCTGCGGCTATTCCTTCTGACGGCACAGATTGCC
GACGAGTGTGGATTTGAGGACTTGACATATGACTTCTATGTGCAAGCCTTTACAGTTTACGAAGATAGCATCTCG
GAGTCTCGAGCTCAGCTCCAGGCTATAACGCTCATTATCGGTACCTTGGCCGGTGCAAAAGTCTTCGGTGTCGAC
AATTACGACACGCTCATCACTAAAGCAGCATTGCATGGTGCCAAGCTCTTGAAAAAGAGCCACCAAGCGACTGCT
GTAGGGCTTGCAAGTCATTTGTGGTGGCAGGAAGTTGTTGGGGGAGAATCTGACGACGTTGAGAAGGAGAAATCT
GAGACGCCACCAGCCAAGGGGGATGATTCAGAAGATACCACGAAGGCTTACCCACATCGGGACAGCAAACGGGTC
CTTGAATGTCTCCAAAAATCTCTTCGAATAGCCAATTCGGCTATTGAAGAGATTGTGACAATTCAATTGTACTGT
GATACCCTTGATCAATACCTCTACTACTTTGACCATGGTGCACCAGCTGTTGCACCCAAGTTTGTCAATAGTCTC
GTGGAACTCATAACTTCAAGTATCGACAGCATCTCTTCGCCCGATGTGCACCCCTCTCAGCGTGCTCCTCCTGGC
CTTGTTGAAGGTGTGCAAACGCCTGAGATGATTACGCGACATTTCCGGAATACCCTGTTACACATTCAACGAAGA
AAGGCCGCTGCGACGGGTGGGGATTCAGATATTGACTCGAGGTGGAACGAAGTTGAAGTGGTGGGCGCATTTCTA
AAGATGGGTATTACGCGGTGA
Gene >Agabi119p4|012240
ATGGCACTACCAGCACCAGAGGAGGGCAAGCTCCTCAGTGAAGCACTCAACACCGTCAAAATCCAGGTGCAACAA
ATGAAGCGACACCTTGTAAGCCATCTCATTAAATCGTGCTTTCCCATTCTAATTCTAATGATTCGTTTACAAAGG
AACTGGATCAGCTGATGGATGCTCTCAAAAGTGCAAGTTTAATGCTTGCAGAATTGAGGACTTCGTCCCTGTCGC
CTAAGCAATACTATGAGCTGTGTGCGTGAGCACGGAGTTTTGGGGTATTCTCACTGAGTTGTTTCCAGACATGGC
CGTGTTCGACGCTCTTCGTCATCTATCCAATTATCTCTATGATGCTCACACCCAAGGCCGACATCATCTTGCAGA
TCTGTATGAACTTGTCCAATACGCCAGCAATATCCTTCCCCGTCTCTACCTCATGATCACTGTTGGCTCCGTTTA
CATGTCGATACCAGATGCACCCGTCAAGGAGATAATGAAGGATATGATGGAAATGTCCAGAGGAGTTTTGCACCC
TATCAGAGGCCTCTTTTTGCGTCATTATCTAAGTGGACAAACGAGGGACAACTTGCCCATTGCGTCAGAACCAGG
GTGCGTTATATATTAATTTTGGCGGAACGTTTCACTTACATCTCATCTAGCCCTACTGGGAACTTACAGGACTCA
ATATCTTTCGTATTGACCAATTTCATTGAAATGAATAAATTATGGGTACGTCTACAACATCAGGGTCATTCTCGC
GATCGTGAGAAGCGCGAAATGGAACGACGCGAGCTTCGCATCCTCGTTGGTACCAACCTTGTGCGGCTTAGCCAA
CTAGATGGTGTAGACTTGGACCTCTACCAGAAGACTATCCTTCCGAGCATTCTGGAACAAGTCGTCAGTTGCAAA
GACGTCATTGCTCAAGAATACCTGATGGAGGTCGTGATTCAGGTAATTCTATTTTTGCTTGAGGGCTTTTAAGGT
CACCATTCACCTTCAGCTAGGTTTTCACCGATGAATTCCACCTTCACAGTCTTGGGCCTTTCCTTTCCTCTACCG
CCCAACTCCACCCAAAAGTGAATATCAAACAAATTGTCATCGCTCTCATTGACCGACTTGCGGCGTATGCTGCCC
GAGAAGCCGAGACTGAAGATCCAGAGGAGACCAAACGACAAGAGGAGGCTGCCGCTAAACGCTTGGCGGAAAAGG
TGAAAGAGCAGAAGAAATCCAGACAAAATGGCAGTTCTCAACCATCCCCGATGTCACCCACGAATTCCGAGGCTA
ACGCTTGGGCGGCCACCCCAACATCACCTACTATCGAGTCATCAGCCTCGAGCGGTCCGGAAAAATCTTCAGTTT
CCGGATCTCCTGCGACTTCTAACATAGAATTGAAGGGCAAAGAAAAAGAAGCGTCGCCTGTCCGAAAATTCAGAG
GTGTCCCGGATAATGTTCGATTGTTTGAAGTTTTCTGGCAACAAGTTGTAGAACTCATCAAGGTGAGTTGCCTAT
GGCCTAATTGTAGGCATATTATCTCACACTTGTTCAAAGGCTCGTCCAGATCTCTCAATCCAGGACATAACCGCC
CTCTTTGTTTCTCTCACCAACCTTTCCGTCAGCTGCTATCCCGACCGGTTGGAATATGTGGACCAAATTCTCGGT
TTTACGGCCGAGAAGATCAAAGAATATAGTGATAAGTGAGTCGACTCACAAAGCTTCCTGCCTTTGACATGACGC
ATGTTGCAGTCCGGATTTGCATGCCCAACAAACATCATCGAATCTCCAAGCCCTACTTGTGGCGCCAATCAATTC
CTATCAATCTGTCCTTACATTACTCGCCATACCCAACTACGTACCCCTGCTAACGCGACAGCTGTTTTCCACGCG
CCGTTCAATAGCACATTCCATCATATCCTCGGTACTTAAGAATGAAACAATTATTGAGACGCCAGAAGATGTGGA
CGGTGTTTTGGAGCTGTGTCACGTTCTAATCAAGGACCAATCTGATTTTGCATCCAATCAAAGTACGTCAATCGG
TCAACAGGGTCACATCAGGGAGGTGCGAAGACAAGGACCATATTTTGTGGAAAGAGAGGAGATGGCAGAGGAACA
AGGATGGGTAGCACGAATGGTTCATCTTTTCCGTGCAGAATCTCTTGACACACAGTTCGAGGTATGTCTGTTTGC
CTATCTCCTTGTTTTTAAACTCCTGACGTGGCCGTCATAGTTGTTACAAATTGCTCGTCGACATTTCGAAACTGG
AGGTGACAGAATGCGGTTCACTTTCCCTGCTCTCATCACTTCATCTATTAAGCTTTGTCGACGTTATAAGAACCG
TGCGGAAGAGGTGAATAAGCTTATTGTTTTTCTAAATATTAGATTGACACATCGACGTAGGAAAGCGACTGGCAG
ACTAAAGTGTCAACTATCTTGAAATTCATTAGGCAACTTACATCCATCCTAGCGACGCAAGTGGAAGCGCCCTCA
ATTGCTCTGCGGCTATTCCTTCTGACGGCACAGATTGCCGACGAGTGTGGATTTGAGGACTTGACATATGACTTC
TATGTGCAAGCCTTTACAGTTTACGAAGATAGCATCTCGGAGTCTCGAGCTCAGCTCCAGGCTATAACGCTCATT
ATCGGTACCTTGGCCGGTGCAAAAGTCTTCGGTGTCGACAATTACGACACGCTCATCACTAAAGCAGCATTGCAT
GGTGCCAAGCTCTTGAAAAAGAGCCACCAAGCGACTGCTGTAGGGCTTGCAAGTCATTTGTGGTGGCAGGAAGTT
GTTGGGGGAGAATCTGACGACGTTGAGAAGGAGAAATCTGAGACGCCACCAGCCAAGGGGGATGATTCAGAAGAT
ACCACGAAGGCTGTTCGTATATTTCTGTTCCCTCTTTATACGTGTATACTGAAAGGCTTGCGTATAGTACCCACA
TCGGGACAGCAAACGGGTCCTTGAATGTCTCCAAAAATCTCTTCGAATAGCCAATTCGGCTATTGAAGAGATTGT
GACAATTCAATTGTACTGTGATACCCTTGATCAATACCTCTACTACTTTGACCATGGTGCACCAGCTGTATGTCT
TTTCTTTTATTACACTACACTAATCTCACCCACAACATTCAGGTTGCACCCAAGTTTGTCAATAGTCTCGTGGAA
CTCATAACTTCAAGTATCGACAGCATCTCTTCGCCCGATGTGCACCCCTCTCAGCGTGCTCCTCCTGGCCTTGTT
GAAGGTGTGCAAACGCCTGAGATGATTACGCGACATTTCCGGAATACCCTGTTACACATTCAACGAAGAAAGGCC
GCTGCGACGGGTGGGGATTCAGATATTGACTCGAGGTGGAACGAAGTTGAAGTGGTGGGCGCATTTCTAAAGATG
GGTATTACGCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail