Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|012180
Gene name
Locationscaffold_01a:2925963..2927170
Strand-
Gene length (bp)1207
Transcript length (bp)789
Coding sequence length (bp)789
Protein length (aa) 263

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02545 Maf Maf-like protein 3.1E-43 22 220

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O95671|ASML_HUMAN N-acetylserotonin O-methyltransferase-like protein OS=Homo sapiens GN=ASMTL PE=1 SV=3 12 220 1.0E-34
sp|O14141|YEW3_SCHPO Maf-like protein C3G6.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3G6.03c PE=1 SV=2 10 242 2.0E-32
sp|Q0SR36|Y2112_CLOPS Maf-like protein CPR_2112 OS=Clostridium perfringens (strain SM101 / Type A) GN=CPR_2112 PE=3 SV=1 22 220 9.0E-27
sp|Q0TNG7|Y2400_CLOP1 Maf-like protein CPF_2400 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=CPF_2400 PE=3 SV=1 22 220 3.0E-26
sp|Q8XIH4|Y2145_CLOPE Maf-like protein CPE2145 OS=Clostridium perfringens (strain 13 / Type A) GN=maf PE=3 SV=1 22 220 1.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O95671|ASML_HUMAN N-acetylserotonin O-methyltransferase-like protein OS=Homo sapiens GN=ASMTL PE=1 SV=3 12 220 1.0E-34
sp|O14141|YEW3_SCHPO Maf-like protein C3G6.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3G6.03c PE=1 SV=2 10 242 2.0E-32
sp|Q0SR36|Y2112_CLOPS Maf-like protein CPR_2112 OS=Clostridium perfringens (strain SM101 / Type A) GN=CPR_2112 PE=3 SV=1 22 220 9.0E-27
sp|Q0TNG7|Y2400_CLOP1 Maf-like protein CPF_2400 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=CPF_2400 PE=3 SV=1 22 220 3.0E-26
sp|Q8XIH4|Y2145_CLOPE Maf-like protein CPE2145 OS=Clostridium perfringens (strain 13 / Type A) GN=maf PE=3 SV=1 22 220 1.0E-25
sp|B0K437|Y2136_THEPX Maf-like protein Teth514_2136 OS=Thermoanaerobacter sp. (strain X514) GN=Teth514_2136 PE=3 SV=1 22 220 2.0E-25
sp|B0KAE1|Y1454_THEP3 Maf-like protein Teth39_1454 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=Teth39_1454 PE=3 SV=1 22 220 2.0E-25
sp|Q5JI98|Y954_THEKO Maf-like protein TK0954 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK0954 PE=3 SV=1 23 230 3.0E-22
sp|Q6AMI5|Y1711_DESPS Maf-like protein DP1711 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=DP1711 PE=3 SV=1 20 220 3.0E-22
sp|Q9RV24|Y1206_DEIRA Maf-like protein DR_1206 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=DR_1206 PE=3 SV=1 22 242 1.0E-21
sp|B9MRU6|Y1300_CALBD Maf-like protein Athe_1300 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=Athe_1300 PE=3 SV=1 21 220 3.0E-21
sp|Q99210|YO111_YEAST Maf-like protein YOR111W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR111W PE=1 SV=1 23 220 7.0E-21
sp|B7IFS5|Y448_THEAB Maf-like protein THA_448 OS=Thermosipho africanus (strain TCF52B) GN=THA_448 PE=3 SV=1 22 220 1.0E-20
sp|Q8RBC6|Y896_CALS4 Maf-like protein TTE0896 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=maf PE=3 SV=1 22 220 1.0E-20
sp|Q1IYX1|Y1267_DEIGD Maf-like protein Dgeo_1267 OS=Deinococcus geothermalis (strain DSM 11300) GN=Dgeo_1267 PE=3 SV=1 23 220 2.0E-20
sp|Q1MQH1|Y702_LAWIP Maf-like protein LI0702 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=LI0702 PE=3 SV=1 23 220 2.0E-20
sp|A8FFU1|MAF_BACP2 Septum formation protein Maf OS=Bacillus pumilus (strain SAFR-032) GN=maf PE=3 SV=1 22 220 5.0E-20
sp|A4XKL5|Y1865_CALS8 Maf-like protein Csac_1865 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=Csac_1865 PE=3 SV=1 21 220 1.0E-19
sp|Q55G28|MAFL1_DICDI Maf-like protein DDB_G0267852 OS=Dictyostelium discoideum GN=DDB_G0267852 PE=3 SV=1 17 220 2.0E-19
sp|Q9KUU7|Y418_VIBCH Maf-like protein VC_0418 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=VC_0418 PE=3 SV=2 22 220 2.0E-19
sp|Q81LD6|MAF_BACAN Septum formation protein Maf OS=Bacillus anthracis GN=maf PE=3 SV=1 21 220 4.0E-19
sp|C3L6Y6|MAF_BACAC Septum formation protein Maf OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=maf PE=3 SV=1 21 220 4.0E-19
sp|C3P9E0|MAF_BACAA Septum formation protein Maf OS=Bacillus anthracis (strain A0248) GN=maf PE=3 SV=1 21 220 4.0E-19
sp|B8I6Q1|Y2565_CLOCE Maf-like protein Ccel_2565 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=Ccel_2565 PE=3 SV=1 21 220 4.0E-19
sp|B6YWV3|Y1078_THEON Maf-like protein TON_1078 OS=Thermococcus onnurineus (strain NA1) GN=TON_1078 PE=3 SV=1 23 230 4.0E-19
sp|Q7NH22|Y2715_GLOVI Maf-like protein glr2715 OS=Gloeobacter violaceus (strain PCC 7421) GN=glr2715 PE=3 SV=1 22 220 4.0E-19
sp|Q72ZX1|MAF_BACC1 Septum formation protein Maf OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=maf PE=3 SV=1 21 220 7.0E-19
sp|A4J7K7|Y2550_DESRM Maf-like protein Dred_2550 OS=Desulfotomaculum reducens (strain MI-1) GN=Dred_2550 PE=3 SV=1 23 220 8.0E-19
sp|B1I4S1|Y1468_DESAP Maf-like protein Daud_1468 OS=Desulforudis audaxviator (strain MP104C) GN=Daud_1468 PE=3 SV=1 22 220 9.0E-19
sp|C1ETQ1|MAF_BACC3 Septum formation protein Maf OS=Bacillus cereus (strain 03BB102) GN=maf PE=3 SV=1 21 220 1.0E-18
sp|B7JQ48|MAF_BACC0 Septum formation protein Maf OS=Bacillus cereus (strain AH820) GN=maf PE=3 SV=1 21 220 1.0E-18
sp|Q633Y9|MAF_BACCZ Septum formation protein Maf OS=Bacillus cereus (strain ZK / E33L) GN=maf PE=3 SV=1 21 220 2.0E-18
sp|B7IIW6|MAF_BACC2 Septum formation protein Maf OS=Bacillus cereus (strain G9842) GN=maf PE=3 SV=1 21 220 2.0E-18
sp|Q6HD71|MAF_BACHK Septum formation protein Maf OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=maf PE=3 SV=1 21 220 2.0E-18
sp|Q8U476|Y216_PYRFU Maf-like protein PF0216 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0216 PE=3 SV=1 21 220 3.0E-18
sp|C5A216|Y1933_THEGJ Maf-like protein TGAM_1933 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=TGAM_1933 PE=3 SV=1 23 230 3.0E-18
sp|A3DBJ9|Y087_CLOTH Maf-like protein Cthe_0087 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=Cthe_0087 PE=3 SV=1 22 220 3.0E-18
sp|B4UJ23|Y1353_ANASK Maf-like protein AnaeK_1353 OS=Anaeromyxobacter sp. (strain K) GN=AnaeK_1353 PE=3 SV=1 21 220 3.0E-18
sp|Q87LC4|Y2688_VIBPA Maf-like protein VP2688 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=VP2688 PE=3 SV=1 23 220 4.0E-18
sp|Q8TSP7|Y748_METAC Maf-like protein MA_0748 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_0748 PE=3 SV=1 21 226 4.0E-18
sp|A7Z794|MAF_BACMF Septum formation protein Maf OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=maf PE=3 SV=1 21 220 4.0E-18
sp|A6TQH7|Y2288_ALKMQ Maf-like protein Amet_2288 OS=Alkaliphilus metalliredigens (strain QYMF) GN=Amet_2288 PE=3 SV=1 21 240 4.0E-18
sp|B7HE87|MAF_BACC4 Septum formation protein Maf OS=Bacillus cereus (strain B4264) GN=maf PE=3 SV=1 21 220 8.0E-18
sp|B2TK54|Y561_CLOBB Maf-like protein CLL_A0561 OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=CLL_A0561 PE=3 SV=1 22 220 8.0E-18
sp|Q5E7X6|Y375_VIBF1 Maf-like protein VF_0375 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=VF_0375 PE=3 SV=1 20 220 9.0E-18
sp|Q11VI6|Y1308_CYTH3 Maf-like protein CHU_1308 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=CHU_1308 PE=3 SV=1 15 220 9.0E-18
sp|A5D426|Y815_PELTS Maf-like protein PTH_0815 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=PTH_0815 PE=3 SV=1 21 220 1.0E-17
sp|B2V089|Y546_CLOBA Maf-like protein CLH_0546 OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=CLH_0546 PE=3 SV=1 22 220 1.0E-17
sp|A5G7S1|Y3686_GEOUR Maf-like protein Gura_3686 OS=Geobacter uraniireducens (strain Rf4) GN=Gura_3686 PE=3 SV=1 23 220 1.0E-17
sp|Q817R9|MAF_BACCR Septum formation protein Maf OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=maf PE=3 SV=1 21 220 1.0E-17
sp|Q2IKU4|Y2502_ANADE Maf-like protein Adeh_2502 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=Adeh_2502 PE=3 SV=1 22 220 1.0E-17
sp|C5D5H8|MAF_GEOSW Septum formation protein Maf OS=Geobacillus sp. (strain WCH70) GN=maf PE=3 SV=1 21 220 2.0E-17
sp|Q1GRU5|Y1915_SPHAL Maf-like protein Sala_1915 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=Sala_1915 PE=3 SV=1 23 226 2.0E-17
sp|Q892M0|Y2076_CLOTE Maf-like protein CTC_02076 OS=Clostridium tetani (strain Massachusetts / E88) GN=CTC_02076 PE=3 SV=2 23 220 2.0E-17
sp|B7HQL2|MAF_BACC7 Septum formation protein Maf OS=Bacillus cereus (strain AH187) GN=maf PE=3 SV=1 21 220 2.0E-17
sp|Q3KI22|Y841_PSEPF Maf-like protein Pfl01_0841 OS=Pseudomonas fluorescens (strain Pf0-1) GN=Pfl01_0841 PE=3 SV=1 21 220 2.0E-17
sp|Q7MHE0|Y2931_VIBVY Maf-like protein VV2931 OS=Vibrio vulnificus (strain YJ016) GN=VV2931 PE=3 SV=1 22 220 3.0E-17
sp|Q8DCG8|Y1452_VIBVU Maf-like protein VV1_1452 OS=Vibrio vulnificus (strain CMCP6) GN=VV1_1452 PE=3 SV=1 22 220 3.0E-17
sp|Q65GL2|MAF_BACLD Septum formation protein Maf OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=maf PE=3 SV=1 21 220 3.0E-17
sp|Q0AWG2|Y1643_SYNWW Maf-like protein Swol_1643 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=Swol_1643 PE=3 SV=1 25 220 4.0E-17
sp|A8MHM5|Y1767_ALKOO Maf-like protein Clos_1767 OS=Alkaliphilus oremlandii (strain OhILAs) GN=Clos_1767 PE=3 SV=1 21 226 4.0E-17
sp|Q8RFE6|Y759_FUSNN Maf-like protein FN0759 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=FN0759 PE=3 SV=1 23 217 4.0E-17
sp|A7HA27|Y1366_ANADF Maf-like protein Anae109_1366 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=Anae109_1366 PE=3 SV=1 22 220 5.0E-17
sp|Q97JN3|Y1240_CLOAB Maf-like protein CA_C1240 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C1240 PE=3 SV=1 22 220 5.0E-17
sp|Q5KWN2|MAF_GEOKA Septum formation protein Maf OS=Geobacillus kaustophilus (strain HTA426) GN=maf PE=3 SV=1 24 220 6.0E-17
sp|B8JH92|Y1450_ANAD2 Maf-like protein A2cp1_1450 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=A2cp1_1450 PE=3 SV=1 22 220 8.0E-17
sp|Q989F1|Y6452_RHILO Maf-like protein mll6452 OS=Rhizobium loti (strain MAFF303099) GN=mll6452 PE=3 SV=1 21 220 8.0E-17
sp|B9IZ30|MAF_BACCQ Septum formation protein Maf OS=Bacillus cereus (strain Q1) GN=maf PE=3 SV=1 21 220 9.0E-17
sp|Q39X87|Y895_GEOMG Maf-like protein Gmet_0895 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=Gmet_0895 PE=3 SV=1 19 220 1.0E-16
sp|C1FVY3|Y3400_CLOBJ Maf-like protein CLM_3400 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=CLM_3400 PE=3 SV=1 21 220 1.0E-16
sp|C4ZDP0|Y3290_EUBR3 Maf-like protein EUBREC_3290 OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=EUBREC_3290 PE=3 SV=1 22 220 2.0E-16
sp|A5N6I4|Y864_CLOK5 Maf-like protein CKL_0864 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=CKL_0864 PE=3 SV=1 22 220 2.0E-16
sp|B9E003|Y777_CLOK1 Maf-like protein CKR_0777 OS=Clostridium kluyveri (strain NBRC 12016) GN=CKR_0777 PE=3 SV=1 22 220 2.0E-16
sp|Q02169|MAF_BACSU Septum formation protein Maf OS=Bacillus subtilis (strain 168) GN=maf PE=1 SV=1 21 220 2.0E-16
sp|O67613|Y1718_AQUAE Maf-like protein aq_1718 OS=Aquifex aeolicus (strain VF5) GN=aq_1718 PE=3 SV=1 22 220 2.0E-16
sp|Q3AF81|Y340_CARHZ Maf-like protein CHY_0340 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=CHY_0340 PE=3 SV=1 22 220 3.0E-16
sp|Q12IW9|Y3331_SHEDO Maf-like protein Sden_3331 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=Sden_3331 PE=3 SV=1 24 220 3.0E-16
sp|Q1D912|Y2642_MYXXD Maf-like protein MXAN_2642 OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_2642 PE=3 SV=1 23 220 3.0E-16
sp|Q1QVC0|Y2237_CHRSD Maf-like protein Csal_2237 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=Csal_2237 PE=3 SV=1 25 230 3.0E-16
sp|Q2SBH1|Y5331_HAHCH Maf-like protein HCH_05331 OS=Hahella chejuensis (strain KCTC 2396) GN=HCH_05331 PE=3 SV=1 21 220 3.0E-16
sp|Q6MQJ7|Y469_BDEBA Maf-like protein Bd0469 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=Bd0469 PE=3 SV=1 23 220 4.0E-16
sp|A6LQP7|Y489_CLOB8 Maf-like protein Cbei_0489 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=Cbei_0489 PE=3 SV=1 22 220 5.0E-16
sp|A7FXW4|Y3029_CLOB1 Maf-like protein CLB_3029 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=CLB_3029 PE=3 SV=1 21 220 5.0E-16
sp|A5I684|Y3004_CLOBH Maf-like protein CBO3004/CLC_2901 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=CBO3004 PE=3 SV=1 21 220 5.0E-16
sp|B1IM03|Y1540_CLOBK Maf-like protein CLD_1540 OS=Clostridium botulinum (strain Okra / Type B1) GN=CLD_1540 PE=3 SV=1 21 220 5.0E-16
sp|Q32B92|YCEF_SHIDS Maf-like protein YceF OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=yceF PE=3 SV=1 23 220 6.0E-16
sp|C3L3L1|Y3262_CLOB6 Maf-like protein CLJ_B3262 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=CLJ_B3262 PE=3 SV=1 21 220 7.0E-16
sp|Q1GZF7|Y2113_METFK Maf-like protein Mfla_2113 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=Mfla_2113 PE=3 SV=1 22 246 8.0E-16
sp|Q3YX01|YCEF2_SHISS Maf-like protein YceF 2 OS=Shigella sonnei (strain Ss046) GN=yceF2 PE=3 SV=1 23 220 9.0E-16
sp|P58629|YHDE_ECO57 Maf-like protein YhdE OS=Escherichia coli O157:H7 GN=yhdE PE=3 SV=1 23 220 1.0E-15
sp|B1KZT1|Y2388_CLOBM Maf-like protein CLK_2388 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=CLK_2388 PE=3 SV=1 21 220 1.0E-15
sp|O59604|Y1941_PYRHO Maf-like protein PH1941 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH1941 PE=3 SV=1 23 220 1.0E-15
sp|Q31WB6|YCEF2_SHIBS Maf-like protein YceF 2 OS=Shigella boydii serotype 4 (strain Sb227) GN=yceF2 PE=3 SV=1 23 220 2.0E-15
sp|A9VIS9|MAF_BACWK Septum formation protein Maf OS=Bacillus weihenstephanensis (strain KBAB4) GN=maf PE=3 SV=1 21 220 2.0E-15
sp|Q11LY4|Y186_CHESB Maf-like protein Meso_0186 OS=Chelativorans sp. (strain BNC1) GN=Meso_0186 PE=3 SV=1 22 220 3.0E-15
sp|Q8FD47|YHDE_ECOL6 Maf-like protein YhdE OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=yhdE PE=3 SV=1 23 220 3.0E-15
sp|Q1R692|YCEF2_ECOUT Maf-like protein YceF 2 OS=Escherichia coli (strain UTI89 / UPEC) GN=yceF2 PE=3 SV=1 23 220 3.0E-15
sp|Q0TCL8|YCEF2_ECOL5 Maf-like protein YceF 2 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=yceF2 PE=3 SV=1 23 220 3.0E-15
sp|A7GHM0|Y3058_CLOBL Maf-like protein CLI_3058 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=CLI_3058 PE=3 SV=1 21 220 4.0E-15
sp|Q142M3|Y1178_BURXL Maf-like protein Bxeno_A1178 OS=Burkholderia xenovorans (strain LB400) GN=Bxeno_A1178 PE=3 SV=1 23 226 4.0E-15
sp|Q15ZH0|Y186_PSEA6 Maf-like protein Patl_0186 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=Patl_0186 PE=3 SV=1 23 220 4.0E-15
sp|Q67SI8|Y370_SYMTH Maf-like protein STH370 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=STH370 PE=3 SV=1 21 220 5.0E-15
sp|Q83JE1|YHDE_SHIFL Maf-like protein YhdE OS=Shigella flexneri GN=yhdE PE=3 SV=1 23 220 7.0E-15
sp|C6E559|Y1532_GEOSM Maf-like protein GM21_1532 OS=Geobacter sp. (strain M21) GN=GM21_1532 PE=3 SV=1 18 220 7.0E-15
sp|Q46BZ6|Y1652_METBF Maf-like protein Mbar_A1652 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=Mbar_A1652 PE=3 SV=1 21 226 8.0E-15
sp|B2UPE6|Y586_AKKM8 Maf-like protein Amuc_0586 OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=Amuc_0586 PE=3 SV=1 23 220 1.0E-14
sp|Q74A46|Y2545_GEOSL Maf-like protein GSU2545 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=GSU2545 PE=3 SV=1 18 220 1.0E-14
sp|P25536|YHDE_ECOLI Maf-like protein YhdE OS=Escherichia coli (strain K12) GN=yhdE PE=1 SV=1 23 220 1.0E-14
sp|Q8PVQ2|Y1910_METMA Maf-like protein MM_1910 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_1910 PE=3 SV=2 21 226 2.0E-14
sp|Q11A17|Y163_TRIEI Maf-like protein Tery_0163 OS=Trichodesmium erythraeum (strain IMS101) GN=Tery_0163 PE=3 SV=1 23 220 2.0E-14
sp|Q12TU6|Y2269_METBU Maf-like protein Mbur_2269 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=Mbur_2269 PE=3 SV=1 21 226 3.0E-14
sp|Q2LSD6|Y1120_SYNAS Maf-like protein SYNAS_11200 OS=Syntrophus aciditrophicus (strain SB) GN=SYNAS_11200 PE=3 SV=2 21 220 3.0E-14
sp|A6LJI7|Y214_THEM4 Maf-like protein Tmel_0214 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=Tmel_0214 PE=3 SV=1 23 220 3.0E-14
sp|Q2KYV3|Y2213_BORA1 Maf-like protein BAV2213 OS=Bordetella avium (strain 197N) GN=BAV2213 PE=3 SV=1 22 226 4.0E-14
sp|Q9K8H3|MAF_BACHD Septum formation protein Maf OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=maf PE=3 SV=1 21 220 4.0E-14
sp|P58630|YHDE_SALTY Maf-like protein YhdE OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yhdE PE=3 SV=1 23 220 4.0E-14
sp|Q57J97|YCEF2_SALCH Maf-like protein YceF 2 OS=Salmonella choleraesuis (strain SC-B67) GN=yceF2 PE=3 SV=1 23 220 4.0E-14
sp|Q5PJV0|YCEF2_SALPA Maf-like protein YceF 2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=yceF2 PE=3 SV=1 23 220 5.0E-14
sp|Q1IV55|Y240_KORVE Maf-like protein Acid345_0240 OS=Koribacter versatilis (strain Ellin345) GN=Acid345_0240 PE=3 SV=1 23 220 5.0E-14
sp|A0PZG3|Y1686_CLONN Maf-like protein NT01CX_1686 OS=Clostridium novyi (strain NT) GN=NT01CX_1686 PE=3 SV=1 22 220 5.0E-14
sp|Q21FT3|Y3189_SACD2 Maf-like protein Sde_3189 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=Sde_3189 PE=3 SV=1 23 226 6.0E-14
sp|P58631|YHDE_SALTI Maf-like protein YhdE OS=Salmonella typhi GN=yhdE PE=3 SV=1 23 220 6.0E-14
sp|Q3A7I0|Y404_PELCD Maf-like protein Pcar_0404 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=Pcar_0404 PE=3 SV=1 19 248 6.0E-14
sp|Q4KIA3|Y899_PSEF5 Maf-like protein PFL_0899 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=PFL_0899 PE=3 SV=1 23 220 6.0E-14
sp|Q6MDL5|Y610_PARUW Maf-like protein pc0610 OS=Protochlamydia amoebophila (strain UWE25) GN=pc0610 PE=3 SV=1 22 220 7.0E-14
sp|A9NE14|Y1383_ACHLI Maf-like protein ACL_1383 OS=Acholeplasma laidlawii (strain PG-8A) GN=ACL_1383 PE=3 SV=1 23 220 8.0E-14
sp|Q9UXZ1|Y1716_PYRAB Maf-like protein PYRAB17160 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB17160 PE=3 SV=1 23 220 8.0E-14
sp|Q5QWE2|Y384_IDILO Maf-like protein IL0384 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=IL0384 PE=3 SV=1 22 220 8.0E-14
sp|Q72EP2|Y527_DESVH Maf-like protein DVU_0527 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=DVU_0527 PE=3 SV=1 23 220 8.0E-14
sp|Q2RL24|Y535_MOOTA Maf-like protein Moth_0535 OS=Moorella thermoacetica (strain ATCC 39073) GN=Moth_0535 PE=3 SV=1 21 220 9.0E-14
sp|Q6FDX8|Y829_ACIAD Maf-like protein ACIAD0829 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ACIAD0829 PE=3 SV=1 25 220 1.0E-13
sp|Q5SJ26|Y1188_THET8 Maf-like protein TTHA1188 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA1188 PE=3 SV=1 23 236 2.0E-13
sp|Q73K74|Y2348_TREDE Maf-like protein TDE_2348 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=TDE_2348 PE=3 SV=1 21 220 2.0E-13
sp|Q07WQ2|Y3735_SHEFN Maf-like protein Sfri_3735 OS=Shewanella frigidimarina (strain NCIMB 400) GN=Sfri_3735 PE=3 SV=1 24 220 2.0E-13
sp|B5YF11|Y1299_DICT6 Maf-like protein DICTH_1299 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=DICTH_1299 PE=3 SV=1 21 220 2.0E-13
sp|Q18B07|Y1143_PEPD6 Maf-like protein CD630_11430 OS=Peptoclostridium difficile (strain 630) GN=CD630_11430 PE=3 SV=1 23 220 2.0E-13
sp|Q31FH4|Y1507_THICR Maf-like protein Tcr_1507 OS=Thiomicrospira crunogena (strain XCL-2) GN=Tcr_1507 PE=3 SV=1 21 220 2.0E-13
sp|Q2YPC2|Y281_BRUA2 Maf-like protein BAB1_0281 OS=Brucella abortus (strain 2308) GN=BAB1_0281 PE=3 SV=1 22 220 3.0E-13
sp|Q57FA3|Y276_BRUAB Maf-like protein BruAb1_0276 OS=Brucella abortus biovar 1 (strain 9-941) GN=BruAb1_0276 PE=3 SV=1 22 220 3.0E-13
sp|Q8G2R6|Y248_BRUSU Maf-like protein BR0248/BS1330_I0249 OS=Brucella suis biovar 1 (strain 1330) GN=maf-1 PE=3 SV=1 22 220 3.0E-13
sp|Q8YF55|Y1672_BRUME Maf-like protein BMEI1672 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=BMEI1672 PE=3 SV=2 22 220 3.0E-13
sp|Q82ZA4|Y3165_ENTFA Maf-like protein EF_3165 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=maf PE=3 SV=1 22 220 3.0E-13
sp|Q8EA14|Y4095_SHEON Maf-like protein SO_4095 OS=Shewanella oneidensis (strain MR-1) GN=SO_4095 PE=3 SV=1 23 220 3.0E-13
sp|A0M2D8|Y1813_GRAFK Maf-like protein GFO_1813 OS=Gramella forsetii (strain KT0803) GN=GFO_1813 PE=3 SV=1 18 220 4.0E-13
sp|Q0ABM5|Y408_ALKEH Maf-like protein Mlg_0408 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=Mlg_0408 PE=3 SV=1 23 226 4.0E-13
sp|Q4ZNT2|Y4160_PSEU2 Maf-like protein Psyr_4160 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=Psyr_4160 PE=3 SV=1 23 220 4.0E-13
sp|A6GZH5|Y1422_FLAPJ Maf-like protein FP1422 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=FP1422 PE=3 SV=1 16 220 4.0E-13
sp|Q72JE7|Y825_THET2 Maf-like protein TT_C0825 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=TT_C0825 PE=3 SV=1 23 236 5.0E-13
sp|P58632|Y3075_NOSS1 Maf-like protein all3075 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all3075 PE=3 SV=1 18 220 5.0E-13
sp|Q39E95|Y5627_BURL3 Maf-like protein Bcep18194_A5627 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=Bcep18194_A5627 PE=3 SV=1 23 226 5.0E-13
sp|Q823U1|Y314_CHLCV Maf-like protein CCA_00314 OS=Chlamydophila caviae (strain GPIC) GN=CCA_00314 PE=3 SV=1 22 223 6.0E-13
sp|B5EHR3|Y2708_GEOBB Maf-like protein Gbem_2708 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=Gbem_2708 PE=3 SV=1 18 220 6.0E-13
sp|B2RIL9|Y695_PORG3 Maf-like protein PGN_0695 OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=PGN_0695 PE=3 SV=1 15 220 8.0E-13
sp|B8E0U2|Y1405_DICTD Maf-like protein Dtur_1405 OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=Dtur_1405 PE=3 SV=1 21 220 8.0E-13
sp|Q7MWG0|Y657_PORGI Maf-like protein PG_0657 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=maf PE=3 SV=2 15 220 8.0E-13
sp|Q47VG7|Y4557_COLP3 Maf-like protein CPS_4557 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=CPS_4557 PE=3 SV=1 20 220 9.0E-13
sp|Q6LMA4|Y3267_PHOPR Maf-like protein PBPRA3267 OS=Photobacterium profundum GN=PBPRA3267 PE=3 SV=1 22 220 9.0E-13
sp|Q1BUW3|Y1688_BURCA Maf-like protein Bcen_1688 OS=Burkholderia cenocepacia (strain AU 1054) GN=Bcen_1688 PE=3 SV=1 23 226 9.0E-13
sp|Q3MEX6|Y836_ANAVT Maf-like protein Ava_0836 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=Ava_0836 PE=3 SV=1 18 220 1.0E-12
sp|Q88PB4|Y936_PSEPK Maf-like protein PP_0936 OS=Pseudomonas putida (strain KT2440) GN=maf-1 PE=3 SV=1 23 220 1.0E-12
sp|A9KHL6|Y1933_CLOPH Maf-like protein Cphy_1933 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=Cphy_1933 PE=3 SV=1 22 220 1.0E-12
sp|Q253S7|Y689_CHLFF Maf-like protein CF0689 OS=Chlamydophila felis (strain Fe/C-56) GN=CF0689 PE=3 SV=1 22 223 2.0E-12
sp|A3DMH6|Y734_STAMF Maf-like protein Smar_0734 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=Smar_0734 PE=3 SV=1 21 220 2.0E-12
sp|Q2W1Y3|Y3338_MAGSA Maf-like protein amb3338 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=amb3338 PE=3 SV=1 23 226 2.0E-12
sp|Q7P1T8|Y124_CHRVO Maf-like protein CV_0124 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=CV_0124 PE=3 SV=1 19 220 2.0E-12
sp|Q7W7U4|Y2416_BORPA Maf-like protein BPP2416 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=BPP2416 PE=3 SV=1 22 220 3.0E-12
sp|Q7WL84|Y1865_BORBR Maf-like protein BB1865 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=BB1865 PE=3 SV=1 22 220 3.0E-12
sp|Q1QDI9|Y481_PSYCK Maf-like protein Pcryo_0481 OS=Psychrobacter cryohalolentis (strain K5) GN=Pcryo_0481 PE=3 SV=2 23 220 3.0E-12
sp|B7K400|Y2532_CYAP8 Maf-like protein PCC8801_2532 OS=Cyanothece sp. (strain PCC 8801) GN=PCC8801_2532 PE=3 SV=1 23 220 4.0E-12
sp|Q1AVT5|Y1531_RUBXD Maf-like protein Rxyl_1531 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=Rxyl_1531 PE=3 SV=1 23 220 5.0E-12
sp|B0C1T2|Y1059_ACAM1 Maf-like protein AM1_1059 OS=Acaryochloris marina (strain MBIC 11017) GN=AM1_1059 PE=3 SV=1 24 220 5.0E-12
sp|Q0HZH0|Y482_SHESR Maf-like protein Shewmr7_0482 OS=Shewanella sp. (strain MR-7) GN=Shewmr7_0482 PE=3 SV=1 23 220 5.0E-12
sp|Q0VS67|Y533_ALCBS Maf-like protein ABO_0533 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=ABO_0533 PE=3 SV=1 23 220 5.0E-12
sp|B8HN65|Y4892_CYAP4 Maf-like protein Cyan7425_4892 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=Cyan7425_4892 PE=3 SV=1 22 220 5.0E-12
sp|Q1C1M9|Y3681_YERPA Maf-like protein YPA_3681 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=YPA_3681 PE=3 SV=2 25 220 6.0E-12
sp|P58636|Y3668_YERPE Maf-like protein YPO3668/y0197/YP_3878 OS=Yersinia pestis GN=YPO3668 PE=3 SV=1 25 220 6.0E-12
sp|Q665F6|Y3562_YERPS Maf-like protein YPTB3562 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=YPTB3562 PE=3 SV=2 25 220 6.0E-12
sp|Q1CDV0|Y3503_YERPN Maf-like protein YPN_3503 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=YPN_3503 PE=3 SV=2 25 220 6.0E-12
sp|Q48E97|Y4169_PSE14 Maf-like protein PSPPH_4169 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=PSPPH_4169 PE=3 SV=1 23 220 7.0E-12
sp|A7GTD6|MAF_BACCN Septum formation protein Maf OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=maf PE=3 SV=1 21 220 1.0E-11
sp|Q24SM2|Y3181_DESHY Maf-like protein DSY3181 OS=Desulfitobacterium hafniense (strain Y51) GN=DSY3181 PE=3 SV=1 21 220 1.0E-11
sp|A6L391|Y2498_BACV8 Maf-like protein BVU_2498 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=BVU_2498 PE=3 SV=1 15 220 1.0E-11
sp|Q38YR2|Y364_LACSS Maf-like protein LCA_0364 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=LCA_0364 PE=3 SV=1 23 220 1.0E-11
sp|Q5L6G5|Y310_CHLAB Maf-like protein CAB310 OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=CAB310 PE=3 SV=1 22 223 1.0E-11
sp|Q2YC50|Y363_NITMU Maf-like protein Nmul_A0363 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=Nmul_A0363 PE=3 SV=1 20 226 1.0E-11
sp|Q0HEI2|Y3469_SHESM Maf-like protein Shewmr4_3469 OS=Shewanella sp. (strain MR-4) GN=Shewmr4_3469 PE=3 SV=1 23 220 1.0E-11
sp|Q0C2H1|Y1355_HYPNA Maf-like protein HNE_1355 OS=Hyphomonas neptunium (strain ATCC 15444) GN=HNE_1355 PE=3 SV=1 23 220 2.0E-11
sp|Q315F5|Y640_DESAG Maf-like protein Dde_0640 OS=Desulfovibrio alaskensis (strain G20) GN=Dde_0640 PE=3 SV=1 23 220 2.0E-11
sp|A6L8E5|Y169_PARD8 Maf-like protein BDI_0169 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=BDI_0169 PE=3 SV=1 15 220 2.0E-11
sp|Q4FUF9|Y486_PSYA2 Maf-like protein Psyc_0486 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=Psyc_0486 PE=3 SV=1 23 220 2.0E-11
sp|Q5P2U3|Y2246_AROAE Maf-like protein AZOSEA22460 OS=Aromatoleum aromaticum (strain EbN1) GN=AZOSEA22460 PE=3 SV=1 22 226 3.0E-11
sp|Q64R56|Y3281_BACFR Maf-like protein BF3281 OS=Bacteroides fragilis (strain YCH46) GN=BF3281 PE=3 SV=1 15 220 3.0E-11
sp|B1YJT1|Y2117_EXIS2 Maf-like protein Exig_2117 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=Exig_2117 PE=3 SV=1 23 220 3.0E-11
sp|A0QTE5|Y1811_MYCS2 Maf-like protein MSMEG_1811/MSMEI_1767 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_1811 PE=3 SV=1 22 220 4.0E-11
sp|Q3KM09|Y378_CHLTA Maf-like protein CTA_0378 OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=CTA_0378 PE=3 SV=1 20 221 4.0E-11
sp|O84353|Y349_CHLTR Maf-like protein CT_349 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=CT_349 PE=3 SV=1 20 221 4.0E-11
sp|Q7VWE3|Y2314_BORPE Maf-like protein BP2314 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=BP2314 PE=3 SV=1 22 220 4.0E-11
sp|A4X378|Y851_SALTO Maf-like protein Strop_0851 OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=Strop_0851 PE=3 SV=1 22 220 4.0E-11
sp|P74331|Y905_SYNY3 Maf-like protein sll0905 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0905 PE=3 SV=1 23 220 5.0E-11
sp|A4QC50|Y825_CORGB Maf-like protein cgR_0825 OS=Corynebacterium glutamicum (strain R) GN=cgR_0825 PE=3 SV=1 22 220 5.0E-11
sp|Q8FRM5|Y735_COREF Maf-like protein CE0735 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=CE0735 PE=3 SV=1 22 220 7.0E-11
sp|Q8NSH0|Y705_CORGL Maf-like protein Cgl0705/cg0809 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=Cgl0705 PE=3 SV=1 22 220 7.0E-11
sp|Q1QRF9|Y292_NITHX Maf-like protein Nham_0292 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=Nham_0292 PE=3 SV=1 22 220 7.0E-11
sp|Q9PK45|Y628_CHLMU Maf-like protein TC_0628 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=TC_0628 PE=3 SV=1 22 221 7.0E-11
sp|Q6G253|Y1413_BARHE Maf-like protein BH14130 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=BH14130 PE=3 SV=1 18 220 7.0E-11
sp|Q5LAQ8|Y3120_BACFN Maf-like protein BF3120 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=BF3120 PE=3 SV=1 15 220 8.0E-11
sp|Q9CLG6|Y1268_PASMU Maf-like protein PM1268 OS=Pasteurella multocida (strain Pm70) GN=PM1268 PE=3 SV=1 18 220 9.0E-11
sp|A3PDZ9|Y1351_PROM0 Maf-like protein P9301_13511 OS=Prochlorococcus marinus (strain MIT 9301) GN=P9301_13511 PE=3 SV=1 23 227 1.0E-10
sp|Q62II4|Y1890_BURMA Maf-like protein BMA1890 OS=Burkholderia mallei (strain ATCC 23344) GN=BMA1890 PE=3 SV=1 23 239 1.0E-10
sp|Q3JUG5|Y1378_BURP1 Maf-like protein BURPS1710b_1378 OS=Burkholderia pseudomallei (strain 1710b) GN=BURPS1710b_1378 PE=3 SV=1 23 239 1.0E-10
sp|Q63VT5|Y1159_BURPS Maf-like protein BPSL1159 OS=Burkholderia pseudomallei (strain K96243) GN=BPSL1159 PE=3 SV=1 23 239 1.0E-10
sp|B0B7R8|Y603_CHLT2 Maf-like protein CTL0603 OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=CTL0603 PE=3 SV=1 20 221 1.0E-10
sp|B0BBY3|Y601_CHLTB Maf-like protein CTLon_0601 OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=CTLon_0601 PE=3 SV=1 20 221 1.0E-10
sp|Q47JQ0|Y172_DECAR Maf-like protein Daro_0172 OS=Dechloromonas aromatica (strain RCB) GN=Daro_0172 PE=3 SV=1 22 235 2.0E-10
sp|B2KC30|Y602_ELUMP Maf-like protein Emin_0602 OS=Elusimicrobium minutum (strain Pei191) GN=Emin_0602 PE=3 SV=1 22 220 2.0E-10
sp|Q7V0U3|Y1159_PROMP Maf-like protein PMM1159 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=PMM1159 PE=3 SV=1 23 237 3.0E-10
sp|B2J6P8|Y5518_NOSP7 Maf-like protein Npun_F5518 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=Npun_F5518 PE=3 SV=1 23 220 3.0E-10
sp|Q3AWW1|Y1594_SYNS9 Maf-like protein Syncc9902_1594 OS=Synechococcus sp. (strain CC9902) GN=Syncc9902_1594 PE=3 SV=2 23 227 4.0E-10
sp|Q0BTC5|Y1029_GRABC Maf-like protein GbCGDNIH1_1029 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=GbCGDNIH1_1029 PE=3 SV=1 23 226 4.0E-10
sp|Q6DAI3|Y270_PECAS Maf-like protein ECA0270 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ECA0270 PE=3 SV=1 22 220 4.0E-10
sp|Q9X1P2|Y1556_THEMA Maf-like protein TM_1556 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_1556 PE=3 SV=1 22 220 4.0E-10
sp|B1LB65|Y1219_THESQ Maf-like protein TRQ2_1219 OS=Thermotoga sp. (strain RQ2) GN=TRQ2_1219 PE=3 SV=1 22 220 4.0E-10
sp|A5IM27|Y1236_THEP1 Maf-like protein Tpet_1236 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=Tpet_1236 PE=3 SV=1 22 220 4.0E-10
sp|A8G5U9|Y1365_PROM2 Maf-like protein P9215_13651 OS=Prochlorococcus marinus (strain MIT 9215) GN=P9215_13651 PE=3 SV=1 23 227 5.0E-10
sp|Q9A5V5|Y2342_CAUCR Maf-like protein CC_2342 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=CC_2342 PE=3 SV=1 23 220 5.0E-10
sp|B9KXM8|Y215_THERP Maf-like protein trd_0215 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=trd_0215 PE=3 SV=1 23 220 6.0E-10
sp|Q6G132|Y1119_BARQU Maf-like protein BQ11190 OS=Bartonella quintana (strain Toulouse) GN=BQ11190 PE=3 SV=1 19 220 6.0E-10
sp|Q6N181|Y4527_RHOPA Maf-like protein RPA4527 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=RPA4527 PE=3 SV=2 22 220 7.0E-10
sp|A5FFP4|Y2955_FLAJ1 Maf-like protein Fjoh_2955 OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=Fjoh_2955 PE=3 SV=1 16 220 7.0E-10
sp|Q3J7T5|Y2658_NITOC Maf-like protein Noc_2658 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=Noc_2658 PE=3 SV=1 23 220 7.0E-10
sp|C3PEA3|Y560_CORA7 Maf-like protein cauri_0560 OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=cauri_0560 PE=3 SV=1 22 220 7.0E-10
sp|B0JH94|Y2424_MICAN Maf-like protein MAE_24240 OS=Microcystis aeruginosa (strain NIES-843) GN=MAE_24240 PE=3 SV=1 23 220 8.0E-10
sp|Q3SVZ7|Y277_NITWN Maf-like protein Nwi_0277 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=Nwi_0277 PE=3 SV=1 22 220 1.0E-09
sp|Q2JNH4|Y709_SYNJB Maf-like protein CYB_0709 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=CYB_0709 PE=3 SV=1 23 220 1.0E-09
sp|A2BS59|Y1336_PROMS Maf-like protein A9601_13361 OS=Prochlorococcus marinus (strain AS9601) GN=A9601_13361 PE=3 SV=1 23 227 1.0E-09
sp|A5EAG4|Y900_BRASB Maf-like protein BBta_0900 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=BBta_0900 PE=3 SV=1 22 220 2.0E-09
sp|Q2SZT6|Y1009_BURTA Maf-like protein BTH_I1009 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=BTH_I1009 PE=3 SV=1 23 239 2.0E-09
sp|Q3SG65|Y2438_THIDA Maf-like protein Tbd_2438 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=Tbd_2438 PE=3 SV=1 18 220 2.0E-09
sp|Q2IRX7|Y4346_RHOP2 Maf-like protein RPB_4346 OS=Rhodopseudomonas palustris (strain HaA2) GN=RPB_4346 PE=3 SV=1 22 220 2.0E-09
sp|Q6A725|Y1709_PROAC Maf-like protein PPA1709 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=PPA1709 PE=3 SV=2 24 224 2.0E-09
sp|B2HEK5|Y1254_MYCMM Maf-like protein MMAR_1254 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=MMAR_1254 PE=3 SV=1 22 223 3.0E-09
sp|Q9HVU3|Y4478_PSEAE Maf-like protein PA4478 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA4478 PE=3 SV=1 23 220 3.0E-09
sp|B7KJY0|Y1128_CYAP7 Maf-like protein PCC7424_1128 OS=Cyanothece sp. (strain PCC 7424) GN=PCC7424_1128 PE=3 SV=1 24 220 3.0E-09
sp|A0PRJ3|Y2634_MYCUA Maf-like protein MUL_2634 OS=Mycobacterium ulcerans (strain Agy99) GN=MUL_2634 PE=3 SV=1 22 223 3.0E-09
sp|Q035Z4|Y2233_LACC3 Maf-like protein LSEI_2233 OS=Lactobacillus casei (strain ATCC 334) GN=LSEI_2233 PE=3 SV=1 23 220 3.0E-09
sp|Q0AQL3|Y1131_MARMM Maf-like protein Mmar10_1131 OS=Maricaulis maris (strain MCS10) GN=Mmar10_1131 PE=3 SV=1 22 220 3.0E-09
sp|Q31RS8|Y209_SYNE7 Maf-like protein Synpcc7942_0209 OS=Synechococcus elongatus (strain PCC 7942) GN=Synpcc7942_0209 PE=3 SV=2 22 220 3.0E-09
sp|Q5N2H7|Y1303_SYNP6 Maf-like protein syc1303_d OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=syc1303_d PE=3 SV=2 22 220 3.0E-09
sp|Q20Y49|Y4414_RHOPB Maf-like protein RPC_4414 OS=Rhodopseudomonas palustris (strain BisB18) GN=RPC_4414 PE=3 SV=1 22 220 3.0E-09
sp|Q92S22|Y615_RHIME Maf-like protein R00615 OS=Rhizobium meliloti (strain 1021) GN=R00615 PE=3 SV=1 21 220 4.0E-09
sp|Q5FS71|Y1003_GLUOX Maf-like protein GOX1003 OS=Gluconobacter oxydans (strain 621H) GN=GOX1003 PE=3 SV=1 22 226 4.0E-09
sp|Q8PIX4|Y2771_XANAC Maf-like protein XAC2771 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=XAC2771 PE=3 SV=1 23 220 4.0E-09
sp|Q9K0J8|Y598_NEIMB Maf-like protein NMB0598 OS=Neisseria meningitidis serogroup B (strain MC58) GN=NMB0598 PE=3 SV=1 23 220 4.0E-09
sp|B3W9W2|Y2415_LACCB Maf-like protein LCABL_24150 OS=Lactobacillus casei (strain BL23) GN=LCABL_24150 PE=3 SV=1 23 220 4.0E-09
sp|Q2G9H1|Y1057_NOVAD Maf-like protein Saro_1057 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=Saro_1057 PE=3 SV=1 19 220 5.0E-09
sp|A4SE83|Y777_CHLPM Maf-like protein Cvib_0777 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=Cvib_0777 PE=3 SV=1 23 234 6.0E-09
sp|Q130J6|Y4276_RHOPS Maf-like protein RPD_4276 OS=Rhodopseudomonas palustris (strain BisB5) GN=RPD_4276 PE=3 SV=1 22 220 7.0E-09
sp|Q3J086|Y2230_RHOS4 Maf-like protein RHOS4_22300 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=RHOS4_22300 PE=3 SV=1 23 220 7.0E-09
sp|Q1LQB1|Y779_CUPMC Maf-like protein Rmet_0779 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=Rmet_0779 PE=3 SV=1 23 226 7.0E-09
sp|Q3BRF4|Y2928_XANC5 Maf-like protein XCV2928 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=XCV2928 PE=3 SV=1 23 220 8.0E-09
sp|Q319X8|Y1258_PROM9 Maf-like protein PMT9312_1258 OS=Prochlorococcus marinus (strain MIT 9312) GN=PMT9312_1258 PE=3 SV=1 23 227 8.0E-09
sp|Q4JTL6|Y1664_CORJK Maf-like protein jk1664 OS=Corynebacterium jeikeium (strain K411) GN=jk1664 PE=3 SV=1 22 215 1.0E-08
sp|B0S919|Y016_LEPBA Maf-like protein LBF_0016 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=LBF_0016 PE=3 SV=1 23 220 1.0E-08
sp|B0SK44|Y014_LEPBP Maf-like protein LEPBI_I0014 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=LEPBI_I0014 PE=3 SV=1 23 220 1.0E-08
sp|Q60BT7|Y378_METCA Maf-like protein MCA0378 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=MCA0378 PE=3 SV=1 19 220 1.0E-08
sp|Q8FA20|Y017_LEPIN Maf-like protein LA_0017 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=LA_0017 PE=3 SV=1 23 235 1.0E-08
sp|Q72WC1|Y016_LEPIC Maf-like protein LIC_10016 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=LIC_10016 PE=3 SV=1 23 235 1.0E-08
sp|Q7VKR7|Y1805_HAEDU Maf-like protein HD_1805 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=HD_1805 PE=3 SV=1 21 226 1.0E-08
sp|A1T5Q3|Y1674_MYCVP Maf-like protein Mvan_1674 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=Mvan_1674 PE=3 SV=1 22 220 1.0E-08
sp|Q8KDS1|Y974_CHLTE Maf-like protein CT0974 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=maf PE=3 SV=1 21 220 1.0E-08
sp|Q04NX0|Y3012_LEPBJ Maf-like protein LBJ_3012 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=LBJ_3012 PE=3 SV=1 23 235 2.0E-08
sp|Q04XA6|Y2976_LEPBL Maf-like protein LBL_2976 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=LBL_2976 PE=3 SV=1 23 235 2.0E-08
sp|Q5FA52|Y180_NEIG1 Maf-like protein NGO0180 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=NGO0180 PE=3 SV=1 13 220 2.0E-08
sp|A5GMB7|Y1656_SYNPW Maf-like protein SynWH7803_1656 OS=Synechococcus sp. (strain WH7803) GN=SynWH7803_1656 PE=3 SV=1 23 234 2.0E-08
sp|A4TF31|Y4776_MYCGI Maf-like protein Mflv_4776 OS=Mycobacterium gilvum (strain PYR-GCK) GN=Mflv_4776 PE=3 SV=1 22 220 2.0E-08
sp|Q28NC5|Y2870_JANSC Maf-like protein Jann_2870 OS=Jannaschia sp. (strain CCS1) GN=Jann_2870 PE=3 SV=1 22 220 2.0E-08
sp|Q46Y94|Y2528_CUPPJ Maf-like protein Reut_A2528 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=Reut_A2528 PE=3 SV=1 23 226 2.0E-08
sp|Q6NIW2|Y654_CORDI Maf-like protein DIP0654 OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=DIP0654 PE=3 SV=1 23 220 3.0E-08
sp|Q21WP7|Y2081_RHOFT Maf-like protein Rfer_2081 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=Rfer_2081 PE=3 SV=1 23 226 3.0E-08
sp|Q7N035|Y4068_PHOLL Maf-like protein plu4068 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=plu4068 PE=3 SV=1 21 220 4.0E-08
sp|Q89V00|Y1259_BRADU Maf-like protein blr1259 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=blr1259 PE=3 SV=1 22 220 5.0E-08
sp|Q5GXK1|Y3316_XANOR Maf-like protein XOO3316 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=XOO3316 PE=3 SV=2 23 220 5.0E-08
sp|Q2P0P1|Y3131_XANOM Maf-like protein XOO3131 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=XOO3131 PE=3 SV=1 23 220 5.0E-08
sp|Q3ALJ5|Y768_SYNSC Maf-like protein Syncc9605_0768 OS=Synechococcus sp. (strain CC9605) GN=Syncc9605_0768 PE=3 SV=1 24 227 5.0E-08
sp|Q12C38|Y1974_POLSJ Maf-like protein Bpro_1974 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=Bpro_1974 PE=3 SV=1 23 235 6.0E-08
sp|Q9JVK3|Y802_NEIMA Maf-like protein NMA0802 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=NMA0802 PE=3 SV=1 23 220 7.0E-08
sp|Q2S4I1|Y763_SALRD Maf-like protein SRU_0763 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=SRU_0763 PE=3 SV=2 26 220 7.0E-08
sp|A8GXY9|Y7195_RICB8 Maf-like protein A1I_07195 OS=Rickettsia bellii (strain OSU 85-389) GN=A1I_07195 PE=3 SV=1 23 226 1.0E-07
sp|Q1RK90|Y143_RICBR Maf-like protein RBE_0143 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0143 PE=3 SV=1 23 226 1.0E-07
sp|Q87WS4|Y4469_PSESM Maf-like protein PSPTO_4469 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=maf-2 PE=3 SV=1 23 220 1.0E-07
sp|Q82I23|Y3335_STRAW Maf-like protein SAV_3335 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=SAV_3335 PE=3 SV=1 21 220 1.0E-07
sp|Q82XC7|Y356_NITEU Maf-like protein NE0356 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=NE0356 PE=3 SV=1 23 226 1.0E-07
sp|Q3AQS4|Y1393_CHLCH Maf-like protein Cag_1393 OS=Chlorobium chlorochromatii (strain CaD3) GN=Cag_1393 PE=3 SV=1 23 234 1.0E-07
sp|Q73UG7|Y3401_MYCPA Maf-like protein MAP_3401 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=MAP_3401 PE=3 SV=1 22 220 1.0E-07
sp|Q8UHX5|Y533_AGRFC Maf-like protein Atu0533 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=maf1 PE=3 SV=1 21 220 1.0E-07
sp|A1KNT4|Y3311_MYCBP Maf-like protein BCG_3311 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_3311 PE=3 SV=1 22 220 2.0E-07
sp|Q7TWT7|Y3310_MYCBO Maf-like protein Mb3310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb3310 PE=3 SV=1 22 220 2.0E-07
sp|C1AH56|Y3307_MYCBT Maf-like protein JTY_3307 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=JTY_3307 PE=3 SV=1 22 220 2.0E-07
sp|Q8DJC5|Y1302_THEEB Maf-like protein tlr1302 OS=Thermosynechococcus elongatus (strain BP-1) GN=tlr1302 PE=3 SV=1 24 220 2.0E-07
sp|Q5PAF5|Y793_ANAMM Maf-like protein AM793 OS=Anaplasma marginale (strain St. Maries) GN=AM793 PE=3 SV=1 18 220 2.0E-07
sp|B9KIX1|Y588_ANAMF Maf-like protein AMF_588 OS=Anaplasma marginale (strain Florida) GN=AMF_588 PE=3 SV=1 18 220 2.0E-07
sp|Q49670|Y729_MYCLE Maf-like protein ML0729 OS=Mycobacterium leprae (strain TN) GN=ML0729 PE=3 SV=1 22 223 3.0E-07
sp|B8ZUX8|Y729_MYCLB Maf-like protein MLBr00729 OS=Mycobacterium leprae (strain Br4923) GN=MLBr00729 PE=3 SV=1 22 223 3.0E-07
sp|Q1GLE1|Y3556_RUEST Maf-like protein TM1040_3556 OS=Ruegeria sp. (strain TM1040) GN=TM1040_3556 PE=3 SV=1 23 220 3.0E-07
sp|Q2RQN0|Y2768_RHORT Maf-like protein Rru_A2768 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=Rru_A2768 PE=3 SV=1 23 226 3.0E-07
sp|Q169N3|Y1686_ROSDO Maf-like protein RD1_1686 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=RD1_1686 PE=3 SV=1 24 220 3.0E-07
sp|Q46JR8|Y769_PROMT Maf-like protein PMN2A_0769 OS=Prochlorococcus marinus (strain NATL2A) GN=PMN2A_0769 PE=3 SV=1 23 227 4.0E-07
sp|Q5E405|Y1746_VIBF1 Maf-like protein VF_1746 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=VF_1746 PE=3 SV=1 22 215 4.0E-07
sp|A5U7V6|Y3323_MYCTA Maf-like protein MRA_3323 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_3323 PE=3 SV=1 22 220 5.0E-07
sp|P9WK27|Y3282_MYCTU Maf-like protein Rv3282 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3282 PE=1 SV=1 22 220 5.0E-07
sp|P9WK26|Y3282_MYCTO Maf-like protein MT3381 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT3381 PE=3 SV=1 22 220 5.0E-07
sp|Q9EWV6|Y4923_STRCO Maf-like protein SCO4923 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO4923 PE=3 SV=1 21 220 5.0E-07
sp|Q5WEQ9|MAF_BACSK Septum formation protein Maf OS=Bacillus clausii (strain KSM-K16) GN=maf PE=3 SV=1 23 220 7.0E-07
sp|Q7U5K1|Y1702_SYNPX Maf-like protein SYNW1702 OS=Synechococcus sp. (strain WH8102) GN=SYNW1702 PE=3 SV=1 92 227 7.0E-07
sp|Q2SK56|Y2139_HAHCH Maf-like protein HCH_02139 OS=Hahella chejuensis (strain KCTC 2396) GN=HCH_02139 PE=3 SV=1 23 215 8.0E-07
sp|B3CL80|Y036_WOLPP Maf-like protein WP0036 OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=WP0036 PE=3 SV=1 23 220 8.0E-07
sp|A4FNQ1|Y6507_SACEN Maf-like protein SACE_6507 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=SACE_6507 PE=3 SV=1 22 224 8.0E-07
sp|Q5LLE9|Y4078_RUEPO Maf-like protein SPOA0078 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=SPOA0078 PE=3 SV=1 23 220 1.0E-06
sp|B3QNY9|Y1237_CHLP8 Maf-like protein Cpar_1237 OS=Chlorobaculum parvum (strain NCIB 8327) GN=Cpar_1237 PE=3 SV=1 21 220 1.0E-06
sp|Q3A587|Y1221_PELCD Maf-like protein Pcar_1221 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=Pcar_1221 PE=3 SV=1 21 216 2.0E-06
sp|Q1MLP2|Y617_RHIL3 Maf-like protein RL0617 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=RL0617 PE=3 SV=1 22 220 2.0E-06
sp|Q5GT91|Y192_WOLTR Maf-like protein Wbm0192 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=Wbm0192 PE=3 SV=1 23 220 2.0E-06
sp|Q5Z154|Y992_NOCFA Maf-like protein NFA_9920 OS=Nocardia farcinica (strain IFM 10152) GN=NFA_9920 PE=3 SV=1 23 223 3.0E-06
sp|Q1QX59|Y1596_CHRSD Maf-like protein Csal_1596 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=Csal_1596 PE=3 SV=1 22 215 3.0E-06
sp|Q7VB43|Y1257_PROMA Maf-like protein Pro_1257 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=maf PE=3 SV=1 23 227 3.0E-06
sp|Q2JXB4|Y360_SYNJA Maf-like protein CYA_0360 OS=Synechococcus sp. (strain JA-3-3Ab) GN=CYA_0360 PE=3 SV=1 23 220 4.0E-06
sp|C0R2U8|Y4530_WOLWR Maf-like protein WRi_004530 OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=WRi_004530 PE=3 SV=1 23 220 4.0E-06
sp|A8GTV6|Y6950_RICRS Maf-like protein A1G_06950 OS=Rickettsia rickettsii (strain Sheila Smith) GN=A1G_06950 PE=3 SV=1 23 226 4.0E-06
sp|C4K258|Y5215_RICPU Maf-like protein RPR_05215 OS=Rickettsia peacockii (strain Rustic) GN=RPR_05215 PE=3 SV=1 23 226 4.0E-06
sp|B0BVE4|Y1484_RICRO Maf-like protein RrIowa_1484 OS=Rickettsia rickettsii (strain Iowa) GN=RrIowa_1484 PE=3 SV=1 23 226 4.0E-06
sp|A8F031|Y5240_RICCK Maf-like protein A1E_05240 OS=Rickettsia canadensis (strain McKiel) GN=A1E_05240 PE=3 SV=1 23 226 4.0E-06
sp|Q8P7K1|Y2610_XANCP Maf-like protein XCC2610 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC2610 PE=3 SV=1 23 226 4.0E-06
sp|Q4UWJ9|Y1506_XANC8 Maf-like protein XC_1506 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=XC_1506 PE=3 SV=1 23 226 4.0E-06
sp|C0ZWV2|Y2129_RHOE4 Maf-like protein RER_21290 OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=RER_21290 PE=3 SV=1 22 223 4.0E-06
sp|Q5NNS3|Y1013_ZYMMO Maf-like protein ZMO1013 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=ZMO1013 PE=3 SV=1 23 220 5.0E-06
sp|Q2KCN4|Y585_RHIEC Maf-like protein RHE_CH00585 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=RHE_CH00585 PE=3 SV=1 22 220 5.0E-06
sp|Q9PEA4|Y1124_XYLFA Maf-like protein XF_1124 OS=Xylella fastidiosa (strain 9a5c) GN=XF_1124 PE=3 SV=2 25 220 5.0E-06
sp|Q0IBR4|Y895_SYNS3 Maf-like protein sync_0895 OS=Synechococcus sp. (strain CC9311) GN=sync_0895 PE=3 SV=1 23 234 9.0E-06
sp|Q73I47|Y333_WOLPM Maf-like protein WD_0333 OS=Wolbachia pipientis wMel GN=WD_0333 PE=3 SV=1 23 220 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0047429 nucleoside-triphosphate diphosphatase activity Yes
GO:0016787 hydrolase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016462 pyrophosphatase activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|012180
MSKYILPHALQVPAIKKLQDKRIVLASSSPRRKEILQTLGLAPDIVASTFEENLPLSSFEDIHEYPVATATHKAV
EVYERLIREDPDNPPDLVIAADTVVLTHAQPSISQTSYADLPQVEQQLLEKPSDKEDNFRMLMDLNGGVCEVVTG
VTVVFPVIYAPGYVTKSIDERTLVYFADNPKHIVRAYADNGEGIDRAGGFAIQGLGGMLIRKVDGDYNNVKRIQT
FWKFKRTWMRNGHVNAYPRLQPIRVYPVSAKQHKGPI*
Coding >Agabi119p4|012180
ATGTCAAAATACATCCTACCCCATGCGCTCCAAGTCCCAGCTATCAAAAAACTCCAAGACAAGCGCATCGTCCTT
GCCTCAAGCAGCCCCAGGAGGAAGGAAATTCTTCAAACTCTTGGTTTGGCCCCCGATATCGTGGCTTCAACTTTC
GAAGAAAACCTTCCTTTGAGTTCTTTTGAGGATATTCATGAATATCCCGTGGCAACTGCAACACATAAAGCAGTC
GAAGTCTATGAACGTTTGATCAGAGAGGATCCTGACAACCCGCCAGATCTCGTCATCGCAGCTGATACTGTCGTC
TTGACACATGCTCAGCCTTCTATATCTCAGACTTCATATGCTGACCTCCCTCAAGTGGAACAACAGCTCTTAGAG
AAGCCAAGTGACAAAGAGGACAACTTTAGAATGCTCATGGACCTGAATGGAGGCGTTTGTGAAGTGGTCACCGGT
GTTACCGTCGTCTTCCCTGTGATATATGCTCCCGGCTACGTCACTAAGTCCATTGACGAGCGAACTCTGGTTTAT
TTTGCCGACAATCCCAAACATATCGTCCGAGCGTATGCCGACAATGGAGAAGGTATTGATCGCGCCGGAGGATTT
GCTATCCAGGGTCTTGGAGGGATGCTGATACGCAAGGTTGACGGTGACTATAATAACGTGAAGAGGATCCAGACT
TTTTGGAAATTTAAACGCACTTGGATGAGGAATGGCCATGTAAACGCGTACCCTCGATTACAACCTATCCGTGTA
TACCCAGTGTCGGCGAAGCAGCATAAAGGGCCAATATGA
Transcript >Agabi119p4|012180
ATGTCAAAATACATCCTACCCCATGCGCTCCAAGTCCCAGCTATCAAAAAACTCCAAGACAAGCGCATCGTCCTT
GCCTCAAGCAGCCCCAGGAGGAAGGAAATTCTTCAAACTCTTGGTTTGGCCCCCGATATCGTGGCTTCAACTTTC
GAAGAAAACCTTCCTTTGAGTTCTTTTGAGGATATTCATGAATATCCCGTGGCAACTGCAACACATAAAGCAGTC
GAAGTCTATGAACGTTTGATCAGAGAGGATCCTGACAACCCGCCAGATCTCGTCATCGCAGCTGATACTGTCGTC
TTGACACATGCTCAGCCTTCTATATCTCAGACTTCATATGCTGACCTCCCTCAAGTGGAACAACAGCTCTTAGAG
AAGCCAAGTGACAAAGAGGACAACTTTAGAATGCTCATGGACCTGAATGGAGGCGTTTGTGAAGTGGTCACCGGT
GTTACCGTCGTCTTCCCTGTGATATATGCTCCCGGCTACGTCACTAAGTCCATTGACGAGCGAACTCTGGTTTAT
TTTGCCGACAATCCCAAACATATCGTCCGAGCGTATGCCGACAATGGAGAAGGTATTGATCGCGCCGGAGGATTT
GCTATCCAGGGTCTTGGAGGGATGCTGATACGCAAGGTTGACGGTGACTATAATAACGTGAAGAGGATCCAGACT
TTTTGGAAATTTAAACGCACTTGGATGAGGAATGGCCATGTAAACGCGTACCCTCGATTACAACCTATCCGTGTA
TACCCAGTGTCGGCGAAGCAGCATAAAGGGCCAATATGA
Gene >Agabi119p4|012180
ATGTCAAAATACATCCTACCCCATGCGCTCCAAGTCCCAGCTATCAAAAAACTCCAAGACAAGCGCATCGTCCTT
GCCTCAAGCAGCCCCAGGAGGAAGGAAATTCTTCAAACTCTTGTTCATATTTCCATCAATTTATAGCTGAGCCCA
AATTCAAATTGATTCCAGGGTTTGGCCCCCGATATCGTGGCTTCAACTTTCGAAGAAAACCTTCCTTTGAGTTCT
TTTGAGGATATTCATGAATATCCCGTGGCAACTGCAACACATAAAGCAGTCGAAGTCTATGAACGTTTGATCGTG
AGTGTTGATGCTCTGGGATTGAGCACCTCCTAAACATGACTTTTAGAGAGAGGATCCTGACAACCCGCCAGATCT
CGTCATCGCAGGTGAGTGTTGGCAATTTTTTATTTTGTGATTGCACTAATCTCTATTGATAGCTGATACTGTCGT
CTTGACACATGCTCAGCCTTCTATATCTCAGACTTCATATGCTGACCTCCCTCAAGTGGAACAACAGCTCTTAGA
GAAGCCAAGTGACAAAGAGGACAACTTTAGAATGCTCATGGACCTGAATGGAGGCGTTTGTGAAGTGGTCACCGG
TGTTACCGTCGGTCAGTAACCACATAGCTTTCTATGATCTTGCCAGACCTCCTGATCACTCATCTAGTCTTCCCT
GTGATATATGCTCCCGGCTACGTCACTAAGTACGCGCACATTCATCTATTTTTTTTTCGAGTTCTAATAACATGG
CCTTATAGGTCCATTGACGAGCGAACTCTGGTTTATTTTGCCGACAATCCCAAACATATCGTCCGAGCGTATGCC
GACAATGGAGAAGGTATTGATCGCGCCGGAGGATTTGCTATCCAGGTAAGCCATACTTGTCATCGTTCGTCCAGT
ATTCTTAATCGAAGCTATTCATGCAGGGTCTTGGAGGGATGCTGATACGCAAGGTTGACGGTGACTATAATAACG
TGGTTGGATTCCCTGCGGCATCATTTTTCAAACTTCTCGATATCATGGTAGAAGAGGATCCAGACTTTTTGGAAA
TTTAAACGCACTTGGATGAGGAATGGCCATGTAAACGCGTACCCTCGATTACAACCTATCCGTAAGCTCCCATGT
TCAATATCCAGTATATTACTGTCTGCATTTATTTGAAGGTGTATACCCAGTGTCGGCGAAGCAGCATAAAGGGCC
AATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail