© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Agabi119p4|011820 |
| Gene name | |
| Location | scaffold_01a:2819512..2820645 |
| Strand | - |
| Gene length (bp) | 1133 |
| Transcript length (bp) | 744 |
| Coding sequence length (bp) | 744 |
| Protein length (aa) | 248 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00574 | CLP_protease | Clp protease | 2.5E-75 | 52 | 238 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|A5D447|CLPP_PELTS | ATP-dependent Clp protease proteolytic subunit OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=clpP PE=3 SV=1 | 41 | 239 | 1.0E-84 |
| sp|O88696|CLPP_MOUSE | ATP-dependent Clp protease proteolytic subunit, mitochondrial OS=Mus musculus GN=Clpp PE=1 SV=1 | 4 | 240 | 2.0E-84 |
| sp|Q2KHU4|CLPP_BOVIN | ATP-dependent Clp protease proteolytic subunit, mitochondrial OS=Bos taurus GN=CLPP PE=2 SV=1 | 42 | 240 | 3.0E-84 |
| sp|Q16740|CLPP_HUMAN | ATP-dependent Clp protease proteolytic subunit, mitochondrial OS=Homo sapiens GN=CLPP PE=1 SV=1 | 6 | 240 | 5.0E-84 |
| sp|Q2RU45|CLPP_RHORT | ATP-dependent Clp protease proteolytic subunit OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=clpP PE=3 SV=1 | 42 | 243 | 6.0E-84 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|A5D447|CLPP_PELTS | ATP-dependent Clp protease proteolytic subunit OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=clpP PE=3 SV=1 | 41 | 239 | 1.0E-84 |
| sp|O88696|CLPP_MOUSE | ATP-dependent Clp protease proteolytic subunit, mitochondrial OS=Mus musculus GN=Clpp PE=1 SV=1 | 4 | 240 | 2.0E-84 |
| sp|Q2KHU4|CLPP_BOVIN | ATP-dependent Clp protease proteolytic subunit, mitochondrial OS=Bos taurus GN=CLPP PE=2 SV=1 | 42 | 240 | 3.0E-84 |
| sp|Q16740|CLPP_HUMAN | ATP-dependent Clp protease proteolytic subunit, mitochondrial OS=Homo sapiens GN=CLPP PE=1 SV=1 | 6 | 240 | 5.0E-84 |
| sp|Q2RU45|CLPP_RHORT | ATP-dependent Clp protease proteolytic subunit OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=clpP PE=3 SV=1 | 42 | 243 | 6.0E-84 |
| sp|B6JGU7|CLPP_OLICO | ATP-dependent Clp protease proteolytic subunit OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=clpP PE=3 SV=1 | 41 | 240 | 6.0E-83 |
| sp|Q9FN42|CLPP2_ARATH | ATP-dependent Clp protease proteolytic subunit 2, mitochondrial OS=Arabidopsis thaliana GN=CLPP2 PE=1 SV=1 | 39 | 240 | 1.0E-82 |
| sp|Q39UH2|CLPP_GEOMG | ATP-dependent Clp protease proteolytic subunit OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=clpP PE=3 SV=1 | 42 | 242 | 1.0E-82 |
| sp|A3DJ10|CLPP_CLOTH | ATP-dependent Clp protease proteolytic subunit OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=clpP PE=3 SV=1 | 41 | 239 | 2.0E-82 |
| sp|Q89KG1|CLPP2_BRADU | ATP-dependent Clp protease proteolytic subunit 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=clpP2 PE=3 SV=1 | 41 | 239 | 3.0E-82 |
| sp|Q2W3H9|CLPP_MAGSA | ATP-dependent Clp protease proteolytic subunit OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=clpP PE=3 SV=2 | 42 | 246 | 6.0E-82 |
| sp|Q1MK43|CLPP1_RHIL3 | ATP-dependent Clp protease proteolytic subunit 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=clpP1 PE=3 SV=1 | 39 | 239 | 7.0E-82 |
| sp|Q1Q8J2|CLPP_PSYCK | ATP-dependent Clp protease proteolytic subunit OS=Psychrobacter cryohalolentis (strain K5) GN=clpP PE=3 SV=2 | 40 | 242 | 8.0E-82 |
| sp|A8HYF2|CLPP_AZOC5 | ATP-dependent Clp protease proteolytic subunit OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=clpP PE=3 SV=1 | 42 | 243 | 9.0E-82 |
| sp|Q74C82|CLPP_GEOSL | ATP-dependent Clp protease proteolytic subunit OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=clpP PE=3 SV=1 | 42 | 245 | 1.0E-81 |
| sp|Q0ST53|CLPP_CLOPS | ATP-dependent Clp protease proteolytic subunit OS=Clostridium perfringens (strain SM101 / Type A) GN=clpP PE=3 SV=1 | 40 | 239 | 1.0E-81 |
| sp|Q8XKK1|CLPP_CLOPE | ATP-dependent Clp protease proteolytic subunit OS=Clostridium perfringens (strain 13 / Type A) GN=clpP PE=3 SV=1 | 40 | 239 | 1.0E-81 |
| sp|Q0TQK2|CLPP_CLOP1 | ATP-dependent Clp protease proteolytic subunit OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=clpP PE=3 SV=1 | 40 | 239 | 1.0E-81 |
| sp|C5BTJ0|CLPP_TERTT | ATP-dependent Clp protease proteolytic subunit OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=clpP PE=3 SV=1 | 19 | 244 | 1.0E-81 |
| sp|Q5FUR3|CLPP1_GLUOX | ATP-dependent Clp protease proteolytic subunit 1 OS=Gluconobacter oxydans (strain 621H) GN=clpP1 PE=3 SV=1 | 39 | 240 | 1.0E-81 |
| sp|Q1QL76|CLPP_NITHX | ATP-dependent Clp protease proteolytic subunit OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=clpP PE=3 SV=1 | 41 | 239 | 2.0E-81 |
| sp|A7ILC6|CLPP_XANP2 | ATP-dependent Clp protease proteolytic subunit OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=clpP PE=3 SV=1 | 42 | 245 | 3.0E-81 |
| sp|Q07NN6|CLPP_RHOP5 | ATP-dependent Clp protease proteolytic subunit OS=Rhodopseudomonas palustris (strain BisA53) GN=clpP PE=3 SV=1 | 41 | 244 | 4.0E-81 |
| sp|Q47FB6|CLPP_DECAR | ATP-dependent Clp protease proteolytic subunit OS=Dechloromonas aromatica (strain RCB) GN=clpP PE=3 SV=1 | 29 | 239 | 8.0E-81 |
| sp|Q3SRD2|CLPP_NITWN | ATP-dependent Clp protease proteolytic subunit OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=clpP PE=3 SV=1 | 41 | 239 | 9.0E-81 |
| sp|Q5P161|CLPP_AROAE | ATP-dependent Clp protease proteolytic subunit OS=Aromatoleum aromaticum (strain EbN1) GN=clpP PE=3 SV=1 | 34 | 242 | 1.0E-80 |
| sp|Q8UEX6|CLPP1_AGRFC | ATP-dependent Clp protease proteolytic subunit 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=clpP1 PE=3 SV=1 | 39 | 239 | 2.0E-80 |
| sp|A4XHW0|CLPP_CALS8 | ATP-dependent Clp protease proteolytic subunit OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=clpP PE=3 SV=1 | 42 | 240 | 2.0E-80 |
| sp|A1K783|CLPP_AZOSB | ATP-dependent Clp protease proteolytic subunit OS=Azoarcus sp. (strain BH72) GN=clpP PE=3 SV=1 | 24 | 239 | 2.0E-80 |
| sp|B3Q7P5|CLPP_RHOPT | ATP-dependent Clp protease proteolytic subunit OS=Rhodopseudomonas palustris (strain TIE-1) GN=clpP PE=3 SV=1 | 41 | 240 | 2.0E-80 |
| sp|Q6N5L3|CLPP_RHOPA | ATP-dependent Clp protease proteolytic subunit OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=clpP PE=3 SV=1 | 41 | 240 | 2.0E-80 |
| sp|Q0VQ90|CLPP_ALCBS | ATP-dependent Clp protease proteolytic subunit OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=clpP PE=3 SV=2 | 37 | 241 | 2.0E-80 |
| sp|A5N2K8|CLPP_CLOK5 | ATP-dependent Clp protease proteolytic subunit OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=clpP PE=3 SV=1 | 41 | 239 | 3.0E-80 |
| sp|B9E685|CLPP_CLOK1 | ATP-dependent Clp protease proteolytic subunit OS=Clostridium kluyveri (strain NBRC 12016) GN=clpP PE=3 SV=1 | 41 | 239 | 3.0E-80 |
| sp|B3E1Z4|CLPP_GEOLS | ATP-dependent Clp protease proteolytic subunit OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=clpP PE=3 SV=1 | 43 | 240 | 3.0E-80 |
| sp|A5GFA0|CLPP_GEOUR | ATP-dependent Clp protease proteolytic subunit OS=Geobacter uraniireducens (strain Rf4) GN=clpP PE=3 SV=1 | 42 | 242 | 4.0E-80 |
| sp|Q3AF96|CLPP_CARHZ | ATP-dependent Clp protease proteolytic subunit OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=clpP PE=3 SV=1 | 42 | 239 | 4.0E-80 |
| sp|Q2KAB9|CLPP1_RHIEC | ATP-dependent Clp protease proteolytic subunit 1 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=clpP1 PE=3 SV=1 | 39 | 247 | 6.0E-80 |
| sp|Q4FQB9|CLPP_PSYA2 | ATP-dependent Clp protease proteolytic subunit OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=clpP PE=3 SV=1 | 42 | 242 | 6.0E-80 |
| sp|Q1GGF6|CLPP_RUEST | ATP-dependent Clp protease proteolytic subunit OS=Ruegeria sp. (strain TM1040) GN=clpP PE=3 SV=2 | 42 | 243 | 6.0E-80 |
| sp|Q2IWZ4|CLPP_RHOP2 | ATP-dependent Clp protease proteolytic subunit OS=Rhodopseudomonas palustris (strain HaA2) GN=clpP PE=3 SV=1 | 41 | 239 | 7.0E-80 |
| sp|P0CAU1|CLPP_CAUCR | ATP-dependent Clp protease proteolytic subunit OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=clpP PE=3 SV=1 | 41 | 244 | 7.0E-80 |
| sp|B8GX16|CLPP_CAUCN | ATP-dependent Clp protease proteolytic subunit OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=clpP PE=3 SV=2 | 41 | 244 | 7.0E-80 |
| sp|B5EI27|CLPP_GEOBB | ATP-dependent Clp protease proteolytic subunit OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=clpP PE=3 SV=1 | 42 | 242 | 8.0E-80 |
| sp|Q0AWF0|CLPP_SYNWW | ATP-dependent Clp protease proteolytic subunit OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=clpP PE=3 SV=1 | 42 | 236 | 9.0E-80 |
| sp|B2TPB9|CLPP_CLOBB | ATP-dependent Clp protease proteolytic subunit OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=clpP PE=3 SV=1 | 42 | 241 | 9.0E-80 |
| sp|Q2GJB4|CLPP_ANAPZ | ATP-dependent Clp protease proteolytic subunit OS=Anaplasma phagocytophilum (strain HZ) GN=clpP PE=3 SV=1 | 41 | 239 | 1.0E-79 |
| sp|Q5HBX5|CLPP_EHRRW | ATP-dependent Clp protease proteolytic subunit OS=Ehrlichia ruminantium (strain Welgevonden) GN=clpP PE=3 SV=1 | 41 | 243 | 1.0E-79 |
| sp|A9W5F5|CLPP_METEP | ATP-dependent Clp protease proteolytic subunit OS=Methylobacterium extorquens (strain PA1) GN=clpP PE=3 SV=1 | 41 | 240 | 1.0E-79 |
| sp|B7KNT0|CLPP_METC4 | ATP-dependent Clp protease proteolytic subunit OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=clpP PE=3 SV=1 | 41 | 240 | 1.0E-79 |
| sp|Q6FEP8|CLPP_ACIAD | ATP-dependent Clp protease proteolytic subunit OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=clpP PE=3 SV=1 | 42 | 240 | 1.0E-79 |
| sp|Q135W7|CLPP_RHOPS | ATP-dependent Clp protease proteolytic subunit OS=Rhodopseudomonas palustris (strain BisB5) GN=clpP PE=3 SV=1 | 41 | 239 | 1.0E-79 |
| sp|C6E2T0|CLPP_GEOSM | ATP-dependent Clp protease proteolytic subunit OS=Geobacter sp. (strain M21) GN=clpP PE=3 SV=1 | 42 | 239 | 1.0E-79 |
| sp|Q8RC25|CLPP_CALS4 | ATP-dependent Clp protease proteolytic subunit OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=clpP PE=3 SV=2 | 41 | 238 | 2.0E-79 |
| sp|B1Z9C7|CLPP_METPB | ATP-dependent Clp protease proteolytic subunit OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=clpP PE=3 SV=1 | 41 | 240 | 2.0E-79 |
| sp|Q3YSQ3|CLPP_EHRCJ | ATP-dependent Clp protease proteolytic subunit OS=Ehrlichia canis (strain Jake) GN=clpP PE=3 SV=1 | 42 | 239 | 2.0E-79 |
| sp|Q8UFY6|CLPP2_AGRFC | ATP-dependent Clp protease proteolytic subunit 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=clpP2 PE=3 SV=1 | 42 | 239 | 2.0E-79 |
| sp|B9M0Y1|CLPP_GEODF | ATP-dependent Clp protease proteolytic subunit OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=clpP PE=3 SV=1 | 42 | 242 | 2.0E-79 |
| sp|A8LJA8|CLPP_DINSH | ATP-dependent Clp protease proteolytic subunit OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=clpP PE=3 SV=1 | 41 | 245 | 2.0E-79 |
| sp|Q5PBD0|CLPP_ANAMM | ATP-dependent Clp protease proteolytic subunit OS=Anaplasma marginale (strain St. Maries) GN=clpP PE=3 SV=1 | 41 | 239 | 2.0E-79 |
| sp|B9KHZ4|CLPP_ANAMF | ATP-dependent Clp protease proteolytic subunit OS=Anaplasma marginale (strain Florida) GN=clpP PE=3 SV=1 | 41 | 239 | 2.0E-79 |
| sp|B1Y6H3|CLPP_LEPCP | ATP-dependent Clp protease proteolytic subunit OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=clpP PE=3 SV=1 | 42 | 240 | 3.0E-79 |
| sp|B0CGR1|CLPP_BRUSI | ATP-dependent Clp protease proteolytic subunit OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=clpP PE=3 SV=1 | 41 | 246 | 3.0E-79 |
| sp|A9M5C2|CLPP_BRUC2 | ATP-dependent Clp protease proteolytic subunit OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=clpP PE=3 SV=1 | 41 | 246 | 3.0E-79 |
| sp|Q9L7X6|CLPP_BRUAB | ATP-dependent Clp protease proteolytic subunit OS=Brucella abortus biovar 1 (strain 9-941) GN=clpP PE=3 SV=1 | 41 | 246 | 3.0E-79 |
| sp|Q2YPX1|CLPP_BRUA2 | ATP-dependent Clp protease proteolytic subunit OS=Brucella abortus (strain 2308) GN=clpP PE=3 SV=1 | 41 | 246 | 3.0E-79 |
| sp|B2S5W1|CLPP_BRUA1 | ATP-dependent Clp protease proteolytic subunit OS=Brucella abortus (strain S19) GN=clpP PE=3 SV=1 | 41 | 246 | 3.0E-79 |
| sp|Q6G178|CLPP_BARQU | ATP-dependent Clp protease proteolytic subunit OS=Bartonella quintana (strain Toulouse) GN=clpP PE=3 SV=1 | 41 | 243 | 3.0E-79 |
| sp|Q8G0I4|CLPP_BRUSU | ATP-dependent Clp protease proteolytic subunit OS=Brucella suis biovar 1 (strain 1330) GN=clpP PE=3 SV=1 | 41 | 246 | 3.0E-79 |
| sp|Q215J2|CLPP_RHOPB | ATP-dependent Clp protease proteolytic subunit OS=Rhodopseudomonas palustris (strain BisB18) GN=clpP PE=3 SV=1 | 41 | 239 | 4.0E-79 |
| sp|P58277|CLPP1_RHIME | ATP-dependent Clp protease proteolytic subunit 1 OS=Rhizobium meliloti (strain 1021) GN=clpP1 PE=3 SV=1 | 41 | 239 | 5.0E-79 |
| sp|A1W5B6|CLPP_ACISJ | ATP-dependent Clp protease proteolytic subunit OS=Acidovorax sp. (strain JS42) GN=clpP PE=3 SV=1 | 42 | 240 | 6.0E-79 |
| sp|C5BCJ6|CLPP_EDWI9 | ATP-dependent Clp protease proteolytic subunit OS=Edwardsiella ictaluri (strain 93-146) GN=clpP PE=3 SV=1 | 30 | 239 | 7.0E-79 |
| sp|B8I8F5|CLPP_CLOCE | ATP-dependent Clp protease proteolytic subunit OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=clpP PE=3 SV=1 | 41 | 239 | 8.0E-79 |
| sp|A2SFB5|CLPP_METPP | ATP-dependent Clp protease proteolytic subunit OS=Methylibium petroleiphilum (strain PM1) GN=clpP PE=3 SV=1 | 42 | 239 | 8.0E-79 |
| sp|Q4FM94|CLPP_PELUB | ATP-dependent Clp protease proteolytic subunit OS=Pelagibacter ubique (strain HTCC1062) GN=clpP PE=3 SV=1 | 42 | 239 | 9.0E-79 |
| sp|Q6G3Z3|CLPP_BARHE | ATP-dependent Clp protease proteolytic subunit OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=clpP PE=3 SV=1 | 41 | 244 | 9.0E-79 |
| sp|B8DNL4|CLPP_DESVM | ATP-dependent Clp protease proteolytic subunit OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=clpP PE=3 SV=1 | 43 | 239 | 9.0E-79 |
| sp|Q9X6W8|CLPP_AZOBR | ATP-dependent Clp protease proteolytic subunit OS=Azospirillum brasilense GN=clpP PE=3 SV=1 | 36 | 242 | 1.0E-78 |
| sp|Q2GFT8|CLPP_EHRCR | ATP-dependent Clp protease proteolytic subunit OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=clpP PE=3 SV=1 | 41 | 239 | 1.0E-78 |
| sp|Q1GPH5|CLPP_SPHAL | ATP-dependent Clp protease proteolytic subunit OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=clpP PE=3 SV=1 | 38 | 240 | 1.0E-78 |
| sp|B9MG14|CLPP_ACIET | ATP-dependent Clp protease proteolytic subunit OS=Acidovorax ebreus (strain TPSY) GN=clpP PE=3 SV=1 | 42 | 240 | 1.0E-78 |
| sp|A7GIH2|CLPP_CLOBL | ATP-dependent Clp protease proteolytic subunit OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=clpP PE=3 SV=1 | 41 | 239 | 2.0E-78 |
| sp|B1IND7|CLPP_CLOBK | ATP-dependent Clp protease proteolytic subunit OS=Clostridium botulinum (strain Okra / Type B1) GN=clpP PE=3 SV=1 | 41 | 239 | 2.0E-78 |
| sp|C1FLA6|CLPP_CLOBJ | ATP-dependent Clp protease proteolytic subunit OS=Clostridium botulinum (strain Kyoto / Type A2) GN=clpP PE=3 SV=1 | 41 | 239 | 2.0E-78 |
| sp|A5I6W1|CLPP_CLOBH | ATP-dependent Clp protease proteolytic subunit OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=clpP PE=3 SV=1 | 41 | 239 | 2.0E-78 |
| sp|A7FYI2|CLPP_CLOB1 | ATP-dependent Clp protease proteolytic subunit OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=clpP PE=3 SV=1 | 41 | 239 | 2.0E-78 |
| sp|B0SZQ2|CLPP_CAUSK | ATP-dependent Clp protease proteolytic subunit OS=Caulobacter sp. (strain K31) GN=clpP PE=3 SV=1 | 41 | 246 | 2.0E-78 |
| sp|B2A158|CLPP_NATTJ | ATP-dependent Clp protease proteolytic subunit OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=clpP PE=3 SV=1 | 41 | 242 | 2.0E-78 |
| sp|A4WSH8|CLPP_RHOS5 | ATP-dependent Clp protease proteolytic subunit OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=clpP PE=3 SV=1 | 41 | 246 | 2.0E-78 |
| sp|A1USA7|CLPP_BARBK | ATP-dependent Clp protease proteolytic subunit OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=clpP PE=3 SV=1 | 41 | 239 | 3.0E-78 |
| sp|Q891J7|CLPP_CLOTE | ATP-dependent Clp protease proteolytic subunit OS=Clostridium tetani (strain Massachusetts / E88) GN=clpP PE=3 SV=2 | 41 | 239 | 3.0E-78 |
| sp|B1L1D7|CLPP_CLOBM | ATP-dependent Clp protease proteolytic subunit OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=clpP PE=3 SV=1 | 41 | 239 | 4.0E-78 |
| sp|B2UX13|CLPP_CLOBA | ATP-dependent Clp protease proteolytic subunit OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=clpP PE=3 SV=1 | 42 | 241 | 4.0E-78 |
| sp|Q3JAJ8|CLPP_NITOC | ATP-dependent Clp protease proteolytic subunit OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=clpP PE=3 SV=1 | 41 | 239 | 4.0E-78 |
| sp|A9ISA4|CLPP_BART1 | ATP-dependent Clp protease proteolytic subunit OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=clpP PE=3 SV=1 | 41 | 244 | 4.0E-78 |
| sp|Q21Y67|CLPP_RHOFT | ATP-dependent Clp protease proteolytic subunit OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=clpP PE=3 SV=2 | 42 | 239 | 4.0E-78 |
| sp|Q165F9|CLPP_ROSDO | ATP-dependent Clp protease proteolytic subunit OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=clpP PE=3 SV=1 | 41 | 246 | 4.0E-78 |
| sp|O67357|CLPP_AQUAE | ATP-dependent Clp protease proteolytic subunit OS=Aquifex aeolicus (strain VF5) GN=clpP PE=3 SV=1 | 41 | 239 | 5.0E-78 |
| sp|Q2G3T3|CLPP_NOVAD | ATP-dependent Clp protease proteolytic subunit OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=clpP PE=3 SV=1 | 37 | 243 | 5.0E-78 |
| sp|Q982V6|CLPP2_RHILO | ATP-dependent Clp protease proteolytic subunit 2 OS=Rhizobium loti (strain MAFF303099) GN=clpP2 PE=3 SV=1 | 41 | 244 | 5.0E-78 |
| sp|C3JYK0|CLPP_PSEFS | ATP-dependent Clp protease proteolytic subunit OS=Pseudomonas fluorescens (strain SBW25) GN=clpP PE=3 SV=1 | 39 | 240 | 6.0E-78 |
| sp|A5EKA8|CLPP_BRASB | ATP-dependent Clp protease proteolytic subunit OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=clpP PE=3 SV=1 | 41 | 240 | 7.0E-78 |
| sp|Q5FFG7|CLPP_EHRRG | ATP-dependent Clp protease proteolytic subunit OS=Ehrlichia ruminantium (strain Gardel) GN=clpP PE=3 SV=1 | 41 | 239 | 7.0E-78 |
| sp|B1LW28|CLPP_METRJ | ATP-dependent Clp protease proteolytic subunit OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=clpP PE=3 SV=1 | 42 | 240 | 7.0E-78 |
| sp|A1AN85|CLPP_PELPD | ATP-dependent Clp protease proteolytic subunit OS=Pelobacter propionicus (strain DSM 2379) GN=clpP PE=3 SV=1 | 43 | 245 | 8.0E-78 |
| sp|Q8YHC8|CLPP_BRUME | ATP-dependent Clp protease proteolytic subunit OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=clpP PE=3 SV=2 | 41 | 246 | 8.0E-78 |
| sp|C0RJ81|CLPP_BRUMB | ATP-dependent Clp protease proteolytic subunit OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=clpP PE=3 SV=1 | 41 | 246 | 8.0E-78 |
| sp|B1L812|CLPP_THESQ | ATP-dependent Clp protease proteolytic subunit OS=Thermotoga sp. (strain RQ2) GN=clpP PE=3 SV=1 | 43 | 239 | 8.0E-78 |
| sp|A5IJ91|CLPP_THEP1 | ATP-dependent Clp protease proteolytic subunit OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=clpP PE=3 SV=1 | 43 | 239 | 8.0E-78 |
| sp|Q9WZF9|CLPP_THEMA | ATP-dependent Clp protease proteolytic subunit OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=clpP PE=3 SV=1 | 43 | 239 | 8.0E-78 |
| sp|Q3A3X5|CLPP_PELCD | ATP-dependent Clp protease proteolytic subunit OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=clpP PE=3 SV=1 | 41 | 239 | 8.0E-78 |
| sp|A6TM61|CLPP_ALKMQ | ATP-dependent Clp protease proteolytic subunit OS=Alkaliphilus metalliredigens (strain QYMF) GN=clpP PE=3 SV=1 | 42 | 239 | 9.0E-78 |
| sp|A4J7L9|CLPP_DESRM | ATP-dependent Clp protease proteolytic subunit OS=Desulfotomaculum reducens (strain MI-1) GN=clpP PE=3 SV=1 | 40 | 239 | 1.0E-77 |
| sp|C1F6W4|CLPP_ACIC5 | ATP-dependent Clp protease proteolytic subunit OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=clpP PE=3 SV=1 | 42 | 238 | 1.0E-77 |
| sp|B2FQR2|CLPP_STRMK | ATP-dependent Clp protease proteolytic subunit OS=Stenotrophomonas maltophilia (strain K279a) GN=clpP PE=3 SV=1 | 41 | 240 | 1.0E-77 |
| sp|A0Q2L1|CLPP_CLONN | ATP-dependent Clp protease proteolytic subunit OS=Clostridium novyi (strain NT) GN=clpP PE=3 SV=1 | 41 | 239 | 1.0E-77 |
| sp|O30612|CLPP2_MYXXD | ATP-dependent Clp protease proteolytic subunit 2 OS=Myxococcus xanthus (strain DK 1622) GN=clpP2 PE=3 SV=1 | 43 | 239 | 1.0E-77 |
| sp|Q1RJH2|CLPP_RICBR | ATP-dependent Clp protease proteolytic subunit OS=Rickettsia bellii (strain RML369-C) GN=clpP PE=3 SV=2 | 43 | 239 | 1.0E-77 |
| sp|A1KUD9|CLPP_NEIMF | ATP-dependent Clp protease proteolytic subunit OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=clpP PE=3 SV=1 | 42 | 241 | 1.0E-77 |
| sp|A9LZN9|CLPP_NEIM0 | ATP-dependent Clp protease proteolytic subunit OS=Neisseria meningitidis serogroup C (strain 053442) GN=clpP PE=3 SV=1 | 42 | 241 | 1.0E-77 |
| sp|Q21KA9|CLPP_SACD2 | ATP-dependent Clp protease proteolytic subunit OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=clpP PE=3 SV=1 | 42 | 239 | 2.0E-77 |
| sp|Q31GF1|CLPP_THICR | ATP-dependent Clp protease proteolytic subunit OS=Thiomicrospira crunogena (strain XCL-2) GN=clpP PE=3 SV=1 | 35 | 239 | 2.0E-77 |
| sp|A3QFX6|CLPP_SHELP | ATP-dependent Clp protease proteolytic subunit OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=clpP PE=3 SV=1 | 42 | 239 | 2.0E-77 |
| sp|Q837R0|CLPP_ENTFA | ATP-dependent Clp protease proteolytic subunit OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=clpP PE=3 SV=1 | 41 | 237 | 2.0E-77 |
| sp|B8CRF7|CLPP_SHEPW | ATP-dependent Clp protease proteolytic subunit OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=clpP PE=3 SV=1 | 42 | 239 | 2.0E-77 |
| sp|Q9JZ38|CLPP_NEIMB | ATP-dependent Clp protease proteolytic subunit OS=Neisseria meningitidis serogroup B (strain MC58) GN=clpP PE=3 SV=2 | 42 | 241 | 2.0E-77 |
| sp|Q9JU33|CLPP_NEIMA | ATP-dependent Clp protease proteolytic subunit OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=clpP PE=3 SV=1 | 42 | 241 | 2.0E-77 |
| sp|Q5F914|CLPP_NEIG1 | ATP-dependent Clp protease proteolytic subunit OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=clpP PE=3 SV=1 | 42 | 241 | 2.0E-77 |
| sp|A9KWH7|CLPP_SHEB9 | ATP-dependent Clp protease proteolytic subunit OS=Shewanella baltica (strain OS195) GN=clpP PE=3 SV=1 | 42 | 239 | 2.0E-77 |
| sp|A6WLQ1|CLPP_SHEB8 | ATP-dependent Clp protease proteolytic subunit OS=Shewanella baltica (strain OS185) GN=clpP PE=3 SV=1 | 42 | 239 | 2.0E-77 |
| sp|A3D305|CLPP_SHEB5 | ATP-dependent Clp protease proteolytic subunit OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=clpP PE=3 SV=1 | 42 | 239 | 2.0E-77 |
| sp|B8E5E9|CLPP_SHEB2 | ATP-dependent Clp protease proteolytic subunit OS=Shewanella baltica (strain OS223) GN=clpP PE=3 SV=1 | 42 | 239 | 2.0E-77 |
| sp|Q4ZVM7|CLPP_PSEU2 | ATP-dependent Clp protease proteolytic subunit OS=Pseudomonas syringae pv. syringae (strain B728a) GN=clpP PE=3 SV=1 | 39 | 239 | 2.0E-77 |
| sp|Q87YR6|CLPP_PSESM | ATP-dependent Clp protease proteolytic subunit OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=clpP PE=3 SV=2 | 39 | 239 | 2.0E-77 |
| sp|Q48KZ0|CLPP_PSE14 | ATP-dependent Clp protease proteolytic subunit OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=clpP PE=3 SV=1 | 39 | 239 | 2.0E-77 |
| sp|C5CJT4|CLPP_VARPS | ATP-dependent Clp protease proteolytic subunit OS=Variovorax paradoxus (strain S110) GN=clpP PE=3 SV=1 | 42 | 239 | 3.0E-77 |
| sp|A5CXJ8|CLPP_VESOH | ATP-dependent Clp protease proteolytic subunit OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=clpP PE=3 SV=1 | 41 | 239 | 3.0E-77 |
| sp|Q11J60|CLPP1_CHESB | ATP-dependent Clp protease proteolytic subunit 1 OS=Chelativorans sp. (strain BNC1) GN=clpP1 PE=3 SV=1 | 41 | 239 | 3.0E-77 |
| sp|B9KJU9|CLPP_RHOSK | ATP-dependent Clp protease proteolytic subunit OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=clpP PE=3 SV=1 | 42 | 246 | 3.0E-77 |
| sp|Q3J1G6|CLPP_RHOS4 | ATP-dependent Clp protease proteolytic subunit OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=clpP PE=3 SV=1 | 42 | 246 | 3.0E-77 |
| sp|A3PKS1|CLPP_RHOS1 | ATP-dependent Clp protease proteolytic subunit OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=clpP PE=3 SV=1 | 42 | 246 | 3.0E-77 |
| sp|Q9ZD29|CLPP_RICPR | ATP-dependent Clp protease proteolytic subunit OS=Rickettsia prowazekii (strain Madrid E) GN=clpP PE=3 SV=1 | 43 | 241 | 4.0E-77 |
| sp|Q24S49|CLPP2_DESHY | ATP-dependent Clp protease proteolytic subunit 2 OS=Desulfitobacterium hafniense (strain Y51) GN=clpP2 PE=3 SV=1 | 42 | 238 | 4.0E-77 |
| sp|B0TLU9|CLPP_SHEHH | ATP-dependent Clp protease proteolytic subunit OS=Shewanella halifaxensis (strain HAW-EB4) GN=clpP PE=3 SV=1 | 42 | 239 | 5.0E-77 |
| sp|Q4ULF0|CLPP_RICFE | ATP-dependent Clp protease proteolytic subunit OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=clpP PE=3 SV=1 | 43 | 239 | 5.0E-77 |
| sp|A7HZE8|CLPP_CAMHC | ATP-dependent Clp protease proteolytic subunit OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=clpP PE=3 SV=1 | 42 | 241 | 5.0E-77 |
| sp|A8FTH9|CLPP_SHESH | ATP-dependent Clp protease proteolytic subunit OS=Shewanella sediminis (strain HAW-EB3) GN=clpP PE=3 SV=1 | 42 | 239 | 5.0E-77 |
| sp|P58276|CLPP_CLOAB | ATP-dependent Clp protease proteolytic subunit OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=clpP PE=3 SV=1 | 41 | 238 | 6.0E-77 |
| sp|A8H614|CLPP_SHEPA | ATP-dependent Clp protease proteolytic subunit OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=clpP PE=3 SV=1 | 42 | 239 | 6.0E-77 |
| sp|C1D539|CLPP_LARHH | ATP-dependent Clp protease proteolytic subunit OS=Laribacter hongkongensis (strain HLHK9) GN=clpP PE=3 SV=1 | 33 | 239 | 6.0E-77 |
| sp|Q2NV79|CLPP_SODGM | ATP-dependent Clp protease proteolytic subunit OS=Sodalis glossinidius (strain morsitans) GN=clpP PE=3 SV=2 | 42 | 239 | 8.0E-77 |
| sp|Q0AQ07|CLPP_MARMM | ATP-dependent Clp protease proteolytic subunit OS=Maricaulis maris (strain MCS10) GN=clpP PE=3 SV=1 | 41 | 239 | 8.0E-77 |
| sp|A6VW20|CLPP_MARMS | ATP-dependent Clp protease proteolytic subunit OS=Marinomonas sp. (strain MWYL1) GN=clpP PE=3 SV=1 | 39 | 239 | 1.0E-76 |
| sp|Q1H1G0|CLPP_METFK | ATP-dependent Clp protease proteolytic subunit OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=clpP PE=3 SV=1 | 43 | 239 | 1.0E-76 |
| sp|Q12LA1|CLPP_SHEDO | ATP-dependent Clp protease proteolytic subunit OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=clpP PE=3 SV=1 | 42 | 239 | 1.0E-76 |
| sp|Q5GS83|CLPP_WOLTR | ATP-dependent Clp protease proteolytic subunit OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=clpP PE=3 SV=1 | 42 | 239 | 1.0E-76 |
| sp|B2GAL4|CLPP_LACF3 | ATP-dependent Clp protease proteolytic subunit OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=clpP PE=3 SV=1 | 41 | 237 | 1.0E-76 |
| sp|Q3K9W9|CLPP_PSEPF | ATP-dependent Clp protease proteolytic subunit OS=Pseudomonas fluorescens (strain Pf0-1) GN=clpP PE=3 SV=1 | 39 | 240 | 1.0E-76 |
| sp|Q7M7M3|CLPP_WOLSU | ATP-dependent Clp protease proteolytic subunit OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=clpP PE=3 SV=1 | 41 | 238 | 2.0E-76 |
| sp|B0K533|CLPP_THEPX | ATP-dependent Clp protease proteolytic subunit OS=Thermoanaerobacter sp. (strain X514) GN=clpP PE=3 SV=1 | 41 | 238 | 2.0E-76 |
| sp|B0KBA4|CLPP_THEP3 | ATP-dependent Clp protease proteolytic subunit OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=clpP PE=3 SV=1 | 41 | 238 | 2.0E-76 |
| sp|Q73I59|CLPP_WOLPM | ATP-dependent Clp protease proteolytic subunit OS=Wolbachia pipientis wMel GN=clpP PE=3 SV=1 | 42 | 239 | 2.0E-76 |
| sp|Q6LNW0|CLPP_PHOPR | ATP-dependent Clp protease proteolytic subunit OS=Photobacterium profundum GN=clpP PE=3 SV=2 | 37 | 239 | 2.0E-76 |
| sp|B1KLT7|CLPP_SHEWM | ATP-dependent Clp protease proteolytic subunit OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=clpP PE=3 SV=1 | 42 | 239 | 2.0E-76 |
| sp|Q88KJ0|CLPP_PSEPK | ATP-dependent Clp protease proteolytic subunit OS=Pseudomonas putida (strain KT2440) GN=clpP PE=3 SV=1 | 39 | 239 | 2.0E-76 |
| sp|A5W635|CLPP_PSEP1 | ATP-dependent Clp protease proteolytic subunit OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=clpP PE=3 SV=1 | 39 | 239 | 2.0E-76 |
| sp|B8IN26|CLPP_METNO | ATP-dependent Clp protease proteolytic subunit OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=clpP PE=3 SV=1 | 42 | 239 | 3.0E-76 |
| sp|A8EYM5|CLPP_RICCK | ATP-dependent Clp protease proteolytic subunit OS=Rickettsia canadensis (strain McKiel) GN=clpP PE=3 SV=1 | 43 | 239 | 3.0E-76 |
| sp|A1TM62|CLPP_ACIAC | ATP-dependent Clp protease proteolytic subunit OS=Acidovorax citrulli (strain AAC00-1) GN=clpP PE=3 SV=1 | 42 | 240 | 3.0E-76 |
| sp|A9IR54|CLPP_BORPD | ATP-dependent Clp protease proteolytic subunit OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=clpP PE=3 SV=1 | 30 | 239 | 3.0E-76 |
| sp|Q2Y6J0|CLPP_NITMU | ATP-dependent Clp protease proteolytic subunit OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=clpP PE=3 SV=1 | 29 | 239 | 3.0E-76 |
| sp|B2G613|CLPP_LACRJ | ATP-dependent Clp protease proteolytic subunit OS=Lactobacillus reuteri (strain JCM 1112) GN=clpP PE=3 SV=1 | 41 | 239 | 3.0E-76 |
| sp|A5VII4|CLPP_LACRD | ATP-dependent Clp protease proteolytic subunit OS=Lactobacillus reuteri (strain DSM 20016) GN=clpP PE=3 SV=1 | 41 | 239 | 3.0E-76 |
| sp|C0R2W3|CLPP_WOLWR | ATP-dependent Clp protease proteolytic subunit OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=clpP PE=3 SV=1 | 42 | 239 | 3.0E-76 |
| sp|Q4K9J6|CLPP_PSEF5 | ATP-dependent Clp protease proteolytic subunit OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=clpP PE=3 SV=1 | 39 | 240 | 4.0E-76 |
| sp|B1J692|CLPP_PSEPW | ATP-dependent Clp protease proteolytic subunit OS=Pseudomonas putida (strain W619) GN=clpP PE=3 SV=1 | 39 | 239 | 4.0E-76 |
| sp|P58278|CLPP2_RHIME | ATP-dependent Clp protease proteolytic subunit 2 OS=Rhizobium meliloti (strain 1021) GN=clpP2 PE=3 SV=1 | 42 | 239 | 5.0E-76 |
| sp|Q3SI98|CLPP_THIDA | ATP-dependent Clp protease proteolytic subunit OS=Thiobacillus denitrificans (strain ATCC 25259) GN=clpP PE=3 SV=1 | 36 | 239 | 5.0E-76 |
| sp|Q7VXI7|CLPP_BORPE | ATP-dependent Clp protease proteolytic subunit OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=clpP PE=3 SV=1 | 30 | 239 | 5.0E-76 |
| sp|Q7W8X2|CLPP_BORPA | ATP-dependent Clp protease proteolytic subunit OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=clpP PE=3 SV=1 | 30 | 239 | 5.0E-76 |
| sp|Q7WK83|CLPP_BORBR | ATP-dependent Clp protease proteolytic subunit OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=clpP PE=3 SV=1 | 30 | 239 | 5.0E-76 |
| sp|C4K4P2|CLPP_HAMD5 | ATP-dependent Clp protease proteolytic subunit OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=clpP PE=3 SV=1 | 27 | 239 | 6.0E-76 |
| sp|Q2SK36|CLPP_HAHCH | ATP-dependent Clp protease proteolytic subunit OS=Hahella chejuensis (strain KCTC 2396) GN=clpP PE=3 SV=2 | 42 | 239 | 6.0E-76 |
| sp|A8MIS8|CLPP_ALKOO | ATP-dependent Clp protease proteolytic subunit OS=Alkaliphilus oremlandii (strain OhILAs) GN=clpP PE=3 SV=1 | 42 | 236 | 6.0E-76 |
| sp|Q472D3|CLPP_CUPPJ | ATP-dependent Clp protease proteolytic subunit OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=clpP PE=3 SV=1 | 42 | 239 | 7.0E-76 |
| sp|A8GNZ4|CLPP_RICAH | ATP-dependent Clp protease proteolytic subunit OS=Rickettsia akari (strain Hartford) GN=clpP PE=3 SV=1 | 43 | 239 | 7.0E-76 |
| sp|A1WR17|CLPP_VEREI | ATP-dependent Clp protease proteolytic subunit OS=Verminephrobacter eiseniae (strain EF01-2) GN=clpP PE=3 SV=1 | 42 | 239 | 8.0E-76 |
| sp|Q07ZX8|CLPP_SHEFN | ATP-dependent Clp protease proteolytic subunit OS=Shewanella frigidimarina (strain NCIMB 400) GN=clpP PE=3 SV=1 | 42 | 239 | 9.0E-76 |
| sp|Q92HM5|CLPP_RICCN | ATP-dependent Clp protease proteolytic subunit OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=clpP PE=3 SV=2 | 43 | 239 | 1.0E-75 |
| sp|Q6D827|CLPP_PECAS | ATP-dependent Clp protease proteolytic subunit OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=clpP PE=3 SV=1 | 26 | 239 | 1.0E-75 |
| sp|A1WUM7|CLPP_HALHL | ATP-dependent Clp protease proteolytic subunit OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=clpP PE=3 SV=1 | 39 | 243 | 2.0E-75 |
| sp|Q2L256|CLPP_BORA1 | ATP-dependent Clp protease proteolytic subunit OS=Bordetella avium (strain 197N) GN=clpP PE=3 SV=2 | 37 | 239 | 2.0E-75 |
| sp|C4ZGF4|CLPP_EUBR3 | ATP-dependent Clp protease proteolytic subunit OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=clpP PE=3 SV=1 | 41 | 239 | 2.0E-75 |
| sp|C4K1D4|CLPP_RICPU | ATP-dependent Clp protease proteolytic subunit OS=Rickettsia peacockii (strain Rustic) GN=clpP PE=3 SV=1 | 43 | 239 | 2.0E-75 |
| sp|B3CLB1|CLPP_WOLPP | ATP-dependent Clp protease proteolytic subunit OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=clpP PE=3 SV=1 | 42 | 239 | 2.0E-75 |
| sp|Q0HTK7|CLPP_SHESR | ATP-dependent Clp protease proteolytic subunit OS=Shewanella sp. (strain MR-7) GN=clpP PE=3 SV=1 | 42 | 239 | 2.0E-75 |
| sp|A1S4X5|CLPP_SHEAM | ATP-dependent Clp protease proteolytic subunit OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=clpP PE=3 SV=1 | 42 | 239 | 2.0E-75 |
| sp|B0KJG6|CLPP_PSEPG | ATP-dependent Clp protease proteolytic subunit OS=Pseudomonas putida (strain GB-1) GN=clpP PE=3 SV=1 | 39 | 239 | 2.0E-75 |
| sp|Q68WL5|CLPP_RICTY | ATP-dependent Clp protease proteolytic subunit OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=clpP PE=3 SV=1 | 43 | 239 | 2.0E-75 |
| sp|A8GSH5|CLPP_RICRS | ATP-dependent Clp protease proteolytic subunit OS=Rickettsia rickettsii (strain Sheila Smith) GN=clpP PE=3 SV=1 | 43 | 239 | 2.0E-75 |
| sp|Q5H434|CLPP_XANOR | ATP-dependent Clp protease proteolytic subunit OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=clpP PE=3 SV=1 | 41 | 240 | 3.0E-75 |
| sp|B2SMI3|CLPP_XANOP | ATP-dependent Clp protease proteolytic subunit OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=clpP PE=3 SV=1 | 41 | 240 | 3.0E-75 |
| sp|Q2P6Z0|CLPP_XANOM | ATP-dependent Clp protease proteolytic subunit OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=clpP PE=3 SV=1 | 41 | 240 | 3.0E-75 |
| sp|B0RTF7|CLPP_XANCB | ATP-dependent Clp protease proteolytic subunit OS=Xanthomonas campestris pv. campestris (strain B100) GN=clpP PE=3 SV=1 | 41 | 240 | 3.0E-75 |
| sp|Q3BWQ1|CLPP_XANC5 | ATP-dependent Clp protease proteolytic subunit OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=clpP PE=3 SV=1 | 41 | 240 | 3.0E-75 |
| sp|Q8PNI5|CLPP_XANAC | ATP-dependent Clp protease proteolytic subunit OS=Xanthomonas axonopodis pv. citri (strain 306) GN=clpP PE=3 SV=1 | 41 | 240 | 3.0E-75 |
| sp|P43867|CLPP_HAEIN | ATP-dependent Clp protease proteolytic subunit OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=clpP PE=3 SV=1 | 41 | 239 | 3.0E-75 |
| sp|Q4QMK5|CLPP_HAEI8 | ATP-dependent Clp protease proteolytic subunit OS=Haemophilus influenzae (strain 86-028NP) GN=clpP PE=3 SV=1 | 41 | 239 | 3.0E-75 |
| sp|A6Q1C1|CLPP_NITSB | ATP-dependent Clp protease proteolytic subunit OS=Nitratiruptor sp. (strain SB155-2) GN=clpP PE=3 SV=1 | 43 | 238 | 3.0E-75 |
| sp|Q5NNY8|CLPP_ZYMMO | ATP-dependent Clp protease proteolytic subunit OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=clpP PE=3 SV=1 | 42 | 242 | 3.0E-75 |
| sp|A1RL89|CLPP_SHESW | ATP-dependent Clp protease proteolytic subunit OS=Shewanella sp. (strain W3-18-1) GN=clpP PE=3 SV=1 | 42 | 239 | 3.0E-75 |
| sp|A4Y5I2|CLPP_SHEPC | ATP-dependent Clp protease proteolytic subunit OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=clpP PE=3 SV=1 | 42 | 239 | 3.0E-75 |
| sp|Q1LM62|CLPP_CUPMC | ATP-dependent Clp protease proteolytic subunit OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=clpP PE=3 SV=1 | 42 | 239 | 4.0E-75 |
| sp|Q8XYP7|CLPP_RALSO | ATP-dependent Clp protease proteolytic subunit OS=Ralstonia solanacearum (strain GMI1000) GN=clpP PE=3 SV=1 | 42 | 239 | 4.0E-75 |
| sp|Q3IF46|CLPP_PSEHT | ATP-dependent Clp protease proteolytic subunit OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=clpP PE=3 SV=1 | 38 | 239 | 4.0E-75 |
| sp|Q1LTJ9|CLPP_BAUCH | ATP-dependent Clp protease proteolytic subunit OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=clpP PE=3 SV=1 | 37 | 239 | 5.0E-75 |
| sp|Q8EG19|CLPP_SHEON | ATP-dependent Clp protease proteolytic subunit OS=Shewanella oneidensis (strain MR-1) GN=clpP PE=3 SV=1 | 42 | 239 | 5.0E-75 |
| sp|Q1DAT0|CLPP1_MYXXD | ATP-dependent Clp protease proteolytic subunit 1 OS=Myxococcus xanthus (strain DK 1622) GN=clpP1 PE=3 SV=1 | 43 | 235 | 5.0E-75 |
| sp|A4XTZ5|CLPP_PSEMY | ATP-dependent Clp protease proteolytic subunit OS=Pseudomonas mendocina (strain ymp) GN=clpP PE=3 SV=1 | 39 | 239 | 6.0E-75 |
| sp|Q30NX1|CLPP_SULDN | ATP-dependent Clp protease proteolytic subunit OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=clpP PE=3 SV=1 | 43 | 239 | 7.0E-75 |
| sp|Q8PBY6|CLPP_XANCP | ATP-dependent Clp protease proteolytic subunit OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=clpP PE=3 SV=1 | 41 | 240 | 7.0E-75 |
| sp|Q4URL4|CLPP_XANC8 | ATP-dependent Clp protease proteolytic subunit OS=Xanthomonas campestris pv. campestris (strain 8004) GN=clpP PE=3 SV=1 | 41 | 240 | 7.0E-75 |
| sp|Q30Z79|CLPP_DESAG | ATP-dependent Clp protease proteolytic subunit OS=Desulfovibrio alaskensis (strain G20) GN=clpP PE=3 SV=1 | 43 | 239 | 7.0E-75 |
| sp|A7HFV9|CLPP_ANADF | ATP-dependent Clp protease proteolytic subunit OS=Anaeromyxobacter sp. (strain Fw109-5) GN=clpP PE=3 SV=1 | 43 | 242 | 7.0E-75 |
| sp|A0LDT4|CLPP_MAGMM | ATP-dependent Clp protease proteolytic subunit OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=clpP PE=3 SV=1 | 41 | 246 | 7.0E-75 |
| sp|B3R4W1|CLPP_CUPTR | ATP-dependent Clp protease proteolytic subunit OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=clpP PE=3 SV=1 | 42 | 239 | 7.0E-75 |
| sp|Q0KBK4|CLPP_CUPNH | ATP-dependent Clp protease proteolytic subunit OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=clpP PE=3 SV=1 | 42 | 239 | 7.0E-75 |
| sp|Q0AJI2|CLPP_NITEC | ATP-dependent Clp protease proteolytic subunit OS=Nitrosomonas eutropha (strain C91) GN=clpP PE=3 SV=1 | 42 | 239 | 8.0E-75 |
| sp|Q0HHA1|CLPP_SHESM | ATP-dependent Clp protease proteolytic subunit OS=Shewanella sp. (strain MR-4) GN=clpP PE=3 SV=1 | 42 | 239 | 8.0E-75 |
| sp|A8ZXB7|CLPP_DESOH | ATP-dependent Clp protease proteolytic subunit OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=clpP PE=3 SV=1 | 42 | 243 | 8.0E-75 |
| sp|A5UHJ6|CLPP_HAEIG | ATP-dependent Clp protease proteolytic subunit OS=Haemophilus influenzae (strain PittGG) GN=clpP PE=3 SV=1 | 41 | 239 | 9.0E-75 |
| sp|A5UE11|CLPP_HAEIE | ATP-dependent Clp protease proteolytic subunit OS=Haemophilus influenzae (strain PittEE) GN=clpP PE=3 SV=1 | 41 | 239 | 9.0E-75 |
| sp|A0KYL9|CLPP_SHESA | ATP-dependent Clp protease proteolytic subunit OS=Shewanella sp. (strain ANA-3) GN=clpP PE=3 SV=1 | 42 | 239 | 9.0E-75 |
| sp|B7VI00|CLPP_VIBTL | ATP-dependent Clp protease proteolytic subunit OS=Vibrio tasmaniensis (strain LGP32) GN=clpP PE=3 SV=1 | 30 | 239 | 1.0E-74 |
| sp|Q5HWX6|CLPP_CAMJR | ATP-dependent Clp protease proteolytic subunit OS=Campylobacter jejuni (strain RM1221) GN=clpP PE=3 SV=1 | 42 | 238 | 1.0E-74 |
| sp|P54413|CLPP_CAMJE | ATP-dependent Clp protease proteolytic subunit OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=clpP PE=3 SV=2 | 42 | 238 | 1.0E-74 |
| sp|A7H1R0|CLPP_CAMJD | ATP-dependent Clp protease proteolytic subunit OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=clpP PE=3 SV=1 | 42 | 238 | 1.0E-74 |
| sp|A8FJZ3|CLPP_CAMJ8 | ATP-dependent Clp protease proteolytic subunit OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=clpP PE=3 SV=1 | 42 | 238 | 1.0E-74 |
| sp|Q87R80|CLPP_VIBPA | ATP-dependent Clp protease proteolytic subunit OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=clpP PE=3 SV=1 | 42 | 239 | 1.0E-74 |
| sp|A1VE85|CLPP_DESVV | ATP-dependent Clp protease proteolytic subunit OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=clpP PE=3 SV=1 | 43 | 245 | 1.0E-74 |
| sp|Q72CE8|CLPP_DESVH | ATP-dependent Clp protease proteolytic subunit OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=clpP PE=3 SV=1 | 43 | 245 | 1.0E-74 |
| sp|Q9K709|CLPP1_BACHD | ATP-dependent Clp protease proteolytic subunit 1 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=clpP1 PE=3 SV=1 | 41 | 237 | 1.0E-74 |
| sp|A7MV87|CLPP_VIBCB | ATP-dependent Clp protease proteolytic subunit OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=clpP PE=3 SV=1 | 30 | 239 | 1.0E-74 |
| sp|Q6AK59|CLPP_DESPS | ATP-dependent Clp protease proteolytic subunit OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=clpP PE=3 SV=2 | 41 | 239 | 1.0E-74 |
| sp|Q47XL8|CLPP_COLP3 | ATP-dependent Clp protease proteolytic subunit OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=clpP PE=3 SV=1 | 42 | 239 | 1.0E-74 |
| sp|B9KDZ6|CLPP_CAMLR | ATP-dependent Clp protease proteolytic subunit OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=clpP PE=3 SV=1 | 43 | 238 | 1.0E-74 |
| sp|Q9PE41|CLPP_XYLFA | ATP-dependent Clp protease proteolytic subunit OS=Xylella fastidiosa (strain 9a5c) GN=clpP PE=3 SV=1 | 41 | 240 | 1.0E-74 |
| sp|Q9X5N0|CLPP2_MYXXA | ATP-dependent Clp protease proteolytic subunit 2 OS=Myxococcus xanthus GN=clpP2 PE=3 SV=1 | 43 | 235 | 1.0E-74 |
| sp|A1AVN6|CLPP_RUTMC | ATP-dependent Clp protease proteolytic subunit OS=Ruthia magnifica subsp. Calyptogena magnifica GN=clpP PE=3 SV=1 | 41 | 239 | 1.0E-74 |
| sp|Q38Y96|CLPP_LACSS | ATP-dependent Clp protease proteolytic subunit OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=clpP PE=3 SV=1 | 42 | 240 | 1.0E-74 |
| sp|B3WCR2|CLPP_LACCB | ATP-dependent Clp protease proteolytic subunit OS=Lactobacillus casei (strain BL23) GN=clpP PE=3 SV=1 | 42 | 241 | 2.0E-74 |
| sp|Q03AL0|CLPP_LACC3 | ATP-dependent Clp protease proteolytic subunit OS=Lactobacillus casei (strain ATCC 334) GN=clpP PE=3 SV=1 | 42 | 241 | 2.0E-74 |
| sp|Q03SM3|CLPP_LACBA | ATP-dependent Clp protease proteolytic subunit OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=clpP PE=3 SV=1 | 41 | 236 | 2.0E-74 |
| sp|Q60107|CLPP_YEREN | ATP-dependent Clp protease proteolytic subunit OS=Yersinia enterocolitica GN=clpP PE=3 SV=1 | 26 | 239 | 2.0E-74 |
| sp|A1JNN2|CLPP_YERE8 | ATP-dependent Clp protease proteolytic subunit OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=clpP PE=3 SV=1 | 26 | 239 | 2.0E-74 |
| sp|Q1GB31|CLPP_LACDA | ATP-dependent Clp protease proteolytic subunit OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=clpP PE=3 SV=1 | 42 | 236 | 2.0E-74 |
| sp|B8F822|CLPP_HAEPS | ATP-dependent Clp protease proteolytic subunit OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=clpP PE=3 SV=1 | 42 | 239 | 2.0E-74 |
| sp|Q15R46|CLPP_PSEA6 | ATP-dependent Clp protease proteolytic subunit OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=clpP PE=3 SV=1 | 38 | 245 | 2.0E-74 |
| sp|B6EHK3|CLPP_ALISL | ATP-dependent Clp protease proteolytic subunit OS=Aliivibrio salmonicida (strain LFI1238) GN=clpP PE=3 SV=1 | 30 | 239 | 2.0E-74 |
| sp|Q82Y57|CLPP_NITEU | ATP-dependent Clp protease proteolytic subunit OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=clpP PE=3 SV=1 | 42 | 239 | 3.0E-74 |
| sp|B5YI38|CLPP_THEYD | ATP-dependent Clp protease proteolytic subunit OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=clpP PE=3 SV=1 | 41 | 236 | 3.0E-74 |
| sp|Q04BH7|CLPP_LACDB | ATP-dependent Clp protease proteolytic subunit OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=clpP PE=3 SV=1 | 42 | 236 | 3.0E-74 |
| sp|Q8ENM5|CLPP_OCEIH | ATP-dependent Clp protease proteolytic subunit OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=clpP PE=3 SV=1 | 41 | 239 | 4.0E-74 |
| sp|Q5LUQ0|CLPP_RUEPO | ATP-dependent Clp protease proteolytic subunit OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=clpP PE=3 SV=1 | 42 | 243 | 4.0E-74 |
| sp|A1VXS0|CLPP_CAMJJ | ATP-dependent Clp protease proteolytic subunit OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=clpP PE=3 SV=1 | 42 | 238 | 4.0E-74 |
| sp|Q9CJM2|CLPP_PASMU | ATP-dependent Clp protease proteolytic subunit OS=Pasteurella multocida (strain Pm70) GN=clpP PE=3 SV=1 | 41 | 239 | 4.0E-74 |
| sp|A8WPG6|CLPP1_CAEBR | ATP-dependent Clp protease proteolytic subunit 1, mitochondrial OS=Caenorhabditis briggsae GN=clpp-1 PE=3 SV=2 | 43 | 235 | 4.0E-74 |
| sp|Q928C4|CLPP_LISIN | ATP-dependent Clp protease proteolytic subunit OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=clpP PE=3 SV=1 | 41 | 239 | 5.0E-74 |
| sp|Q9RQI6|CLPP_LISMO | ATP-dependent Clp protease proteolytic subunit OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=clpP PE=1 SV=1 | 41 | 236 | 5.0E-74 |
| sp|Q71WV9|CLPP_LISMF | ATP-dependent Clp protease proteolytic subunit OS=Listeria monocytogenes serotype 4b (strain F2365) GN=clpP PE=3 SV=1 | 41 | 236 | 5.0E-74 |
| sp|B4EU53|CLPP_PROMH | ATP-dependent Clp protease proteolytic subunit OS=Proteus mirabilis (strain HI4320) GN=clpP PE=3 SV=1 | 26 | 239 | 5.0E-74 |
| sp|C5D7M9|CLPP_GEOSW | ATP-dependent Clp protease proteolytic subunit OS=Geobacillus sp. (strain WCH70) GN=clpP PE=3 SV=1 | 41 | 238 | 5.0E-74 |
| sp|B5FBZ8|CLPP_VIBFM | ATP-dependent Clp protease proteolytic subunit OS=Vibrio fischeri (strain MJ11) GN=clpP PE=3 SV=1 | 30 | 239 | 5.0E-74 |
| sp|Q5E6Q5|CLPP_VIBF1 | ATP-dependent Clp protease proteolytic subunit OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=clpP PE=3 SV=1 | 30 | 239 | 5.0E-74 |
| sp|Q1MIM7|CLPP2_RHIL3 | ATP-dependent Clp protease proteolytic subunit 2 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=clpP2 PE=3 SV=1 | 42 | 239 | 5.0E-74 |
| sp|Q65EI5|CLPP1_BACLD | ATP-dependent Clp protease proteolytic subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=clpP1 PE=3 SV=1 | 41 | 238 | 6.0E-74 |
| sp|Q2RZ59|CLPP2_SALRD | ATP-dependent Clp protease proteolytic subunit 2 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=clpP2 PE=3 SV=2 | 38 | 236 | 6.0E-74 |
| sp|Q8KC73|CLPP_CHLTE | ATP-dependent Clp protease proteolytic subunit OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=clpP PE=3 SV=1 | 39 | 244 | 7.0E-74 |
| sp|Q5SKM8|CLPP_THET8 | ATP-dependent Clp protease proteolytic subunit OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=clpP PE=3 SV=1 | 42 | 238 | 7.0E-74 |
| sp|Q72L15|CLPP_THET2 | ATP-dependent Clp protease proteolytic subunit OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=clpP PE=3 SV=2 | 42 | 238 | 7.0E-74 |
| sp|Q2K9U7|CLPP2_RHIEC | ATP-dependent Clp protease proteolytic subunit 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=clpP2 PE=3 SV=1 | 42 | 239 | 8.0E-74 |
| sp|Q3ATL3|CLPP_CHLCH | ATP-dependent Clp protease proteolytic subunit OS=Chlorobium chlorochromatii (strain CaD3) GN=clpP PE=3 SV=1 | 39 | 243 | 8.0E-74 |
| sp|Q89WR7|CLPP1_BRADU | ATP-dependent Clp protease proteolytic subunit 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=clpP1 PE=3 SV=1 | 42 | 242 | 9.0E-74 |
| sp|Q13Z15|CLPP2_BURXL | ATP-dependent Clp protease proteolytic subunit 2 OS=Burkholderia xenovorans (strain LB400) GN=clpP2 PE=3 SV=1 | 26 | 240 | 9.0E-74 |
| sp|Q11I48|CLPP2_CHESB | ATP-dependent Clp protease proteolytic subunit 2 OS=Chelativorans sp. (strain BNC1) GN=clpP2 PE=3 SV=1 | 39 | 239 | 1.0E-73 |
| sp|Q0BEF6|CLPP_BURCM | ATP-dependent Clp protease proteolytic subunit OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=clpP PE=3 SV=1 | 42 | 240 | 1.0E-73 |
| sp|A0K847|CLPP_BURCH | ATP-dependent Clp protease proteolytic subunit OS=Burkholderia cenocepacia (strain HI2424) GN=clpP PE=3 SV=1 | 42 | 240 | 1.0E-73 |
| sp|Q1BH85|CLPP_BURCA | ATP-dependent Clp protease proteolytic subunit OS=Burkholderia cenocepacia (strain AU 1054) GN=clpP PE=3 SV=1 | 42 | 240 | 1.0E-73 |
| sp|Q2LTK5|CLPP_SYNAS | ATP-dependent Clp protease proteolytic subunit OS=Syntrophus aciditrophicus (strain SB) GN=clpP PE=3 SV=1 | 41 | 239 | 2.0E-73 |
| sp|Q72XW9|CLPP2_BACC1 | ATP-dependent Clp protease proteolytic subunit 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=clpP2 PE=3 SV=1 | 41 | 239 | 2.0E-73 |
| sp|B8IYM2|CLPP_DESDA | ATP-dependent Clp protease proteolytic subunit OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=clpP PE=3 SV=1 | 41 | 239 | 2.0E-73 |
| sp|Q2RL31|CLPP_MOOTA | ATP-dependent Clp protease proteolytic subunit OS=Moorella thermoacetica (strain ATCC 39073) GN=clpP PE=3 SV=1 | 42 | 239 | 2.0E-73 |
| sp|Q2IEW1|CLPP_ANADE | ATP-dependent Clp protease proteolytic subunit OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=clpP PE=3 SV=1 | 43 | 244 | 2.0E-73 |
| sp|B8J5G7|CLPP_ANAD2 | ATP-dependent Clp protease proteolytic subunit OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=clpP PE=3 SV=1 | 43 | 244 | 2.0E-73 |
| sp|C0QGT0|CLPP_DESAH | ATP-dependent Clp protease proteolytic subunit OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=clpP PE=3 SV=1 | 42 | 239 | 2.0E-73 |
| sp|Q1IRD8|CLPP_KORVE | ATP-dependent Clp protease proteolytic subunit OS=Koribacter versatilis (strain Ellin345) GN=clpP PE=3 SV=1 | 42 | 238 | 2.0E-73 |
| sp|A4JF05|CLPP_BURVG | ATP-dependent Clp protease proteolytic subunit OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=clpP PE=3 SV=1 | 42 | 240 | 2.0E-73 |
| sp|Q39FE8|CLPP_BURL3 | ATP-dependent Clp protease proteolytic subunit OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=clpP PE=3 SV=1 | 42 | 240 | 3.0E-73 |
| sp|Q1MQ79|CLPP_LAWIP | ATP-dependent Clp protease proteolytic subunit OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=clpP PE=3 SV=1 | 43 | 243 | 3.0E-73 |
| sp|B0UW20|CLPP_HISS2 | ATP-dependent Clp protease proteolytic subunit OS=Histophilus somni (strain 2336) GN=clpP PE=3 SV=1 | 41 | 239 | 3.0E-73 |
| sp|Q63V41|CLPP_BURPS | ATP-dependent Clp protease proteolytic subunit OS=Burkholderia pseudomallei (strain K96243) GN=clpP PE=3 SV=1 | 14 | 240 | 3.0E-73 |
| sp|A3NAI5|CLPP_BURP6 | ATP-dependent Clp protease proteolytic subunit OS=Burkholderia pseudomallei (strain 668) GN=clpP PE=3 SV=1 | 14 | 240 | 3.0E-73 |
| sp|A3NWA6|CLPP_BURP0 | ATP-dependent Clp protease proteolytic subunit OS=Burkholderia pseudomallei (strain 1106a) GN=clpP PE=3 SV=1 | 14 | 240 | 3.0E-73 |
| sp|A1V4X1|CLPP_BURMS | ATP-dependent Clp protease proteolytic subunit OS=Burkholderia mallei (strain SAVP1) GN=clpP PE=3 SV=1 | 14 | 240 | 3.0E-73 |
| sp|A2SBG3|CLPP_BURM9 | ATP-dependent Clp protease proteolytic subunit OS=Burkholderia mallei (strain NCTC 10229) GN=clpP PE=3 SV=1 | 14 | 240 | 3.0E-73 |
| sp|A3MKJ8|CLPP_BURM7 | ATP-dependent Clp protease proteolytic subunit OS=Burkholderia mallei (strain NCTC 10247) GN=clpP PE=3 SV=1 | 14 | 240 | 3.0E-73 |
| sp|Q03GX1|CLPP_PEDPA | ATP-dependent Clp protease proteolytic subunit OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=clpP PE=3 SV=1 | 41 | 239 | 3.0E-73 |
| sp|Q3JRC9|CLPP_BURP1 | ATP-dependent Clp protease proteolytic subunit OS=Burkholderia pseudomallei (strain 1710b) GN=clpP PE=3 SV=1 | 42 | 240 | 4.0E-73 |
| sp|Q62JK7|CLPP_BURMA | ATP-dependent Clp protease proteolytic subunit OS=Burkholderia mallei (strain ATCC 23344) GN=clpP PE=3 SV=1 | 42 | 240 | 4.0E-73 |
| sp|B0TZA5|CLPP_FRAP2 | ATP-dependent Clp protease proteolytic subunit OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=clpP PE=3 SV=1 | 39 | 239 | 4.0E-73 |
| sp|A8FHN9|CLPP_BACP2 | ATP-dependent Clp protease proteolytic subunit OS=Bacillus pumilus (strain SAFR-032) GN=clpP PE=3 SV=1 | 41 | 238 | 4.0E-73 |
| sp|Q6HBD8|CLPP2_BACHK | ATP-dependent Clp protease proteolytic subunit 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=clpP2 PE=3 SV=1 | 41 | 239 | 5.0E-73 |
| sp|Q631K2|CLPP2_BACCZ | ATP-dependent Clp protease proteolytic subunit 2 OS=Bacillus cereus (strain ZK / E33L) GN=clpP2 PE=3 SV=1 | 41 | 239 | 5.0E-73 |
| sp|Q815J6|CLPP2_BACCR | ATP-dependent Clp protease proteolytic subunit 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=clpP2 PE=3 SV=1 | 41 | 239 | 5.0E-73 |
| sp|A6SY74|CLPP_JANMA | ATP-dependent Clp protease proteolytic subunit OS=Janthinobacterium sp. (strain Marseille) GN=clpP PE=3 SV=1 | 42 | 239 | 5.0E-73 |
| sp|Q87E51|CLPP_XYLFT | ATP-dependent Clp protease proteolytic subunit OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=clpP PE=3 SV=1 | 41 | 239 | 5.0E-73 |
| sp|B2I8K3|CLPP_XYLF2 | ATP-dependent Clp protease proteolytic subunit OS=Xylella fastidiosa (strain M23) GN=clpP PE=3 SV=1 | 41 | 239 | 5.0E-73 |
| sp|Q88YH9|CLPP_LACPL | ATP-dependent Clp protease proteolytic subunit OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=clpP PE=3 SV=1 | 43 | 239 | 6.0E-73 |
| sp|Q5WDK0|CLPP2_BACSK | ATP-dependent Clp protease proteolytic subunit 2 OS=Bacillus clausii (strain KSM-K16) GN=clpP2 PE=3 SV=1 | 41 | 237 | 7.0E-73 |
| sp|B0U5N1|CLPP_XYLFM | ATP-dependent Clp protease proteolytic subunit OS=Xylella fastidiosa (strain M12) GN=clpP PE=3 SV=1 | 41 | 239 | 7.0E-73 |
| sp|B4UAX9|CLPP_ANASK | ATP-dependent Clp protease proteolytic subunit OS=Anaeromyxobacter sp. (strain K) GN=clpP PE=3 SV=1 | 43 | 240 | 9.0E-73 |
| sp|Q5QXN8|CLPP_IDILO | ATP-dependent Clp protease proteolytic subunit OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=clpP PE=3 SV=1 | 36 | 239 | 9.0E-73 |
| sp|Q3Z4W6|CLPP_SHISS | ATP-dependent Clp protease proteolytic subunit OS=Shigella sonnei (strain Ss046) GN=clpP PE=3 SV=1 | 26 | 239 | 1.0E-72 |
| sp|P0A6H0|CLPP_SHIFL | ATP-dependent Clp protease proteolytic subunit OS=Shigella flexneri GN=clpP PE=3 SV=1 | 26 | 239 | 1.0E-72 |
| sp|Q0T7E6|CLPP_SHIF8 | ATP-dependent Clp protease proteolytic subunit OS=Shigella flexneri serotype 5b (strain 8401) GN=clpP PE=3 SV=1 | 26 | 239 | 1.0E-72 |
| sp|Q32JJ3|CLPP_SHIDS | ATP-dependent Clp protease proteolytic subunit OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=clpP PE=3 SV=1 | 26 | 239 | 1.0E-72 |
| sp|Q325G4|CLPP_SHIBS | ATP-dependent Clp protease proteolytic subunit OS=Shigella boydii serotype 4 (strain Sb227) GN=clpP PE=3 SV=1 | 26 | 239 | 1.0E-72 |
| sp|Q1RF98|CLPP_ECOUT | ATP-dependent Clp protease proteolytic subunit OS=Escherichia coli (strain UTI89 / UPEC) GN=clpP PE=3 SV=1 | 26 | 239 | 1.0E-72 |
| sp|P0A6G7|CLPP_ECOLI | ATP-dependent Clp protease proteolytic subunit OS=Escherichia coli (strain K12) GN=clpP PE=1 SV=1 | 26 | 239 | 1.0E-72 |
| sp|B1J011|CLPP_ECOLC | ATP-dependent Clp protease proteolytic subunit OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=clpP PE=3 SV=1 | 26 | 239 | 1.0E-72 |
| sp|P0A6G8|CLPP_ECOL6 | ATP-dependent Clp protease proteolytic subunit OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=clpP PE=3 SV=1 | 26 | 239 | 1.0E-72 |
| sp|Q0TKK4|CLPP_ECOL5 | ATP-dependent Clp protease proteolytic subunit OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=clpP PE=3 SV=1 | 26 | 239 | 1.0E-72 |
| sp|A1A8A6|CLPP_ECOK1 | ATP-dependent Clp protease proteolytic subunit OS=Escherichia coli O1:K1 / APEC GN=clpP PE=3 SV=1 | 26 | 239 | 1.0E-72 |
| sp|A7ZX95|CLPP_ECOHS | ATP-dependent Clp protease proteolytic subunit OS=Escherichia coli O9:H4 (strain HS) GN=clpP PE=3 SV=1 | 26 | 239 | 1.0E-72 |
| sp|P0A6G9|CLPP_ECO57 | ATP-dependent Clp protease proteolytic subunit OS=Escherichia coli O157:H7 GN=clpP PE=3 SV=1 | 26 | 239 | 1.0E-72 |
| sp|A7ZIJ5|CLPP_ECO24 | ATP-dependent Clp protease proteolytic subunit OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=clpP PE=3 SV=1 | 26 | 239 | 1.0E-72 |
| sp|Q7N0L3|CLPP_PHOLL | ATP-dependent Clp protease proteolytic subunit OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=clpP PE=3 SV=1 | 26 | 239 | 1.0E-72 |
| sp|A4IYB6|CLPP_FRATW | ATP-dependent Clp protease proteolytic subunit OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=clpP PE=3 SV=1 | 39 | 239 | 1.0E-72 |
| sp|Q5NH47|CLPP_FRATT | ATP-dependent Clp protease proteolytic subunit OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=clpP PE=1 SV=1 | 39 | 239 | 1.0E-72 |
| sp|Q0BM92|CLPP_FRATO | ATP-dependent Clp protease proteolytic subunit OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=clpP PE=3 SV=1 | 39 | 239 | 1.0E-72 |
| sp|A0Q6S9|CLPP_FRATN | ATP-dependent Clp protease proteolytic subunit OS=Francisella tularensis subsp. novicida (strain U112) GN=clpP PE=3 SV=1 | 39 | 239 | 1.0E-72 |
| sp|B2SG18|CLPP_FRATM | ATP-dependent Clp protease proteolytic subunit OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=clpP PE=3 SV=1 | 39 | 239 | 1.0E-72 |
| sp|Q2A3U1|CLPP_FRATH | ATP-dependent Clp protease proteolytic subunit OS=Francisella tularensis subsp. holarctica (strain LVS) GN=clpP PE=3 SV=1 | 39 | 239 | 1.0E-72 |
| sp|A7NBR6|CLPP_FRATF | ATP-dependent Clp protease proteolytic subunit OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=clpP PE=3 SV=1 | 39 | 239 | 1.0E-72 |
| sp|Q14IJ9|CLPP_FRAT1 | ATP-dependent Clp protease proteolytic subunit OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=clpP PE=3 SV=1 | 39 | 239 | 1.0E-72 |
| sp|Q66DT4|CLPP_YERPS | ATP-dependent Clp protease proteolytic subunit OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=clpP PE=3 SV=1 | 26 | 239 | 1.0E-72 |
| sp|A4TPE3|CLPP_YERPP | ATP-dependent Clp protease proteolytic subunit OS=Yersinia pestis (strain Pestoides F) GN=clpP PE=3 SV=1 | 26 | 239 | 1.0E-72 |
| sp|Q1CL65|CLPP_YERPN | ATP-dependent Clp protease proteolytic subunit OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=clpP PE=3 SV=1 | 26 | 239 | 1.0E-72 |
| sp|Q8ZC65|CLPP_YERPE | ATP-dependent Clp protease proteolytic subunit OS=Yersinia pestis GN=clpP PE=3 SV=1 | 26 | 239 | 1.0E-72 |
| sp|Q1C4K8|CLPP_YERPA | ATP-dependent Clp protease proteolytic subunit OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=clpP PE=3 SV=1 | 26 | 239 | 1.0E-72 |
| sp|A7FLC4|CLPP_YERP3 | ATP-dependent Clp protease proteolytic subunit OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=clpP PE=3 SV=1 | 26 | 239 | 1.0E-72 |
| sp|Q2SWQ6|CLPP_BURTA | ATP-dependent Clp protease proteolytic subunit OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=clpP PE=3 SV=1 | 42 | 240 | 1.0E-72 |
| sp|C3LNM6|CLPP_VIBCM | ATP-dependent Clp protease proteolytic subunit OS=Vibrio cholerae serotype O1 (strain M66-2) GN=clpP PE=3 SV=1 | 42 | 239 | 1.0E-72 |
| sp|Q9KQS6|CLPP_VIBCH | ATP-dependent Clp protease proteolytic subunit OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=clpP PE=3 SV=1 | 42 | 239 | 1.0E-72 |
| sp|A5F6X0|CLPP_VIBC3 | ATP-dependent Clp protease proteolytic subunit OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=clpP PE=3 SV=1 | 42 | 239 | 1.0E-72 |
| sp|A8YUD9|CLPP_LACH4 | ATP-dependent Clp protease proteolytic subunit OS=Lactobacillus helveticus (strain DPC 4571) GN=clpP PE=3 SV=1 | 42 | 239 | 1.0E-72 |
| sp|Q5FL55|CLPP_LACAC | ATP-dependent Clp protease proteolytic subunit OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=clpP PE=3 SV=1 | 42 | 242 | 1.0E-72 |
| sp|B9EAG5|CLPP_MACCJ | ATP-dependent Clp protease proteolytic subunit OS=Macrococcus caseolyticus (strain JCSC5402) GN=clpP PE=3 SV=1 | 41 | 236 | 2.0E-72 |
| sp|C4Z1T6|CLPP_EUBE2 | ATP-dependent Clp protease proteolytic subunit OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=clpP PE=3 SV=1 | 41 | 239 | 2.0E-72 |
| sp|Q7MMG7|CLPP_VIBVY | ATP-dependent Clp protease proteolytic subunit OS=Vibrio vulnificus (strain YJ016) GN=clpP PE=3 SV=2 | 42 | 239 | 2.0E-72 |
| sp|Q8DG26|CLPP_VIBVU | ATP-dependent Clp protease proteolytic subunit OS=Vibrio vulnificus (strain CMCP6) GN=clpP PE=3 SV=2 | 42 | 239 | 2.0E-72 |
| sp|P0A1D7|CLPP_SALTY | ATP-dependent Clp protease proteolytic subunit OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=clpP PE=3 SV=1 | 38 | 239 | 2.0E-72 |
| sp|P0A1D8|CLPP_SALTI | ATP-dependent Clp protease proteolytic subunit OS=Salmonella typhi GN=clpP PE=3 SV=1 | 38 | 239 | 2.0E-72 |
| sp|B4TMC6|CLPP_SALSV | ATP-dependent Clp protease proteolytic subunit OS=Salmonella schwarzengrund (strain CVM19633) GN=clpP PE=3 SV=1 | 38 | 239 | 2.0E-72 |
| sp|B4SWU1|CLPP_SALNS | ATP-dependent Clp protease proteolytic subunit OS=Salmonella newport (strain SL254) GN=clpP PE=3 SV=1 | 38 | 239 | 2.0E-72 |
| sp|B4T9E3|CLPP_SALHS | ATP-dependent Clp protease proteolytic subunit OS=Salmonella heidelberg (strain SL476) GN=clpP PE=3 SV=1 | 38 | 239 | 2.0E-72 |
| sp|B5QTJ6|CLPP_SALEP | ATP-dependent Clp protease proteolytic subunit OS=Salmonella enteritidis PT4 (strain P125109) GN=clpP PE=3 SV=1 | 38 | 239 | 2.0E-72 |
| sp|Q57SB5|CLPP_SALCH | ATP-dependent Clp protease proteolytic subunit OS=Salmonella choleraesuis (strain SC-B67) GN=clpP PE=3 SV=2 | 38 | 239 | 2.0E-72 |
| sp|Q98M38|CLPP1_RHILO | ATP-dependent Clp protease proteolytic subunit 1 OS=Rhizobium loti (strain MAFF303099) GN=clpP1 PE=3 SV=1 | 40 | 239 | 2.0E-72 |
| sp|B1HVR0|CLPP_LYSSC | ATP-dependent Clp protease proteolytic subunit OS=Lysinibacillus sphaericus (strain C3-41) GN=clpP PE=3 SV=1 | 41 | 238 | 2.0E-72 |
| sp|Q7VP78|CLPP_HAEDU | ATP-dependent Clp protease proteolytic subunit OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=clpP PE=3 SV=1 | 42 | 239 | 2.0E-72 |
| sp|Q3M726|CLPP3_ANAVT | ATP-dependent Clp protease proteolytic subunit 3 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=clpP3 PE=3 SV=2 | 40 | 242 | 2.0E-72 |
| sp|A4ISQ2|CLPP_GEOTN | ATP-dependent Clp protease proteolytic subunit OS=Geobacillus thermodenitrificans (strain NG80-2) GN=clpP PE=3 SV=1 | 42 | 238 | 2.0E-72 |
| sp|A7Z939|CLPP_BACMF | ATP-dependent Clp protease proteolytic subunit OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=clpP PE=3 SV=1 | 41 | 238 | 2.0E-72 |
| sp|Q81X63|CLPP2_BACAN | ATP-dependent Clp protease proteolytic subunit 2 OS=Bacillus anthracis GN=clpP2 PE=3 SV=1 | 41 | 239 | 2.0E-72 |
| sp|B5BD83|CLPP_SALPK | ATP-dependent Clp protease proteolytic subunit OS=Salmonella paratyphi A (strain AKU_12601) GN=clpP PE=3 SV=1 | 38 | 239 | 2.0E-72 |
| sp|Q5PFN4|CLPP_SALPA | ATP-dependent Clp protease proteolytic subunit OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=clpP PE=3 SV=1 | 38 | 239 | 2.0E-72 |
| sp|A8F754|CLPP_PSELT | ATP-dependent Clp protease proteolytic subunit OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=clpP PE=3 SV=1 | 42 | 239 | 3.0E-72 |
| sp|Q8YQX8|CLPP2_NOSS1 | ATP-dependent Clp protease proteolytic subunit 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=clpP2 PE=3 SV=1 | 40 | 242 | 3.0E-72 |
| sp|Q74K84|CLPP_LACJO | ATP-dependent Clp protease proteolytic subunit OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=clpP PE=3 SV=1 | 42 | 236 | 3.0E-72 |
| sp|Q042E8|CLPP_LACGA | ATP-dependent Clp protease proteolytic subunit OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=clpP PE=3 SV=1 | 42 | 236 | 3.0E-72 |
| sp|Q5KVD9|CLPP_GEOKA | ATP-dependent Clp protease proteolytic subunit OS=Geobacillus kaustophilus (strain HTA426) GN=clpP PE=3 SV=1 | 42 | 238 | 3.0E-72 |
| sp|Q7NUY9|CLPP_CHRVO | ATP-dependent Clp protease proteolytic subunit OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=clpP PE=3 SV=1 | 36 | 239 | 3.0E-72 |
| sp|B7GL34|CLPP_ANOFW | ATP-dependent Clp protease proteolytic subunit OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=clpP PE=3 SV=1 | 41 | 238 | 4.0E-72 |
| sp|B0BQL3|CLPP_ACTPJ | ATP-dependent Clp protease proteolytic subunit OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=clpP PE=3 SV=1 | 42 | 239 | 4.0E-72 |
| sp|A3N1T0|CLPP_ACTP2 | ATP-dependent Clp protease proteolytic subunit OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=clpP PE=3 SV=1 | 42 | 239 | 4.0E-72 |
| sp|A6VME1|CLPP_ACTSZ | ATP-dependent Clp protease proteolytic subunit OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=clpP PE=3 SV=1 | 42 | 239 | 4.0E-72 |
| sp|B3H252|CLPP_ACTP7 | ATP-dependent Clp protease proteolytic subunit OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=clpP PE=3 SV=1 | 42 | 239 | 4.0E-72 |
| sp|Q1WTA8|CLPP_LACS1 | ATP-dependent Clp protease proteolytic subunit OS=Lactobacillus salivarius (strain UCC118) GN=clpP PE=3 SV=1 | 41 | 239 | 5.0E-72 |
| sp|A4SM42|CLPP_AERS4 | ATP-dependent Clp protease proteolytic subunit OS=Aeromonas salmonicida (strain A449) GN=clpP PE=3 SV=1 | 36 | 239 | 5.0E-72 |
| sp|B8FA62|CLPP_DESAA | ATP-dependent Clp protease proteolytic subunit OS=Desulfatibacillum alkenivorans (strain AK-01) GN=clpP PE=3 SV=1 | 43 | 244 | 7.0E-72 |
| sp|A1SUW7|CLPP_PSYIN | ATP-dependent Clp protease proteolytic subunit OS=Psychromonas ingrahamii (strain 37) GN=clpP PE=3 SV=1 | 37 | 239 | 7.0E-72 |
| sp|Q2S2L8|CLPP1_SALRD | ATP-dependent Clp protease proteolytic subunit 1 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=clpP1 PE=3 SV=2 | 38 | 236 | 1.0E-71 |
| sp|Q4L4J5|CLPP_STAHJ | ATP-dependent Clp protease proteolytic subunit OS=Staphylococcus haemolyticus (strain JCSC1435) GN=clpP PE=3 SV=1 | 41 | 237 | 1.0E-71 |
| sp|Q1QVW1|CLPP_CHRSD | ATP-dependent Clp protease proteolytic subunit OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=clpP PE=3 SV=1 | 39 | 242 | 1.0E-71 |
| sp|P54416|CLPP1_SYNY3 | ATP-dependent Clp protease proteolytic subunit 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=clpP1 PE=3 SV=1 | 42 | 242 | 2.0E-71 |
| sp|P80244|CLPP_BACSU | ATP-dependent Clp protease proteolytic subunit OS=Bacillus subtilis (strain 168) GN=clpP PE=1 SV=3 | 41 | 236 | 2.0E-71 |
| sp|Q0A6A7|CLPP_ALKEH | ATP-dependent Clp protease proteolytic subunit OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=clpP PE=3 SV=1 | 39 | 243 | 2.0E-71 |
| sp|C4XH03|CLPP_DESMR | ATP-dependent Clp protease proteolytic subunit OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=clpP PE=3 SV=1 | 43 | 239 | 3.0E-71 |
| sp|A1BI15|CLPP_CHLPD | ATP-dependent Clp protease proteolytic subunit OS=Chlorobium phaeobacteroides (strain DSM 266) GN=clpP PE=3 SV=1 | 39 | 243 | 3.0E-71 |
| sp|P63786|CLPP_STAAW | ATP-dependent Clp protease proteolytic subunit OS=Staphylococcus aureus (strain MW2) GN=clpP PE=1 SV=1 | 41 | 236 | 4.0E-71 |
| sp|A8Z045|CLPP_STAAT | ATP-dependent Clp protease proteolytic subunit OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=clpP PE=3 SV=1 | 41 | 236 | 4.0E-71 |
| sp|Q6GB62|CLPP_STAAS | ATP-dependent Clp protease proteolytic subunit OS=Staphylococcus aureus (strain MSSA476) GN=clpP PE=3 SV=1 | 41 | 236 | 4.0E-71 |
| sp|Q6GIM3|CLPP_STAAR | ATP-dependent Clp protease proteolytic subunit OS=Staphylococcus aureus (strain MRSA252) GN=clpP PE=3 SV=1 | 41 | 236 | 4.0E-71 |
| sp|P99089|CLPP_STAAN | ATP-dependent Clp protease proteolytic subunit OS=Staphylococcus aureus (strain N315) GN=clpP PE=1 SV=1 | 41 | 236 | 4.0E-71 |
| sp|P63785|CLPP_STAAM | ATP-dependent Clp protease proteolytic subunit OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=clpP PE=3 SV=1 | 41 | 236 | 4.0E-71 |
| sp|A6QF76|CLPP_STAAE | ATP-dependent Clp protease proteolytic subunit OS=Staphylococcus aureus (strain Newman) GN=clpP PE=3 SV=1 | 41 | 236 | 4.0E-71 |
| sp|Q5HHQ0|CLPP_STAAC | ATP-dependent Clp protease proteolytic subunit OS=Staphylococcus aureus (strain COL) GN=clpP PE=3 SV=1 | 41 | 236 | 4.0E-71 |
| sp|Q2YSF8|CLPP_STAAB | ATP-dependent Clp protease proteolytic subunit OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=clpP PE=3 SV=1 | 41 | 236 | 4.0E-71 |
| sp|A5IQX2|CLPP_STAA9 | ATP-dependent Clp protease proteolytic subunit OS=Staphylococcus aureus (strain JH9) GN=clpP PE=3 SV=1 | 41 | 236 | 4.0E-71 |
| sp|Q2G036|CLPP_STAA8 | ATP-dependent Clp protease proteolytic subunit OS=Staphylococcus aureus (strain NCTC 8325) GN=clpP PE=1 SV=1 | 41 | 236 | 4.0E-71 |
| sp|Q2FIM5|CLPP_STAA3 | ATP-dependent Clp protease proteolytic subunit OS=Staphylococcus aureus (strain USA300) GN=clpP PE=3 SV=1 | 41 | 236 | 4.0E-71 |
| sp|A6TZP7|CLPP_STAA2 | ATP-dependent Clp protease proteolytic subunit OS=Staphylococcus aureus (strain JH1) GN=clpP PE=3 SV=1 | 41 | 236 | 4.0E-71 |
| sp|A7WZR9|CLPP_STAA1 | ATP-dependent Clp protease proteolytic subunit OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=clpP PE=3 SV=1 | 41 | 236 | 4.0E-71 |
| sp|A6Q675|CLPP_SULNB | ATP-dependent Clp protease proteolytic subunit OS=Sulfurovum sp. (strain NBC37-1) GN=clpP PE=3 SV=1 | 43 | 241 | 4.0E-71 |
| sp|Q2JV68|CLPP2_SYNJA | ATP-dependent Clp protease proteolytic subunit 2 OS=Synechococcus sp. (strain JA-3-3Ab) GN=clpP2 PE=3 SV=1 | 42 | 240 | 4.0E-71 |
| sp|Q27539|CLPP1_CAEEL | ATP-dependent Clp protease proteolytic subunit 1, mitochondrial OS=Caenorhabditis elegans GN=clpp-1 PE=1 SV=2 | 43 | 235 | 5.0E-71 |
| sp|Q8DLI2|CLPP1_THEEB | ATP-dependent Clp protease proteolytic subunit 1 OS=Thermosynechococcus elongatus (strain BP-1) GN=clpP1 PE=3 SV=1 | 37 | 239 | 6.0E-71 |
| sp|Q6MH11|CLPP_BDEBA | ATP-dependent Clp protease proteolytic subunit OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=clpP PE=3 SV=1 | 42 | 239 | 6.0E-71 |
| sp|Q8CTE0|CLPP_STAES | ATP-dependent Clp protease proteolytic subunit OS=Staphylococcus epidermidis (strain ATCC 12228) GN=clpP PE=3 SV=1 | 41 | 237 | 8.0E-71 |
| sp|Q5HQW0|CLPP_STAEQ | ATP-dependent Clp protease proteolytic subunit OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=clpP PE=3 SV=1 | 41 | 237 | 8.0E-71 |
| sp|Q2JIP1|CLPP2_SYNJB | ATP-dependent Clp protease proteolytic subunit 2 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=clpP2 PE=3 SV=1 | 42 | 240 | 9.0E-71 |
| sp|Q49VZ2|CLPP_STAS1 | ATP-dependent Clp protease proteolytic subunit OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=clpP PE=3 SV=1 | 41 | 236 | 1.0E-70 |
| sp|Q89AA1|CLPP_BUCBP | ATP-dependent Clp protease proteolytic subunit OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=clpP PE=3 SV=1 | 42 | 239 | 1.0E-70 |
| sp|Q0SMP6|CLPP_BORAP | ATP-dependent Clp protease proteolytic subunit OS=Borrelia afzelii (strain PKo) GN=clpP PE=3 SV=1 | 41 | 238 | 2.0E-70 |
| sp|B9DJL4|CLPP_STACT | ATP-dependent Clp protease proteolytic subunit OS=Staphylococcus carnosus (strain TM300) GN=clpP PE=3 SV=1 | 41 | 237 | 2.0E-70 |
| sp|Q8D346|CLPP_WIGBR | ATP-dependent Clp protease proteolytic subunit OS=Wigglesworthia glossinidia brevipalpis GN=clpP PE=3 SV=1 | 41 | 239 | 2.0E-70 |
| sp|A0LEF1|CLPP_SYNFM | ATP-dependent Clp protease proteolytic subunit OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=clpP PE=3 SV=1 | 41 | 239 | 2.0E-70 |
| sp|O51556|CLPP1_BORBU | ATP-dependent Clp protease proteolytic subunit 1 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=clpP1 PE=3 SV=2 | 41 | 238 | 2.0E-70 |
| sp|Q73M38|CLPP1_TREDE | ATP-dependent Clp protease proteolytic subunit 1 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=clpP1 PE=3 SV=1 | 40 | 239 | 2.0E-70 |
| sp|Q5N1P6|CLPP3_SYNP6 | ATP-dependent Clp protease proteolytic subunit 3 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=clpP3 PE=3 SV=1 | 33 | 241 | 2.0E-70 |
| sp|O34125|CLPP2_SYNE7 | ATP-dependent Clp protease proteolytic subunit 2 OS=Synechococcus elongatus (strain PCC 7942) GN=clpP2 PE=3 SV=1 | 33 | 241 | 2.0E-70 |
| sp|Q2GD19|CLPP_NEOSM | ATP-dependent Clp protease proteolytic subunit OS=Neorickettsia sennetsu (strain Miyayama) GN=clpP PE=3 SV=2 | 41 | 239 | 2.0E-70 |
| sp|A8EVH5|CLPP_ARCB4 | ATP-dependent Clp protease proteolytic subunit OS=Arcobacter butzleri (strain RM4018) GN=clpP PE=3 SV=1 | 43 | 238 | 3.0E-70 |
| sp|Q7VRH1|CLPP_BLOFL | ATP-dependent Clp protease proteolytic subunit OS=Blochmannia floridanus GN=clpP PE=3 SV=1 | 39 | 239 | 3.0E-70 |
| sp|Q660R2|CLPP_BORBP | ATP-dependent Clp protease proteolytic subunit OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=clpP PE=3 SV=1 | 41 | 238 | 4.0E-70 |
| sp|Q7VIN7|CLPP_HELHP | ATP-dependent Clp protease proteolytic subunit OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=clpP PE=3 SV=1 | 40 | 238 | 5.0E-70 |
| sp|Q13UT1|CLPP1_BURXL | ATP-dependent Clp protease proteolytic subunit 1 OS=Burkholderia xenovorans (strain LB400) GN=clpP1 PE=3 SV=1 | 42 | 239 | 6.0E-70 |
| sp|Q59993|CLPP2_SYNY3 | ATP-dependent Clp protease proteolytic subunit 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=clpP2 PE=3 SV=1 | 41 | 247 | 7.0E-70 |
| sp|B2UT37|CLPP_HELPS | ATP-dependent Clp protease proteolytic subunit OS=Helicobacter pylori (strain Shi470) GN=clpP PE=3 SV=1 | 43 | 239 | 8.0E-70 |
| sp|Q493F8|CLPP_BLOPB | ATP-dependent Clp protease proteolytic subunit OS=Blochmannia pennsylvanicus (strain BPEN) GN=clpP PE=3 SV=1 | 42 | 239 | 9.0E-70 |
| sp|Q9K888|CLPP2_BACHD | ATP-dependent Clp protease proteolytic subunit 2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=clpP2 PE=3 SV=1 | 43 | 236 | 1.0E-69 |
| sp|Q65RF6|CLPP_MANSM | ATP-dependent Clp protease proteolytic subunit OS=Mannheimia succiniciproducens (strain MBEL55E) GN=clpP PE=3 SV=1 | 42 | 239 | 1.0E-69 |
| sp|Q317Y6|CLPP4_PROM9 | ATP-dependent Clp protease proteolytic subunit 4 OS=Prochlorococcus marinus (strain MIT 9312) GN=clpP4 PE=3 SV=1 | 43 | 238 | 2.0E-69 |
| sp|Q3B5V8|CLPP_CHLL7 | ATP-dependent Clp protease proteolytic subunit OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=clpP PE=3 SV=1 | 41 | 241 | 2.0E-69 |
| sp|Q17XD3|CLPP_HELAH | ATP-dependent Clp protease proteolytic subunit OS=Helicobacter acinonychis (strain Sheeba) GN=clpP PE=3 SV=1 | 43 | 238 | 2.0E-69 |
| sp|Q1CT76|CLPP_HELPH | ATP-dependent Clp protease proteolytic subunit OS=Helicobacter pylori (strain HPAG1) GN=clpP PE=3 SV=2 | 43 | 238 | 3.0E-69 |
| sp|B5Z7F6|CLPP_HELPG | ATP-dependent Clp protease proteolytic subunit OS=Helicobacter pylori (strain G27) GN=clpP PE=3 SV=1 | 43 | 238 | 3.0E-69 |
| sp|A4SDA4|CLPP_CHLPM | ATP-dependent Clp protease proteolytic subunit OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=clpP PE=3 SV=1 | 41 | 241 | 3.0E-69 |
| sp|P56156|CLPP_HELPY | ATP-dependent Clp protease proteolytic subunit OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=clpP PE=1 SV=1 | 43 | 238 | 3.0E-69 |
| sp|Q8F352|CLPP_LEPIN | ATP-dependent Clp protease proteolytic subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=clpP PE=3 SV=1 | 42 | 237 | 3.0E-69 |
| sp|Q72SG6|CLPP1_LEPIC | ATP-dependent Clp protease proteolytic subunit 1 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=clpP1 PE=3 SV=1 | 42 | 237 | 3.0E-69 |
| sp|Q1ICA8|CLPP_PSEE4 | ATP-dependent Clp protease proteolytic subunit OS=Pseudomonas entomophila (strain L48) GN=clpP PE=3 SV=1 | 39 | 239 | 3.0E-69 |
| sp|O83520|CLPP1_TREPA | ATP-dependent Clp protease proteolytic subunit 1 OS=Treponema pallidum (strain Nichols) GN=clpP1 PE=3 SV=1 | 41 | 239 | 4.0E-69 |
| sp|Q9ZL50|CLPP_HELPJ | ATP-dependent Clp protease proteolytic subunit OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=clpP PE=3 SV=1 | 43 | 238 | 5.0E-69 |
| sp|Q6MBE9|CLPP2_PARUW | ATP-dependent Clp protease proteolytic subunit 2 OS=Protochlamydia amoebophila (strain UWE25) GN=clpP2 PE=3 SV=1 | 38 | 236 | 6.0E-69 |
| sp|Q5N665|CLPP1_SYNP6 | ATP-dependent Clp protease proteolytic subunit 1 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=clpP1 PE=3 SV=1 | 42 | 239 | 9.0E-69 |
| sp|P54415|CLPP1_SYNE7 | ATP-dependent Clp protease proteolytic subunit 1 OS=Synechococcus elongatus (strain PCC 7942) GN=clpP1 PE=3 SV=1 | 42 | 239 | 9.0E-69 |
| sp|Q7UZK7|CLPP3_PROMP | ATP-dependent Clp protease proteolytic subunit 3 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=clpP3 PE=3 SV=1 | 39 | 237 | 2.0E-68 |
| sp|A5EWF5|CLPP_DICNV | ATP-dependent Clp protease proteolytic subunit OS=Dichelobacter nodosus (strain VCS1703A) GN=clpP PE=3 SV=1 | 43 | 241 | 2.0E-68 |
| sp|Q8YXH5|CLPP1_NOSS1 | ATP-dependent Clp protease proteolytic subunit 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=clpP1 PE=3 SV=1 | 43 | 238 | 3.0E-68 |
| sp|P57547|CLPP_BUCAI | ATP-dependent Clp protease proteolytic subunit OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=clpP PE=3 SV=1 | 40 | 239 | 3.0E-68 |
| sp|Q736T1|CLPP1_BACC1 | ATP-dependent Clp protease proteolytic subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=clpP1 PE=3 SV=1 | 41 | 239 | 3.0E-68 |
| sp|Q46L44|CLPP1_PROMT | ATP-dependent Clp protease proteolytic subunit 1 OS=Prochlorococcus marinus (strain NATL2A) GN=clpP1 PE=3 SV=1 | 42 | 242 | 3.0E-68 |
| sp|Q7UA36|CLPP1_SYNPX | ATP-dependent Clp protease proteolytic subunit 1 OS=Synechococcus sp. (strain WH8102) GN=clpP1 PE=3 SV=1 | 16 | 237 | 5.0E-68 |
| sp|Q3MFR5|CLPP1_ANAVT | ATP-dependent Clp protease proteolytic subunit 1 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=clpP1 PE=3 SV=1 | 43 | 238 | 6.0E-68 |
| sp|Q81CH1|CLPP1_BACCR | ATP-dependent Clp protease proteolytic subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=clpP1 PE=3 SV=1 | 41 | 239 | 6.0E-68 |
| sp|A3CPK8|CLPP_STRSV | ATP-dependent Clp protease proteolytic subunit OS=Streptococcus sanguinis (strain SK36) GN=clpP PE=3 SV=1 | 42 | 242 | 7.0E-68 |
| sp|Q7V9L6|CLPP3_PROMA | ATP-dependent Clp protease proteolytic subunit 3 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=clpP3 PE=3 SV=1 | 15 | 236 | 9.0E-68 |
| sp|Q63AG0|CLPP1_BACCZ | ATP-dependent Clp protease proteolytic subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=clpP1 PE=3 SV=1 | 41 | 239 | 1.0E-67 |
| sp|Q28NI7|CLPP_JANSC | ATP-dependent Clp protease proteolytic subunit OS=Jannaschia sp. (strain CCS1) GN=clpP PE=3 SV=1 | 41 | 244 | 2.0E-67 |
| sp|Q6HHU9|CLPP1_BACHK | ATP-dependent Clp protease proteolytic subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=clpP1 PE=3 SV=1 | 41 | 239 | 3.0E-67 |
| sp|Q81PL4|CLPP1_BACAN | ATP-dependent Clp protease proteolytic subunit 1 OS=Bacillus anthracis GN=clpP1 PE=3 SV=1 | 41 | 239 | 3.0E-67 |
| sp|Q7V7R2|CLPP3_PROMM | ATP-dependent Clp protease proteolytic subunit 3 OS=Prochlorococcus marinus (strain MIT 9313) GN=clpP3 PE=3 SV=1 | 42 | 241 | 4.0E-67 |
| sp|B8CY74|CLPP_HALOH | ATP-dependent Clp protease proteolytic subunit OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=clpP PE=3 SV=1 | 41 | 244 | 5.0E-67 |
| sp|Q7VC22|CLPP1_PROMA | ATP-dependent Clp protease proteolytic subunit 1 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=clpP1 PE=3 SV=1 | 42 | 242 | 6.0E-67 |
| sp|Q3ANI8|CLPP1_SYNSC | ATP-dependent Clp protease proteolytic subunit 1 OS=Synechococcus sp. (strain CC9605) GN=clpP1 PE=3 SV=2 | 43 | 237 | 7.0E-67 |
| sp|Q65E10|CLPP2_BACLD | ATP-dependent Clp protease proteolytic subunit 2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=clpP2 PE=3 SV=1 | 41 | 236 | 8.0E-67 |
| sp|Q3B0U1|CLPP2_SYNS9 | ATP-dependent Clp protease proteolytic subunit 2 OS=Synechococcus sp. (strain CC9902) GN=clpP2 PE=3 SV=1 | 43 | 237 | 1.0E-66 |
| sp|Q7U6N7|CLPP2_SYNPX | ATP-dependent Clp protease proteolytic subunit 2 OS=Synechococcus sp. (strain WH8102) GN=clpP2 PE=3 SV=1 | 42 | 240 | 1.0E-66 |
| sp|Q7V992|CLPP1_PROMM | ATP-dependent Clp protease proteolytic subunit 1 OS=Prochlorococcus marinus (strain MIT 9313) GN=clpP1 PE=3 SV=1 | 18 | 237 | 1.0E-66 |
| sp|Q60C68|CLPP1_METCA | ATP-dependent Clp protease proteolytic subunit 1 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=clpP1 PE=3 SV=1 | 34 | 241 | 3.0E-66 |
| sp|Q3AJN8|CLPP2_SYNSC | ATP-dependent Clp protease proteolytic subunit 2 OS=Synechococcus sp. (strain CC9605) GN=clpP2 PE=3 SV=2 | 42 | 241 | 4.0E-66 |
| sp|Q3AY04|CLPP1_SYNS9 | ATP-dependent Clp protease proteolytic subunit 1 OS=Synechococcus sp. (strain CC9902) GN=clpP1 PE=3 SV=1 | 42 | 241 | 4.0E-66 |
| sp|Q1IWD9|CLPP_DEIGD | ATP-dependent Clp protease proteolytic subunit OS=Deinococcus geothermalis (strain DSM 11300) GN=clpP PE=3 SV=1 | 41 | 242 | 6.0E-66 |
| sp|Q3Z8J8|CLPP_DEHM1 | ATP-dependent Clp protease proteolytic subunit OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=clpP PE=3 SV=1 | 41 | 238 | 7.0E-66 |
| sp|Q9I2U1|CLPP1_PSEAE | ATP-dependent Clp protease proteolytic subunit 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=clpP1 PE=3 SV=1 | 39 | 239 | 8.0E-66 |
| sp|Q9RSZ7|CLPP_DEIRA | ATP-dependent Clp protease proteolytic subunit OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=clpP PE=3 SV=1 | 41 | 238 | 1.0E-65 |
| sp|Q46ID4|CLPP3_PROMT | ATP-dependent Clp protease proteolytic subunit 3 OS=Prochlorococcus marinus (strain NATL2A) GN=clpP3 PE=3 SV=1 | 42 | 236 | 2.0E-65 |
| sp|B9DTU8|CLPP_STRU0 | ATP-dependent Clp protease proteolytic subunit OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=clpP PE=3 SV=1 | 42 | 239 | 3.0E-65 |
| sp|Q3ZX82|CLPP_DEHMC | ATP-dependent Clp protease proteolytic subunit OS=Dehalococcoides mccartyi (strain CBDB1) GN=clpP PE=3 SV=1 | 41 | 238 | 6.0E-65 |
| sp|A5FRE5|CLPP_DEHMB | ATP-dependent Clp protease proteolytic subunit OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=clpP PE=3 SV=1 | 41 | 238 | 6.0E-65 |
| sp|Q9L4P3|CLPP3_SYNE7 | ATP-dependent Clp protease proteolytic subunit 3 OS=Synechococcus elongatus (strain PCC 7942) GN=clpP3 PE=3 SV=1 | 54 | 241 | 6.0E-65 |
| sp|Q5N1Q7|CLPP2_SYNP6 | ATP-dependent Clp protease proteolytic subunit 2 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=clpP2 PE=3 SV=1 | 54 | 241 | 6.0E-65 |
| sp|Q1AVS9|CLPP_RUBXD | ATP-dependent Clp protease proteolytic subunit OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=clpP PE=3 SV=1 | 42 | 236 | 6.0E-65 |
| sp|Q60BE8|CLPP2_METCA | ATP-dependent Clp protease proteolytic subunit 2 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=clpP2 PE=3 SV=2 | 43 | 242 | 1.0E-64 |
| sp|Q67QZ4|CLPP2_SYMTH | ATP-dependent Clp protease proteolytic subunit 2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=clpP2 PE=3 SV=1 | 40 | 239 | 1.0E-64 |
| sp|Q8K990|CLPP_BUCAP | ATP-dependent Clp protease proteolytic subunit OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=clpP PE=3 SV=1 | 42 | 239 | 5.0E-64 |
| sp|Q5WVJ0|CLPP_LEGPL | ATP-dependent Clp protease proteolytic subunit OS=Legionella pneumophila (strain Lens) GN=clpP PE=3 SV=1 | 39 | 247 | 7.0E-64 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 54 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Agabi119p4|011820 MLRSFRPLRSALKNTARSFHPLANQSLTEHQDRWAKPPSANLVPIVIEQTGRGERSYDIFSRLLRERVIMLHGPI RDTDATLVVAQLLFLEAEDSSKPIHLYINSPGGSVTAGLAIYDTMQYVSSPIHTYSIGIAASMGSLLLAAGENGK RHCLPNASIMIHQPSGGASGQASDIAIHAKEILRIRQVLTSIYQKHCAQPAESEAEGLARFEKALERDYYMTAQE AKDFGIVDGILERRPTSDSTSL* |
| Coding | >Agabi119p4|011820 ATGTTGCGCTCTTTCCGTCCTCTGAGATCTGCTCTGAAAAACACTGCTCGATCATTTCACCCACTGGCAAACCAG TCACTTACAGAACACCAAGACAGATGGGCCAAACCACCCTCAGCGAACCTTGTTCCCATAGTTATTGAGCAAACG GGGAGAGGAGAGCGTTCATATGACATTTTCTCCCGCCTCTTACGAGAAAGAGTCATAATGCTACACGGTCCGATA AGAGACACGGACGCGACGCTTGTCGTTGCGCAACTCCTCTTTTTGGAAGCAGAGGACTCATCAAAACCTATACAT CTATATATCAATTCCCCGGGCGGGAGTGTAACCGCCGGTCTTGCGATCTACGATACTATGCAGTATGTTTCCTCT CCGATTCACACATATAGCATCGGCATTGCAGCATCCATGGGATCTCTCCTTCTGGCAGCAGGTGAAAATGGCAAA CGTCACTGCCTCCCGAACGCGAGCATCATGATCCATCAACCCTCGGGTGGTGCCTCAGGACAGGCTTCTGATATT GCTATTCACGCCAAGGAGATCCTCCGTATCCGACAGGTGCTGACCAGCATCTATCAAAAGCATTGCGCCCAACCG GCTGAAAGTGAAGCCGAGGGGTTAGCGCGTTTTGAGAAAGCATTGGAAAGGGACTACTATATGACAGCTCAGGAA GCGAAAGATTTTGGCATCGTTGATGGTATTCTTGAGCGAAGACCTACTTCTGATAGTACTTCTCTGTGA |
| Transcript | >Agabi119p4|011820 ATGTTGCGCTCTTTCCGTCCTCTGAGATCTGCTCTGAAAAACACTGCTCGATCATTTCACCCACTGGCAAACCAG TCACTTACAGAACACCAAGACAGATGGGCCAAACCACCCTCAGCGAACCTTGTTCCCATAGTTATTGAGCAAACG GGGAGAGGAGAGCGTTCATATGACATTTTCTCCCGCCTCTTACGAGAAAGAGTCATAATGCTACACGGTCCGATA AGAGACACGGACGCGACGCTTGTCGTTGCGCAACTCCTCTTTTTGGAAGCAGAGGACTCATCAAAACCTATACAT CTATATATCAATTCCCCGGGCGGGAGTGTAACCGCCGGTCTTGCGATCTACGATACTATGCAGTATGTTTCCTCT CCGATTCACACATATAGCATCGGCATTGCAGCATCCATGGGATCTCTCCTTCTGGCAGCAGGTGAAAATGGCAAA CGTCACTGCCTCCCGAACGCGAGCATCATGATCCATCAACCCTCGGGTGGTGCCTCAGGACAGGCTTCTGATATT GCTATTCACGCCAAGGAGATCCTCCGTATCCGACAGGTGCTGACCAGCATCTATCAAAAGCATTGCGCCCAACCG GCTGAAAGTGAAGCCGAGGGGTTAGCGCGTTTTGAGAAAGCATTGGAAAGGGACTACTATATGACAGCTCAGGAA GCGAAAGATTTTGGCATCGTTGATGGTATTCTTGAGCGAAGACCTACTTCTGATAGTACTTCTCTGTGA |
| Gene | >Agabi119p4|011820 ATGTTGCGCTCTTTCCGTCCTCTGAGATCTGCTCTGAAAAACACTGCTCGATCATTTCACCCACTGGCAAACCAG TCACTTACAGAACACCAAGACAGATGGGCCAAACCACCCTCAGCGAACCTTGTTCCCATAGTTATTGAGCAAACG GTATTCAGTCATAGTTCGCATACCGCTGGTGCTCATACTTTTACTAGGGGAGAGGAGAGCGTTCATATGACATTT TCTCCCGCCTCTTACGAGAAAGAGTCATAATGCTACACGGTCCGGTAACTTGTCCGCTCGTATTCAACCCGTTGA GCTGCGTAGCTCAACAATTCAGATAAGAGACACGGACGCGACGCTTGTCGTTGCGCAACTCCTCTTTTTGGAAGC AGAGGACTCATCAAAACCTATACATCTATATATCAATTCCCCGGGCGGGAGTGTAACCGCCGGTCTTGCGATCTA CGATACTGTGAGCTTGCACCGGTCACCTGAACCAGTCAGTATGTTTGGCTCACAAATTCCATTCAGATGCAGGTA TATATTATTTCCGTTTGTCATATTCTTCGAATTGGATATTAACACCGGTGGAATCGCCAGTATGTTTCCTCTCCG ATTCACACATATAGCATCGGCATTGCAGCATCCATGGGATCTCTCCTTCTGGCAGCAGGTGAAAATGGCAAACGT CACTGCCTCCCGAACGCGAGCATCATGATCCATCGTCCGTCCCCCTTTTCTTTTCTTAGGTGCTGACTTAGTCAA ACACGCACTATGTAGAACCCTCGGGTGGTGCCTCAGGACAGGCTTCTGATATTGCTATTCACGCCAAGGAGATCC TCCGTATCCGACAGGTGCTGACCAGCATCTATCAAAAGCATTGCGCCCAACCGGCTGAAAGTGAAGCCGAGGGGT TAGCGCGTTTTGGTCAGTGCCCAGCTTATCGCCGATCCTTATCGTTCTCACATGCTGATTTGGTACTGTGTTAGA GAAAGCATTGGAAAGGGACTACTATATGACAGGTATTTTTTTACCACAGTTTCCCATGGGCACCTCTAATTCAGG AAACAGCTCAGGAAGCGAAAGATTTTGGCATCGTTGATGGTATTCTTGAGCGAAGACCTACTTCTGATAGTACTT CTCTGTGA |