Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|010510
Gene name
Locationscaffold_01a:2467731..2468678
Strand+
Gene length (bp)947
Transcript length (bp)720
Coding sequence length (bp)720
Protein length (aa) 240

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00887 ACBP Acyl CoA binding protein 1.7E-18 5 82
PF12796 Ank_2 Ankyrin repeats (3 copies) 6.8E-08 151 215
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.2E-09 165 237
PF13857 Ank_5 Ankyrin repeats (many copies) 2.0E-09 169 225
PF00023 Ank Ankyrin repeat 2.8E-06 184 215
PF13606 Ank_3 Ankyrin repeat 1.2E-05 184 210
PF13637 Ank_4 Ankyrin repeats (many copies) 5.6E-05 161 205

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9STP8|ACBP2_ARATH Acyl-CoA-binding domain-containing protein 2 OS=Arabidopsis thaliana GN=ACBP2 PE=1 SV=1 6 237 1.0E-22
sp|Q9SM23|ACBP1_ARATH Acyl-CoA-binding domain-containing protein 1 OS=Arabidopsis thaliana GN=ACBP1 PE=1 SV=2 21 237 7.0E-20
sp|A2VDR2|ACBD6_BOVIN Acyl-CoA-binding domain-containing protein 6 OS=Bos taurus GN=ACBD6 PE=2 SV=1 6 237 2.0E-16
sp|Q9BR61|ACBD6_HUMAN Acyl-CoA-binding domain-containing protein 6 OS=Homo sapiens GN=ACBD6 PE=1 SV=1 6 237 2.0E-15
sp|Q4V869|ACBD6_XENLA Acyl-CoA-binding domain-containing protein 6 OS=Xenopus laevis GN=acbd6 PE=2 SV=1 5 224 1.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9STP8|ACBP2_ARATH Acyl-CoA-binding domain-containing protein 2 OS=Arabidopsis thaliana GN=ACBP2 PE=1 SV=1 6 237 1.0E-22
sp|Q9SM23|ACBP1_ARATH Acyl-CoA-binding domain-containing protein 1 OS=Arabidopsis thaliana GN=ACBP1 PE=1 SV=2 21 237 7.0E-20
sp|A2VDR2|ACBD6_BOVIN Acyl-CoA-binding domain-containing protein 6 OS=Bos taurus GN=ACBD6 PE=2 SV=1 6 237 2.0E-16
sp|Q9BR61|ACBD6_HUMAN Acyl-CoA-binding domain-containing protein 6 OS=Homo sapiens GN=ACBD6 PE=1 SV=1 6 237 2.0E-15
sp|Q4V869|ACBD6_XENLA Acyl-CoA-binding domain-containing protein 6 OS=Xenopus laevis GN=acbd6 PE=2 SV=1 5 224 1.0E-13
sp|Q9D061|ACBD6_MOUSE Acyl-CoA-binding domain-containing protein 6 OS=Mus musculus GN=Acbd6 PE=1 SV=2 6 227 4.0E-13
sp|Q66JD7|ACBD6_XENTR Acyl-CoA-binding domain-containing protein 6 OS=Xenopus tropicalis GN=acbd6 PE=2 SV=1 5 224 6.0E-13
sp|Q5RJK8|ACBD6_RAT Acyl-CoA-binding domain-containing protein 6 OS=Rattus norvegicus GN=Acbd6 PE=1 SV=1 6 227 4.0E-12
sp|Q54GC8|ACBD6_DICDI Acyl-CoA-binding domain-containing protein 6 homolog OS=Dictyostelium discoideum GN=acbd6 PE=3 SV=1 6 237 2.0E-11
sp|Q4V8X4|ACBD6_DANRE Acyl-CoA-binding domain-containing protein 6 OS=Danio rerio GN=acbd6 PE=2 SV=1 28 220 3.0E-10
sp|Q69ZU8|ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 183 237 2.0E-09
sp|Q9Y2G4|ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 183 237 1.0E-08
sp|O04066|ACBP_RICCO Acyl-CoA-binding protein OS=Ricinus communis PE=3 SV=1 22 86 2.0E-08
sp|Q39315|ACBP_BRANA Acyl-CoA-binding protein OS=Brassica napus PE=3 SV=1 23 86 3.0E-08
sp|Q5XIC0|ECI2_RAT Enoyl-CoA delta isomerase 2, mitochondrial OS=Rattus norvegicus GN=Eci2 PE=1 SV=1 24 71 5.0E-08
sp|Q9DCN1|NUD12_MOUSE Peroxisomal NADH pyrophosphatase NUDT12 OS=Mus musculus GN=Nudt12 PE=1 SV=1 154 238 9.0E-08
sp|O75521|ECI2_HUMAN Enoyl-CoA delta isomerase 2, mitochondrial OS=Homo sapiens GN=ECI2 PE=1 SV=4 24 71 1.0E-07
sp|P62775|MTPN_RAT Myotrophin OS=Rattus norvegicus GN=Mtpn PE=1 SV=2 148 223 2.0E-07
sp|P62774|MTPN_MOUSE Myotrophin OS=Mus musculus GN=Mtpn PE=1 SV=2 148 223 2.0E-07
sp|Q8MJ49|OSTF1_PIG Osteoclast-stimulating factor 1 OS=Sus scrofa GN=OSTF1 PE=2 SV=1 164 225 2.0E-07
sp|Q9BQG2|NUD12_HUMAN Peroxisomal NADH pyrophosphatase NUDT12 OS=Homo sapiens GN=NUDT12 PE=1 SV=1 154 238 3.0E-07
sp|Q91955|MTPN_CHICK Myotrophin OS=Gallus gallus GN=MTPN PE=3 SV=1 148 223 3.0E-07
sp|Q4R7L8|NUD12_MACFA Peroxisomal NADH pyrophosphatase NUDT12 OS=Macaca fascicularis GN=NUDT12 PE=2 SV=1 154 238 3.0E-07
sp|Q5RD76|NUD12_PONAB Peroxisomal NADH pyrophosphatase NUDT12 OS=Pongo abelii GN=NUDT12 PE=2 SV=1 154 238 3.0E-07
sp|Q8MJ50|OSTF1_BOVIN Osteoclast-stimulating factor 1 OS=Bos taurus GN=OSTF1 PE=2 SV=1 164 225 3.0E-07
sp|Q7T0Q1|MTPN_XENLA Myotrophin OS=Xenopus laevis GN=mtpn PE=3 SV=1 148 223 3.0E-07
sp|P58546|MTPN_HUMAN Myotrophin OS=Homo sapiens GN=MTPN PE=1 SV=2 148 223 5.0E-07
sp|Q863Z4|MTPN_CANLF Myotrophin OS=Canis lupus familiaris GN=MTPN PE=3 SV=3 148 223 5.0E-07
sp|Q3T0F7|MTPN_BOVIN Myotrophin OS=Bos taurus GN=MTPN PE=1 SV=3 148 223 5.0E-07
sp|Q6P1S6|MTPN_XENTR Myotrophin OS=Xenopus tropicalis GN=mtpn PE=3 SV=1 177 223 6.0E-07
sp|P57752|ACBP6_ARATH Acyl-CoA-binding domain-containing protein 6 OS=Arabidopsis thaliana GN=ACBP6 PE=1 SV=1 6 86 7.0E-07
sp|Q62422|OSTF1_MOUSE Osteoclast-stimulating factor 1 OS=Mus musculus GN=Ostf1 PE=1 SV=2 157 225 1.0E-06
sp|Q6P686|OSTF1_RAT Osteoclast-stimulating factor 1 OS=Rattus norvegicus GN=Ostf1 PE=1 SV=1 164 225 1.0E-06
sp|Q5ZJJ9|OSTF1_CHICK Osteoclast-stimulating factor 1 OS=Gallus gallus GN=OSTF1 PE=2 SV=1 157 225 1.0E-06
sp|Q92882|OSTF1_HUMAN Osteoclast-stimulating factor 1 OS=Homo sapiens GN=OSTF1 PE=1 SV=2 164 225 2.0E-06
sp|Q9WUR2|ECI2_MOUSE Enoyl-CoA delta isomerase 2, mitochondrial OS=Mus musculus GN=Eci2 PE=1 SV=2 24 71 2.0E-06
sp|P31824|ACBP_MANSE Acyl-CoA-binding protein homolog OS=Manduca sexta PE=3 SV=1 5 75 3.0E-06
sp|Q8K4M9|OSBL1_RAT Oxysterol-binding protein-related protein 1 OS=Rattus norvegicus GN=Osbpl1a PE=1 SV=1 151 237 4.0E-06
sp|Q54LF0|SIR2B_DICDI NAD-dependent deacetylase sir2B OS=Dictyostelium discoideum GN=sir2B PE=2 SV=1 147 237 4.0E-06
sp|O22643|ACBP_FRIAG Acyl-CoA-binding protein OS=Fritillaria agrestis GN=ACABP PE=3 SV=1 23 86 5.0E-06
sp|Q7ZYG4|OSTF1_XENLA Osteoclast-stimulating factor 1 OS=Xenopus laevis GN=ostf1 PE=2 SV=1 164 225 5.0E-06
sp|Q14DN9|AKD1B_MOUSE Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=3 154 237 5.0E-06
sp|Q6TGW5|OSTF1_DANRE Osteoclast-stimulating factor 1 OS=Danio rerio GN=ostf1 PE=2 SV=1 143 225 6.0E-06
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 179 225 6.0E-06
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 179 225 7.0E-06
sp|Q39779|ACBP_GOSHI Acyl-CoA-binding protein OS=Gossypium hirsutum PE=3 SV=1 23 86 8.0E-06
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 179 225 8.0E-06
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 179 225 8.0E-06
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 157 238 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0000062 fatty-acyl-CoA binding Yes
GO:0032555 purine ribonucleotide binding No
GO:0003674 molecular_function No
GO:0097367 carbohydrate derivative binding No
GO:0000166 nucleotide binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0033218 amide binding No
GO:0030554 adenyl nucleotide binding No
GO:0120227 acyl-CoA binding No
GO:0097159 organic cyclic compound binding No
GO:1901567 fatty acid derivative binding No
GO:1901363 heterocyclic compound binding No
GO:0017076 purine nucleotide binding No
GO:1901681 sulfur compound binding No
GO:0032553 ribonucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|010510
MPSPNFELAAAYLSTASSLTKVSNTVKLELYGLFKYVTTGPKPTVSRPSIFDMTGRAKWDAWNAAGQKYVDAQEA
ELRYLQMAKELGWDETKIDQSVKNDSKKGKGKVRAGEEGDDDIWDSDSDSGDSTTKSNSGLGLTVSTMAGAKEAS
EKTLHGFAVDNDVRGIVDLLKTVPNLNLNEMDEYGYTPLHLAADRGHIDVVILLLSKGVDKSIKDPDDMTALELA
HCVGNEDIVSALSG*
Coding >Agabi119p4|010510
ATGCCTTCCCCTAACTTTGAACTGGCCGCTGCATATCTTTCGACGGCTTCATCCCTCACCAAGGTTTCGAACACC
GTTAAGCTTGAGCTTTATGGATTATTTAAATATGTCACGACTGGACCAAAACCTACGGTGTCTCGACCGTCCATC
TTTGACATGACAGGACGCGCGAAATGGGACGCATGGAATGCAGCTGGACAGAAGTATGTTGATGCTCAAGAAGCC
GAATTGCGTTATTTGCAAATGGCAAAAGAGCTTGGATGGGATGAGACGAAAATTGATCAATCTGTAAAGAACGAT
TCGAAGAAGGGGAAGGGGAAGGTCAGGGCAGGTGAGGAAGGAGATGATGATATATGGGACTCGGACTCGGACTCG
GGCGATTCGACGACGAAGAGTAATTCAGGACTTGGGCTGACGGTGAGCACCATGGCTGGTGCAAAAGAAGCTAGT
GAGAAGACTTTGCATGGCTTCGCAGTCGACAACGATGTGAGAGGTATAGTGGATTTATTGAAAACAGTACCAAAT
CTAAACTTGAATGAGATGGACGAGTATGGATATACTCCATTGCATCTTGCAGCAGATAGAGGGCACATAGATGTA
GTAATACTTCTTTTGAGCAAAGGAGTTGACAAGTCAATCAAGGATCCGGACGACATGACTGCACTAGAACTGGCG
CATTGTGTAGGGAATGAAGATATAGTCTCGGCTCTTTCTGGGTAG
Transcript >Agabi119p4|010510
ATGCCTTCCCCTAACTTTGAACTGGCCGCTGCATATCTTTCGACGGCTTCATCCCTCACCAAGGTTTCGAACACC
GTTAAGCTTGAGCTTTATGGATTATTTAAATATGTCACGACTGGACCAAAACCTACGGTGTCTCGACCGTCCATC
TTTGACATGACAGGACGCGCGAAATGGGACGCATGGAATGCAGCTGGACAGAAGTATGTTGATGCTCAAGAAGCC
GAATTGCGTTATTTGCAAATGGCAAAAGAGCTTGGATGGGATGAGACGAAAATTGATCAATCTGTAAAGAACGAT
TCGAAGAAGGGGAAGGGGAAGGTCAGGGCAGGTGAGGAAGGAGATGATGATATATGGGACTCGGACTCGGACTCG
GGCGATTCGACGACGAAGAGTAATTCAGGACTTGGGCTGACGGTGAGCACCATGGCTGGTGCAAAAGAAGCTAGT
GAGAAGACTTTGCATGGCTTCGCAGTCGACAACGATGTGAGAGGTATAGTGGATTTATTGAAAACAGTACCAAAT
CTAAACTTGAATGAGATGGACGAGTATGGATATACTCCATTGCATCTTGCAGCAGATAGAGGGCACATAGATGTA
GTAATACTTCTTTTGAGCAAAGGAGTTGACAAGTCAATCAAGGATCCGGACGACATGACTGCACTAGAACTGGCG
CATTGTGTAGGGAATGAAGATATAGTCTCGGCTCTTTCTGGGTAG
Gene >Agabi119p4|010510
ATGCCTTCCCCTAACTTTGAACTGGCCGCTGCATATCTTTCGACGGCTTCATCCCTCACCAAGGTTTCGAACACC
GTTAAGCTTGAGGTTGCTAGCCGCTCGTTCCAATTGATCTTCATGGTTATATTGAACCTGACTAGATATTTTGTT
TCCTGCTTTCCTTGGCCTCGACAAAACACGCTTGCGCTTGAAACACATAGCTTTATGGATTATTTAAATATGTCA
CGACTGGACCAAAACCTACGGTGTCTCGACCGTCCATCTTTGACATGACAGGACGCGCGAAATGGGACGCATGGA
ATGCAGCTGGACAGAAGTATGTTGATGCTCAAGAAGCCGAATTGCGTTATTTGCAAATGGCAAAAGAGCTTGGAT
GGGATGAGACGAAAATTGATCAATCTGTAAAGAACGATTCGAAGAAGGGGAAGGGGAAGGTCAGGGCAGGTGAGG
AAGGAGATGATGATATATGGGACTCGGACTCGGACTCGGGCGATTCGACGACGAAGAGTAATTCAGGACTTGGGC
TGACGGTGAGCACCATGGCTGGTGCAAAAGAAGCTAGTGAGAAGACTTTGCATGGCTTCGCAGTCGACAACGATG
TGAGAGGTATAGTGGATTTATTGAAAACAGTACCAAATCTAAACTTGAATGAGATGGACGAGTATGTGAGTGTCA
ATCTGTGGTTGTCATTTTTCCCGTTTCAATTTGTTGAATGATTCAAAGGGATATACTCCATTGCATCTTGCAGCA
GATAGAGGGCACATAGATGTAGTAATACTTCTTTTGAGCAAAGGAGTTGACAAGTCAATCAAGGCAAGCATGTTT
TAGCCTCGCTACAGATTCAAGCAATGACCGTCAACATAACACAGGATCCGGACGACATGACTGCACTAGAACTGG
CGCATTGTGTAGGGAATGAAGATATAGTCTCGGCTCTTTCTGGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail