Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|010430
Gene name
Locationscaffold_01a:2445417..2446164
Strand+
Gene length (bp)747
Transcript length (bp)636
Coding sequence length (bp)636
Protein length (aa) 212

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07890 Rrp15p Rrp15p 2.1E-23 59 203

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0006364 rRNA processing Yes
GO:0006725 cellular aromatic compound metabolic process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0034470 ncRNA processing No
GO:0090304 nucleic acid metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006396 RNA processing No
GO:0044238 primary metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0016072 rRNA metabolic process No
GO:0009987 cellular process No
GO:0016070 RNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|010430
MPPLAPSDHNDDDLDLSSDNYASSEQDTDDAIHDLKKVKSKNTSKRKLRATAPSNFGATLQSLLSTDAPSSLPLS
LKPSTSRHKHDEKVQKREKKALQIEKKELEDKGRIRDVIGGWGGESERGLRKVAQRGVVQLFNAIQQSHATAAAT
AEDTKAGRGSGKPTLAAPTFEKKGKAKGKNKDNILGREKEQAVGKDDFFDMIKSGSIVSRV*
Coding >Agabi119p4|010430
ATGCCCCCTCTCGCCCCCTCCGACCACAACGACGACGACCTCGACTTATCTTCCGACAACTATGCCTCCTCTGAA
CAAGACACAGATGACGCCATTCACGATCTCAAAAAAGTAAAGTCAAAGAACACCTCAAAACGTAAATTAAGAGCA
ACCGCTCCCTCAAATTTTGGTGCTACCCTCCAATCCCTCCTCAGCACCGACGCACCATCCTCATTACCACTCTCC
CTCAAGCCTTCAACTTCACGTCACAAACATGACGAAAAGGTGCAAAAGCGAGAGAAAAAGGCTCTCCAAATCGAA
AAGAAGGAATTGGAAGATAAAGGCCGTATACGAGACGTTATAGGCGGCTGGGGCGGTGAGAGCGAACGCGGCCTG
CGAAAGGTCGCTCAGCGTGGCGTTGTGCAATTATTTAACGCTATTCAACAATCCCATGCCACTGCAGCTGCAACT
GCAGAGGACACAAAAGCAGGCCGAGGTTCCGGCAAACCTACGTTAGCTGCACCAACATTCGAGAAAAAAGGAAAA
GCCAAAGGAAAAAACAAGGATAACATCCTGGGTAGGGAGAAAGAGCAAGCGGTGGGCAAGGATGACTTTTTTGAT
ATGATAAAGTCGGGCAGCATTGTATCTAGAGTATAG
Transcript >Agabi119p4|010430
ATGCCCCCTCTCGCCCCCTCCGACCACAACGACGACGACCTCGACTTATCTTCCGACAACTATGCCTCCTCTGAA
CAAGACACAGATGACGCCATTCACGATCTCAAAAAAGTAAAGTCAAAGAACACCTCAAAACGTAAATTAAGAGCA
ACCGCTCCCTCAAATTTTGGTGCTACCCTCCAATCCCTCCTCAGCACCGACGCACCATCCTCATTACCACTCTCC
CTCAAGCCTTCAACTTCACGTCACAAACATGACGAAAAGGTGCAAAAGCGAGAGAAAAAGGCTCTCCAAATCGAA
AAGAAGGAATTGGAAGATAAAGGCCGTATACGAGACGTTATAGGCGGCTGGGGCGGTGAGAGCGAACGCGGCCTG
CGAAAGGTCGCTCAGCGTGGCGTTGTGCAATTATTTAACGCTATTCAACAATCCCATGCCACTGCAGCTGCAACT
GCAGAGGACACAAAAGCAGGCCGAGGTTCCGGCAAACCTACGTTAGCTGCACCAACATTCGAGAAAAAAGGAAAA
GCCAAAGGAAAAAACAAGGATAACATCCTGGGTAGGGAGAAAGAGCAAGCGGTGGGCAAGGATGACTTTTTTGAT
ATGATAAAGTCGGGCAGCATTGTATCTAGAGTATAG
Gene >Agabi119p4|010430
ATGCCCCCTCTCGCCCCCTCCGACCACAACGACGACGACCTCGACTTATCTTCCGACAACTATGCCTCCTCTGAA
CAAGACACAGATGACGCCATTCACGATCTCAAAAAAGTAAAGTCAAAGAACACCTCAAAACGTAAATTAAGAGCA
ACCGCTCCCTCAAATTTTGGTGCTACCCTCCAATCCCTCCTCAGCACCGACGCACCATCCTCATTACCACTCTCC
CTCAAGCCTTCAACTTCACGTCACAAACATGACGAAAAGGTGCAAAAGCGAGAGAAAAAGGCTCTCCAAATCGAA
AAGAAGGAATTGGAAGATAAAGGCCGTATACGAGACGTTATAGGCGGCTGGGGCGGTGAGAGCGAACGCGGCCTG
CGAAAGGTCGCTCAGCGTGGCGGTACGTCAAGCCATCGCATTTGTCCTTTGATATAATTGTTTTTGATTTACATT
ACATAGTTGTGCAATTATTTAACGCTATTCAACAATCCCATGCCACTGCAGCTGCAACTGCAGAGGACACAAAAG
CAGGCCGAGGTTCCGGCAAACCTACGTTAGCTGCACCAACATTCGAGAAAAAAGGAAAAGCCAAAGGAAAAAACA
AGGATAACATCCTGGGTAGGGAGAAAGAGCGTATGTCTTTTATATCTCATCCATTCCATCAAGTCATGAATTATT
ATTGCAGAAGCGGTGGGCAAGGATGACTTTTTTGATATGATAAAGTCGGGCAGCATTGTATCTAGAGTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail