Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|010210
Gene name
Locationscaffold_01a:2395389..2396781
Strand-
Gene length (bp)1392
Transcript length (bp)1284
Coding sequence length (bp)1284
Protein length (aa) 428

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08316 Pal1 Pal1 cell morphology protein 9.2E-15 120 160

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38809|YHP7_YEAST Uncharacterized protein YHR097C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHR097C PE=1 SV=1 102 158 3.0E-08
sp|Q9UU83|PAL1_SCHPO Protein pal1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pal1 PE=1 SV=1 112 165 1.0E-07
sp|Q05518|PAL1_YEAST Protein PAL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAL1 PE=1 SV=1 9 158 3.0E-06

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID5
Orthogroup1696
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|010210
Agaricus bisporus var bisporus H97 AgabiH97|010210
Agaricus bisporus var burnettii H119p4 Agabi119p4|010210 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|010210
MAAVRTHTSSSDPFLDPAAPPTHRPPPPPPKQPPSANMPRPAPPSKDIHDITEAVRDTVTLRDRSDGTRARVGRS
TTSIGAPNASPHHSSKRSHSEDSAIAEKSKSSGKSRGKKGSQHADVIDRLDFTSVGLFHHDGPFDACAPSRNKQR
NKAPLYAWTNPPDPVQYGDSAYPSAHAYAAFSNDYPEPPKKKVDAIAEAWGIHEPEPYEEFFAGGGGSTRPDGDT
PTSSIYNGRDSHSNPVTRSGLPKRVGDDAQGNKERTRGATRRSLVPPPQPIFVPDPIERLDSGAIPSPDPKRQKS
IMQRIRKMRDSPNVPVTSEYDQPSSPNSAFDQPYSPTQPTRPSHKSQNSFLGRFGNKAQPQSADKPEPFVLIEPL
PSSNKDLPPAPTMNVTSSGESAQHGSPEFGSPGIGRKTSLMKKVGRVVRGTR*
Coding >Agabi119p4|010210
ATGGCTGCAGTCCGCACCCACACATCCTCCTCAGACCCTTTCCTCGACCCCGCGGCTCCCCCCACTCATCGCCCG
CCGCCACCCCCGCCCAAGCAGCCCCCGTCGGCCAACATGCCTAGGCCAGCCCCTCCCTCCAAAGACATCCACGAT
ATCACCGAAGCTGTAAGAGACACCGTCACCCTTCGAGATCGCAGCGACGGCACCCGCGCCCGCGTTGGACGCAGC
ACAACTTCGATTGGGGCTCCAAACGCCAGCCCCCACCATAGCTCCAAACGCTCCCATTCTGAGGACTCTGCCATC
GCCGAAAAATCCAAATCTTCTGGAAAGTCTCGAGGCAAGAAAGGTTCTCAGCACGCAGACGTCATTGACCGTCTA
GATTTCACAAGTGTTGGCCTCTTCCATCACGATGGTCCCTTTGATGCCTGCGCCCCTTCCCGCAACAAGCAGCGA
AACAAGGCCCCTCTATACGCATGGACCAATCCCCCAGATCCAGTTCAGTATGGCGATAGTGCTTATCCATCTGCC
CACGCCTATGCCGCCTTTTCTAATGACTATCCCGAACCACCAAAAAAGAAGGTCGATGCCATAGCCGAGGCCTGG
GGGATACACGAACCAGAACCTTATGAAGAGTTTTTCGCTGGCGGTGGCGGCTCCACTCGCCCAGACGGTGACACC
CCAACTAGTTCGATCTACAACGGGAGAGATTCACACTCCAATCCGGTTACACGCAGTGGTCTCCCTAAACGAGTT
GGTGATGACGCTCAGGGCAATAAAGAGCGGACTCGCGGCGCCACCCGTCGTTCCCTTGTCCCGCCGCCTCAACCA
ATATTTGTCCCAGATCCCATTGAACGCCTCGATTCAGGTGCCATCCCGTCACCGGATCCTAAGCGGCAAAAATCT
ATTATGCAAAGAATACGTAAGATGCGCGACTCGCCAAACGTTCCCGTCACATCCGAATATGATCAACCGTCTTCC
CCTAATTCTGCCTTTGACCAACCCTACTCTCCCACGCAGCCTACCAGACCCTCTCACAAGTCCCAGAATTCCTTC
CTCGGGCGATTTGGTAATAAGGCGCAGCCCCAAAGTGCAGACAAACCTGAACCTTTCGTTTTAATCGAACCTTTG
CCATCGAGTAACAAAGATTTACCACCAGCCCCTACAATGAACGTGACGTCCTCCGGGGAAAGTGCACAACATGGA
TCTCCGGAATTTGGATCTCCCGGTATTGGCCGGAAAACTAGCCTCATGAAGAAAGTTGGAAGAGTTGTGCGTGGG
ACCAGATGA
Transcript >Agabi119p4|010210
ATGGCTGCAGTCCGCACCCACACATCCTCCTCAGACCCTTTCCTCGACCCCGCGGCTCCCCCCACTCATCGCCCG
CCGCCACCCCCGCCCAAGCAGCCCCCGTCGGCCAACATGCCTAGGCCAGCCCCTCCCTCCAAAGACATCCACGAT
ATCACCGAAGCTGTAAGAGACACCGTCACCCTTCGAGATCGCAGCGACGGCACCCGCGCCCGCGTTGGACGCAGC
ACAACTTCGATTGGGGCTCCAAACGCCAGCCCCCACCATAGCTCCAAACGCTCCCATTCTGAGGACTCTGCCATC
GCCGAAAAATCCAAATCTTCTGGAAAGTCTCGAGGCAAGAAAGGTTCTCAGCACGCAGACGTCATTGACCGTCTA
GATTTCACAAGTGTTGGCCTCTTCCATCACGATGGTCCCTTTGATGCCTGCGCCCCTTCCCGCAACAAGCAGCGA
AACAAGGCCCCTCTATACGCATGGACCAATCCCCCAGATCCAGTTCAGTATGGCGATAGTGCTTATCCATCTGCC
CACGCCTATGCCGCCTTTTCTAATGACTATCCCGAACCACCAAAAAAGAAGGTCGATGCCATAGCCGAGGCCTGG
GGGATACACGAACCAGAACCTTATGAAGAGTTTTTCGCTGGCGGTGGCGGCTCCACTCGCCCAGACGGTGACACC
CCAACTAGTTCGATCTACAACGGGAGAGATTCACACTCCAATCCGGTTACACGCAGTGGTCTCCCTAAACGAGTT
GGTGATGACGCTCAGGGCAATAAAGAGCGGACTCGCGGCGCCACCCGTCGTTCCCTTGTCCCGCCGCCTCAACCA
ATATTTGTCCCAGATCCCATTGAACGCCTCGATTCAGGTGCCATCCCGTCACCGGATCCTAAGCGGCAAAAATCT
ATTATGCAAAGAATACGTAAGATGCGCGACTCGCCAAACGTTCCCGTCACATCCGAATATGATCAACCGTCTTCC
CCTAATTCTGCCTTTGACCAACCCTACTCTCCCACGCAGCCTACCAGACCCTCTCACAAGTCCCAGAATTCCTTC
CTCGGGCGATTTGGTAATAAGGCGCAGCCCCAAAGTGCAGACAAACCTGAACCTTTCGTTTTAATCGAACCTTTG
CCATCGAGTAACAAAGATTTACCACCAGCCCCTACAATGAACGTGACGTCCTCCGGGGAAAGTGCACAACATGGA
TCTCCGGAATTTGGATCTCCCGGTATTGGCCGGAAAACTAGCCTCATGAAGAAAGTTGGAAGAGTTGTGCGTGGG
ACCAGATGA
Gene >Agabi119p4|010210
ATGGCTGCAGTCCGCACCCACACATCCTCCTCAGACCCTTTCCTCGACCCCGCGGCTCCCCCCACTCATCGCCCG
CCGCCACCCCCGCCCAAGCAGCCCCCGTCGGCCAACATGCCTAGGCCAGCCCCTCCCTCCAAAGACATCCACGAT
ATCACCGAAGCTGTAAGAGACACCGTCACCCTTCGAGATCGCAGCGACGGCACCCGCGCCCGCGTTGGACGCAGC
ACAACTTCGATGTAAGGTTTCTCTACCCCCAATGGAAGATGACTTATGCCTCCCGATAGTGGGGCTCCAAACGCC
AGCCCCCACCATAGCTCCAAACGCTCCCATTCTGAGGACTCTGCCATCGCCGAAAAATCCAAATCTTCTGGAAAG
TCTCGAGGCAAGAAAGGTTCTCAGCACGCAGACGTCATTGACCGTCTAGATTTCACAAGTGTTGGCCGTGCGTTC
TCTTGTCTGCACCTTGTCTTCGAATTCCTTCTAATCGATCAACCTCTCCCAGTCTTCCATCACGATGGTCCCTTT
GATGCCTGCGCCCCTTCCCGCAACAAGCAGCGAAACAAGGCCCCTCTATACGCATGGACCAATCCCCCAGATCCA
GTTCAGTATGGCGATAGTGCTTATCCATCTGCCCACGCCTATGCCGCCTTTTCTAATGACTATCCCGAACCACCA
AAAAAGAAGGTCGATGCCATAGCCGAGGCCTGGGGGATACACGAACCAGAACCTTATGAAGAGTTTTTCGCTGGC
GGTGGCGGCTCCACTCGCCCAGACGGTGACACCCCAACTAGTTCGATCTACAACGGGAGAGATTCACACTCCAAT
CCGGTTACACGCAGTGGTCTCCCTAAACGAGTTGGTGATGACGCTCAGGGCAATAAAGAGCGGACTCGCGGCGCC
ACCCGTCGTTCCCTTGTCCCGCCGCCTCAACCAATATTTGTCCCAGATCCCATTGAACGCCTCGATTCAGGTGCC
ATCCCGTCACCGGATCCTAAGCGGCAAAAATCTATTATGCAAAGAATACGTAAGATGCGCGACTCGCCAAACGTT
CCCGTCACATCCGAATATGATCAACCGTCTTCCCCTAATTCTGCCTTTGACCAACCCTACTCTCCCACGCAGCCT
ACCAGACCCTCTCACAAGTCCCAGAATTCCTTCCTCGGGCGATTTGGTAATAAGGCGCAGCCCCAAAGTGCAGAC
AAACCTGAACCTTTCGTTTTAATCGAACCTTTGCCATCGAGTAACAAAGATTTACCACCAGCCCCTACAATGAAC
GTGACGTCCTCCGGGGAAAGTGCACAACATGGATCTCCGGAATTTGGATCTCCCGGTATTGGCCGGAAAACTAGC
CTCATGAAGAAAGTTGGAAGAGTTGTGCGTGGGACCAGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail