Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|010140
Gene name
Locationscaffold_01a:2381994..2384470
Strand+
Gene length (bp)2476
Transcript length (bp)2247
Coding sequence length (bp)2247
Protein length (aa) 749

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07940 Hepar_II_III Heparinase II/III-like protein 3.7E-09 529 719

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016829 lyase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.5

Transmembrane Domains

Domain # Start End Length
1 48 70 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|010140
MEANYKSVNDSRQGLTPNHPYGAGDPYYAESTGYITPQPAKKRGISNWIKIGVPVLILIIVAAVLGGVLGSRASK
NDSASSNGASGAGSNSPDGSGNNNVDLADSRFATATDSQWLEPLYPSTTNTAVLTTPTFRPTSDDVLSWPQDPFT
FSNPSPTSLRTDRPRLIAPAYKWQALPALISNDPYLRGWNDTIFANATRYYNEPPVQYFMDGPSGILDNARDVKR
RIKTFGYAYRMTNDTRWVDRTWTELQNAANNGSVTWGSPPDVDDLWNKNHFLDTAELSAAFGIAYDFFYDIWTDE
QKSMIRFTLLKYGLQPGLLVYTDPSAATYGWWTNNITGNWNCVSNGGLILGSLAILGDDDTGTAEAILSHAIDNA
KQNCAFGVTSDGTWKETPNYWYFGCTGHAEMSSALLTATGSDYGLSDVNPDFGKTGLFHMYSNGPGSLFSWGDHG
PNKYSSTANCMFHYANQYQQPSYALFQRDQHDAPEPWSMFWYDAKTGGAFWNGAALDHFFDDVNDQWASMRTSWT
DNDAFLINIKAGRNDDHQTHNDLDCGDFVMDALGTRWFGDLGSADYRSPDYFSSGDQDAVRWQYYRKMTEGQNTI
LINRKNQLVSASPTVRHDSTNEAQGSSTVYTVPQDSTAFFVADMSSAYDDAQTVMRGIRFLNGRRQALLQDEINA
SGTVDWRVHTNATVETSGTSATLKLDGQQLKITMLDPPEGATFTTGAAESVFTRWAVHIANVDQPKLARDEGL*
Coding >Agabi119p4|010140
ATGGAGGCAAACTACAAGTCCGTCAACGACAGCCGGCAGGGGCTCACCCCTAACCACCCCTACGGCGCAGGTGAC
CCCTACTATGCAGAATCCACAGGATACATCACCCCCCAGCCCGCCAAAAAGCGTGGCATCAGCAACTGGATCAAA
ATCGGTGTCCCCGTCCTCATACTCATCATCGTTGCCGCCGTCCTTGGTGGTGTTCTTGGTAGCCGTGCCTCCAAG
AACGACAGCGCATCCAGCAACGGCGCCAGTGGCGCCGGCAGCAATTCCCCTGATGGCTCTGGCAACAACAACGTT
GATTTGGCCGATTCAAGATTTGCCACGGCTACTGACAGCCAGTGGTTGGAGCCTCTCTACCCCTCCACAACCAAT
ACTGCAGTCCTCACCACCCCGACTTTCCGCCCAACAAGCGATGACGTTCTCTCCTGGCCCCAGGATCCTTTTACC
TTTTCTAATCCTTCCCCAACTTCCCTACGCACAGACCGTCCGCGCCTCATTGCTCCAGCTTACAAGTGGCAAGCT
CTTCCCGCACTCATCTCCAACGATCCCTATCTCAGGGGTTGGAATGACACCATATTCGCCAATGCCACTCGCTAT
TACAATGAACCTCCCGTCCAATATTTCATGGATGGTCCCAGTGGCATTCTCGACAATGCTCGCGACGTCAAACGG
AGGATCAAGACATTCGGCTATGCTTACCGCATGACCAATGACACCCGCTGGGTTGACCGTACCTGGACGGAACTT
CAGAATGCGGCTAACAATGGTTCTGTCACATGGGGTAGTCCACCCGACGTGGATGACCTCTGGAATAAAAACCAC
TTTTTGGATACCGCCGAGCTTTCTGCAGCTTTTGGTATCGCCTATGATTTCTTCTATGATATCTGGACAGATGAG
CAGAAGAGCATGATCAGGTTTACCTTGCTTAAATACGGCCTACAACCCGGTTTGCTTGTTTACACCGATCCGAGC
GCTGCGACGTACGGTTGGTGGACAAATAATATCACAGGCAACTGGAATTGTGTTTCCAATGGTGGCCTTATCCTT
GGCTCGCTTGCCATACTCGGTGACGACGATACCGGAACGGCAGAGGCAATTCTCAGCCACGCAATCGACAACGCA
AAGCAAAACTGCGCCTTTGGTGTAACCTCTGATGGAACTTGGAAAGAGACACCCAACTACTGGTATTTCGGCTGC
ACAGGCCACGCCGAAATGTCTTCTGCCCTCCTTACCGCCACCGGTTCAGACTACGGCCTTAGCGATGTCAATCCT
GACTTTGGGAAGACAGGTCTATTCCACATGTACAGCAACGGTCCAGGGTCCCTATTCAGTTGGGGTGATCATGGT
CCAAACAAGTATTCTTCGACTGCCAACTGCATGTTCCACTATGCCAATCAATATCAGCAACCCTCGTATGCTTTG
TTCCAACGTGATCAGCATGATGCACCAGAGCCTTGGAGTATGTTTTGGTACGATGCCAAGACCGGTGGTGCTTTC
TGGAATGGTGCCGCCCTTGATCATTTCTTCGACGATGTTAATGATCAATGGGCTTCAATGCGTACCAGCTGGACT
GACAACGACGCCTTCCTCATCAACATCAAGGCTGGTCGTAACGATGATCACCAGACTCATAATGACCTCGATTGT
GGTGATTTCGTCATGGACGCCCTCGGTACTCGCTGGTTCGGTGACCTCGGATCTGCGGATTACAGATCTCCTGAC
TACTTCAGCAGTGGAGATCAGGATGCGGTTAGGTGGCAATACTATAGGAAGATGACAGAGGGCCAGAATACCATT
CTGATCAATCGTAAAAACCAGCTTGTCAGCGCCTCACCAACTGTCAGGCATGATAGTACAAATGAAGCCCAAGGG
TCGAGCACCGTTTATACAGTGCCTCAAGATTCAACAGCTTTCTTTGTCGCTGATATGTCCAGTGCCTACGACGAT
GCCCAAACGGTGATGCGCGGCATCCGCTTCCTCAATGGGCGTCGACAAGCCCTCTTGCAAGATGAAATCAATGCG
TCCGGCACCGTTGATTGGCGTGTGCATACCAACGCTACTGTAGAAACCAGCGGTACATCCGCAACTCTGAAACTC
GACGGCCAGCAGCTAAAGATTACCATGCTCGACCCTCCTGAAGGCGCAACATTCACCACCGGTGCCGCGGAGAGT
GTCTTTACCCGCTGGGCAGTACACATTGCAAATGTTGATCAACCCAAGTTGGCCAGGGATGAAGGACTCTGA
Transcript >Agabi119p4|010140
ATGGAGGCAAACTACAAGTCCGTCAACGACAGCCGGCAGGGGCTCACCCCTAACCACCCCTACGGCGCAGGTGAC
CCCTACTATGCAGAATCCACAGGATACATCACCCCCCAGCCCGCCAAAAAGCGTGGCATCAGCAACTGGATCAAA
ATCGGTGTCCCCGTCCTCATACTCATCATCGTTGCCGCCGTCCTTGGTGGTGTTCTTGGTAGCCGTGCCTCCAAG
AACGACAGCGCATCCAGCAACGGCGCCAGTGGCGCCGGCAGCAATTCCCCTGATGGCTCTGGCAACAACAACGTT
GATTTGGCCGATTCAAGATTTGCCACGGCTACTGACAGCCAGTGGTTGGAGCCTCTCTACCCCTCCACAACCAAT
ACTGCAGTCCTCACCACCCCGACTTTCCGCCCAACAAGCGATGACGTTCTCTCCTGGCCCCAGGATCCTTTTACC
TTTTCTAATCCTTCCCCAACTTCCCTACGCACAGACCGTCCGCGCCTCATTGCTCCAGCTTACAAGTGGCAAGCT
CTTCCCGCACTCATCTCCAACGATCCCTATCTCAGGGGTTGGAATGACACCATATTCGCCAATGCCACTCGCTAT
TACAATGAACCTCCCGTCCAATATTTCATGGATGGTCCCAGTGGCATTCTCGACAATGCTCGCGACGTCAAACGG
AGGATCAAGACATTCGGCTATGCTTACCGCATGACCAATGACACCCGCTGGGTTGACCGTACCTGGACGGAACTT
CAGAATGCGGCTAACAATGGTTCTGTCACATGGGGTAGTCCACCCGACGTGGATGACCTCTGGAATAAAAACCAC
TTTTTGGATACCGCCGAGCTTTCTGCAGCTTTTGGTATCGCCTATGATTTCTTCTATGATATCTGGACAGATGAG
CAGAAGAGCATGATCAGGTTTACCTTGCTTAAATACGGCCTACAACCCGGTTTGCTTGTTTACACCGATCCGAGC
GCTGCGACGTACGGTTGGTGGACAAATAATATCACAGGCAACTGGAATTGTGTTTCCAATGGTGGCCTTATCCTT
GGCTCGCTTGCCATACTCGGTGACGACGATACCGGAACGGCAGAGGCAATTCTCAGCCACGCAATCGACAACGCA
AAGCAAAACTGCGCCTTTGGTGTAACCTCTGATGGAACTTGGAAAGAGACACCCAACTACTGGTATTTCGGCTGC
ACAGGCCACGCCGAAATGTCTTCTGCCCTCCTTACCGCCACCGGTTCAGACTACGGCCTTAGCGATGTCAATCCT
GACTTTGGGAAGACAGGTCTATTCCACATGTACAGCAACGGTCCAGGGTCCCTATTCAGTTGGGGTGATCATGGT
CCAAACAAGTATTCTTCGACTGCCAACTGCATGTTCCACTATGCCAATCAATATCAGCAACCCTCGTATGCTTTG
TTCCAACGTGATCAGCATGATGCACCAGAGCCTTGGAGTATGTTTTGGTACGATGCCAAGACCGGTGGTGCTTTC
TGGAATGGTGCCGCCCTTGATCATTTCTTCGACGATGTTAATGATCAATGGGCTTCAATGCGTACCAGCTGGACT
GACAACGACGCCTTCCTCATCAACATCAAGGCTGGTCGTAACGATGATCACCAGACTCATAATGACCTCGATTGT
GGTGATTTCGTCATGGACGCCCTCGGTACTCGCTGGTTCGGTGACCTCGGATCTGCGGATTACAGATCTCCTGAC
TACTTCAGCAGTGGAGATCAGGATGCGGTTAGGTGGCAATACTATAGGAAGATGACAGAGGGCCAGAATACCATT
CTGATCAATCGTAAAAACCAGCTTGTCAGCGCCTCACCAACTGTCAGGCATGATAGTACAAATGAAGCCCAAGGG
TCGAGCACCGTTTATACAGTGCCTCAAGATTCAACAGCTTTCTTTGTCGCTGATATGTCCAGTGCCTACGACGAT
GCCCAAACGGTGATGCGCGGCATCCGCTTCCTCAATGGGCGTCGACAAGCCCTCTTGCAAGATGAAATCAATGCG
TCCGGCACCGTTGATTGGCGTGTGCATACCAACGCTACTGTAGAAACCAGCGGTACATCCGCAACTCTGAAACTC
GACGGCCAGCAGCTAAAGATTACCATGCTCGACCCTCCTGAAGGCGCAACATTCACCACCGGTGCCGCGGAGAGT
GTCTTTACCCGCTGGGCAGTACACATTGCAAATGTTGATCAACCCAAGTTGGCCAGGGATGAAGGACTCTGA
Gene >Agabi119p4|010140
ATGGAGGCAAACTACAAGTCCGTCAACGACAGCCGGCAGGGGCTCACCCCTAACCACCCCTACGGCGCAGGTGAC
CCCTACTATGCAGAATCCACAGGATACATCACCCCCCAGCCCGCCAAAAAGCGTGGCATCAGCAACTGGATCAAA
ATCGGTGTCCCCGTCCTCATACTCATCATCGTTGCCGCCGTCCTTGGTGGTGTTCTTGGTAGCCGTGCCTCCAAG
AACGACAGCGCATCCAGCAACGGCGCCAGTGGCGCCGGCAGCAATTCCCCTGATGGCTCTGGCAACAACAACGTT
GATTTGGCCGATTCAAGATTTGCCACGGCTACTGACAGCCAGTGGTTGGAGCCTCTCTACCCCTCCACAGTGCGC
AATTTCTCTCGCTATGTTCCTCCCTCTAACCTCACCCTACACCCTTTCAGACCAATACTGCAGTCCTCACCACCC
CGACTTTCCGCCCAACAAGCGATGACGTTCTCTCCTGGCCCCAGGATCCTTTTACCTTTTCTAATCCTTCCCCAA
CTTCCCTACGCACAGACCGTCCGCGCCTCATTGCTCCAGCTTACAAGTGGCAAGCTCTTCCCGCACTCATCTCCA
ACGATCCCTATCTCAGGGGTTGGAATGACACCATATTCGCCAATGCCACTCGCTATTACAATGAACCTCCCGTCC
AATATTTCATGGATGGTCCCAGTGGCATTCTCGACAATGCTCGCGACGTCAAACGGAGGATCAAGACATTCGGCT
ATGCTTACCGCATGACCAATGACACCCGCTGGGTTGACCGTACCTGGACGGAACTTCAGGCATGTGATCCGACTT
CATCGCCATCCCTCCTTCGGCTAACCTCTTCCCCCAGAATGCGGCTAACAATGGTTCTGTCACATGGGGTAGTCC
ACCCGACGTGGATGACCTCTGGAATAAAAACCACTTTTTGGATACCGCCGAGCTTTCTGCAGCTTTTGGTATCGC
CTATGATTTCTTCTATGATATCTGGACAGATGAGCAGAAGAGCATGATCAGGTTTACCTTGCTTAAATACGGCCT
ACAACCCGGTTTGCTTGTTTACACCGATCCGAGCGCTGCGACGTACGGTTGGTGGACAAATAATATCACAGGCAA
CTGGAATTGTGTTTCCAATGGTGGCCTTATCCTTGGCTCGCTTGCCATACTCGGTGACGACGATACCGGAACGGC
AGAGGCAATTCTCAGCCACGCAATCGACAACGCAAAGCAAAACTGCGCCTTTGGTGTAACCTCTGATGGAACTTG
GAAAGAGACACCCAACTACTGGTATTTCGGCTGCACAGGCCACGCCGAAATGTCTTCTGCCCTCCTTACCGCCAC
CGGTTCAGACTACGGCCTTAGCGATGTCAATCCTGACTTTGGGAAGACAGGTCTATTCCACATGTACAGCAACGG
TCCAGGGTCCCTATTCAGTTGGGGTGATCATGGTCCAAACAAGTATTCTTCGACTGCCAACTGCATGTTCCACTA
TGCCAATCAATATCAGCAACCCTCGTATGCTTTGTTCCAACGTGATCAGCATGATGCACCAGAGCCTTGGAGTAT
GTTTTGGTACGATGCCAAGACCGGTGGTGCTTTCTGGAATGGTGCCGCCCTTGATCATTTCTTCGACGATGTTAA
TGATCAATGGGCTTCAATGCGTACCAGCTGGACTGACAACGACGCCTTCCTCATCAACATCAAGGCTGGTCGTAA
CGATGATCACCAGACTCATAATGACCTCGATTGTGGTGATTTCGTCATGGACGCCCTCGGTACTCGCTGGTTCGG
TGACCTCGGATCTGCGGATTACAGATCTCCTGACTACTTCAGCAGTGGAGATCAGGATGCGGTTAGGTGGCAATA
CTATAGGAAGATGACAGAGGGCCAGAATACCATTCTGATCAATCGTAAAAACCAGCTTGTCAGCGCCTCACCAAC
TGTCAGGCATGATAGTACAAATGAAGCCCAAGGGTCGAGCACCGTTTATACAGTGCCTCAAGATTCAACAGCTTT
CTTTGTCGCTGATATGTCCAGTGCCTACGACGATGCGTAAGTGTGGACCATTCGTAAGTTTCTGGTTACTGACCC
ACTTTTGATTCTGCAGCCAAACGGTGATGCGCGGCATCCGCTTCCTCAATGGGCGTCGACAAGCCCTCTTGCAAG
ATGAAATCAATGCGTCCGGCACCGTTGATTGGCGTGTGCATACCAACGCTACTGTAGAAACCAGCGGTACATCCG
CAACTCTGAAACTCGACGGCCAGCAGCTAAAGATTACCATGCTCGACCCTCCTGAAGGCGCAACATTCACCACCG
GTGCCGCGGAGAGGTTTGCTACCGACGTAACGCCTCCGGTACCCGACCAGCCTAATCCCGGTGTGACCGTCCTCT
CAGTGTCTTTACCCGCTGGGCAGTACACATTGCAAATGTTGATCAACCCAAGTTGGCCAGGGATGAAGGACTCTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail