Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|010010
Gene name
Locationscaffold_01a:2346880..2349758
Strand+
Gene length (bp)2878
Transcript length (bp)2727
Coding sequence length (bp)2727
Protein length (aa) 909

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02469 Fasciclin Fasciclin domain 1.3E-09 31 200
PF02469 Fasciclin Fasciclin domain 9.8E-13 221 336
PF02469 Fasciclin Fasciclin domain 1.3E-13 352 484
PF02469 Fasciclin Fasciclin domain 6.0E-11 497 630
PF02469 Fasciclin Fasciclin domain 8.9E-06 647 731

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q15063|POSTN_HUMAN Periostin OS=Homo sapiens GN=POSTN PE=1 SV=2 186 630 2.0E-22
sp|Q62009|POSTN_MOUSE Periostin OS=Mus musculus GN=Postn PE=1 SV=2 186 638 4.0E-22
sp|Q15582|BGH3_HUMAN Transforming growth factor-beta-induced protein ig-h3 OS=Homo sapiens GN=TGFBI PE=1 SV=1 43 630 3.0E-15
sp|O11780|BGH3_PIG Transforming growth factor-beta-induced protein ig-h3 OS=Sus scrofa GN=TGFBI PE=1 SV=1 43 630 2.0E-14
sp|P82198|BGH3_MOUSE Transforming growth factor-beta-induced protein ig-h3 OS=Mus musculus GN=Tgfbi PE=1 SV=1 43 630 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q15063|POSTN_HUMAN Periostin OS=Homo sapiens GN=POSTN PE=1 SV=2 186 630 2.0E-22
sp|Q62009|POSTN_MOUSE Periostin OS=Mus musculus GN=Postn PE=1 SV=2 186 638 4.0E-22
sp|Q15582|BGH3_HUMAN Transforming growth factor-beta-induced protein ig-h3 OS=Homo sapiens GN=TGFBI PE=1 SV=1 43 630 3.0E-15
sp|O11780|BGH3_PIG Transforming growth factor-beta-induced protein ig-h3 OS=Sus scrofa GN=TGFBI PE=1 SV=1 43 630 2.0E-14
sp|P82198|BGH3_MOUSE Transforming growth factor-beta-induced protein ig-h3 OS=Mus musculus GN=Tgfbi PE=1 SV=1 43 630 2.0E-13
sp|Q95215|BGH3_RABIT Transforming growth factor-beta-induced protein ig-h3 OS=Oryctolagus cuniculus GN=TGFBI PE=2 SV=2 55 630 2.0E-11
sp|O94439|FSC1_SCHPO FAS1 domain-containing protein fsc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fsc1 PE=3 SV=1 175 633 3.0E-09
sp|Q15063|POSTN_HUMAN Periostin OS=Homo sapiens GN=POSTN PE=1 SV=2 235 718 7.0E-09
sp|Q62009|POSTN_MOUSE Periostin OS=Mus musculus GN=Postn PE=1 SV=2 236 718 1.0E-06
sp|Q8R4U0|STAB2_MOUSE Stabilin-2 OS=Mus musculus GN=Stab2 PE=1 SV=1 216 430 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 857 879 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|010010
MRLSVCLAALLARPALALSSTITDVLSADPDYEALLRLLQRTRLIPTLNTLPAATLFAPTNDAISKHDLWAHALD
DAFVLTDNVNEQLRQQLFYHMLNFSIAQGPAPEHSPPLHTFDTLLYPHKPLDPPSHEPPPHPPWMPIPSGTLGEK
SQRLRAVLADENQKGRVAVDAFGKGGADIVKPIVNATNGAVLGISDVLIPPLDLATVVSAQQSLSYFRRIVTPHV
IKFLNSTSELTLFLPVDNAWDQLNKYERIYLESEFASDDLSRIFNMHAVAKTGVKWSDSFTPGINLSTIDGTTLE
VVTTTEGTKVSGGDLVHPDIYASNGVLHLVSSLLIPEGALQITPEKYLLALNCTSFVSMLRSVNLTNLIRDTEQK
YTILAPQDDVLDVLGDSDLPEKGSPELKKLLQYHFVPGHWTAEKLENGMLLETTLEEEGLKGGKQVLSVDVHHSG
KDSKGLQFAGASVIGDPIELDNILVYFLSRPIVPPSDSISTALPSLDLSNFLAALLSSSQSDIIRTTPRTSLLIP
YNSAFKRLGLLVSAHLLSTSYKQDLEKVILHHTLSDVEYSSNLVNGSQQTFQTLEGSDIKLERMDNGTVLISPSG
GWPGMKSRLVPRDTLTQTGVIHELSDILLPRSVDITIGKLMKAAKGSTMISLFNRAGFEWILNGTAPPDDWSWPD
EKNPGGGIGWTVLCPTDDAFKNHNLTELFANPMRLKSIVMQHIILSPYPKDQHQRLDARHDFEEMYNNQPLVLED
TATYSTLRDNESFYGDIVFKSTGAEEDGTTQFIVGIKDARGTDGSGDWAKVLGWGRSTTSAFPTFEPTQLDSEPA
QMGFSTRAGFIGGAAGGVIQIDRLILPYEPPWWISYGAPSVVGFAGMVAICGFFYGVRIVWGWDTTEATYEPVGG
FGRNDDEE*
Coding >Agabi119p4|010010
ATGCGTCTCTCCGTCTGCCTCGCCGCCCTCCTCGCCCGCCCCGCCCTCGCTCTCTCGTCTACCATCACCGACGTC
CTCAGCGCAGACCCCGACTACGAGGCCCTCCTCCGTCTCCTCCAGCGCACGCGTCTCATCCCCACCCTCAACACT
CTCCCCGCAGCTACTCTCTTTGCCCCCACCAATGACGCCATTAGCAAACACGATCTTTGGGCACACGCCCTCGAC
GACGCCTTCGTCCTCACCGACAACGTCAACGAACAACTCCGCCAGCAGCTCTTCTATCATATGCTCAATTTCTCT
ATTGCCCAGGGACCAGCTCCTGAACACTCTCCACCCCTTCACACTTTCGACACCCTCCTCTATCCCCACAAACCT
CTAGATCCTCCCTCCCACGAACCTCCACCCCATCCTCCCTGGATGCCCATCCCTTCAGGAACTCTGGGCGAAAAG
TCCCAGCGACTACGCGCAGTCCTAGCCGACGAGAACCAGAAAGGCCGGGTCGCCGTTGATGCTTTCGGCAAAGGT
GGTGCCGATATCGTCAAACCTATCGTCAATGCCACGAATGGCGCTGTTCTCGGTATTTCAGATGTCCTAATCCCT
CCCCTAGACCTTGCTACCGTCGTATCTGCGCAACAGTCACTCTCCTATTTCCGTCGCATCGTCACGCCCCACGTC
ATCAAGTTTCTTAATTCGACTTCTGAACTCACCCTGTTCCTCCCGGTTGATAACGCCTGGGACCAACTCAACAAA
TACGAGAGGATATATCTTGAGAGCGAGTTTGCTTCCGACGATCTCAGTCGCATATTTAATATGCATGCCGTTGCA
AAGACAGGCGTAAAGTGGTCTGATTCATTTACCCCAGGCATCAACCTCTCGACGATCGACGGAACAACTCTTGAA
GTAGTCACCACCACCGAGGGTACTAAAGTTTCTGGCGGTGACCTCGTGCACCCAGACATCTATGCTTCCAATGGC
GTCCTTCACCTCGTTTCCTCATTGCTCATTCCCGAAGGCGCATTACAAATTACCCCAGAAAAGTACCTCCTCGCC
CTTAATTGCACATCTTTCGTCTCCATGCTTCGTTCCGTAAACCTTACTAATCTCATCCGTGACACCGAACAGAAA
TATACTATCCTAGCCCCTCAGGATGACGTACTCGATGTCCTTGGTGACAGTGATTTGCCCGAGAAAGGAAGTCCG
GAGCTAAAGAAACTCCTTCAATATCATTTCGTTCCTGGTCACTGGACCGCCGAGAAGCTTGAAAATGGAATGTTG
CTAGAGACGACATTGGAGGAAGAGGGGTTAAAGGGTGGGAAGCAGGTTTTGTCCGTTGATGTCCATCATAGCGGC
AAAGATTCCAAGGGTTTGCAATTTGCTGGAGCCAGTGTCATCGGCGATCCAATCGAACTTGACAACATCTTGGTT
TACTTTCTTTCAAGGCCCATAGTGCCTCCCTCGGATTCCATTTCCACCGCTCTCCCTTCCCTCGACTTGTCCAAC
TTCCTTGCCGCACTCCTTTCTTCCAGCCAATCTGACATCATTAGAACAACACCTCGCACTTCTCTTCTCATTCCG
TACAATTCCGCTTTTAAACGCCTTGGTCTCCTTGTCAGCGCACATCTTCTCAGCACATCCTACAAACAAGATCTT
GAAAAAGTCATTCTTCACCACACACTCTCCGATGTCGAGTACTCGAGCAACCTCGTCAATGGCTCTCAACAAACT
TTCCAAACGTTGGAAGGTAGCGACATCAAACTTGAACGTATGGACAACGGTACCGTTCTCATTAGCCCAAGTGGT
GGCTGGCCTGGCATGAAATCACGTCTTGTTCCACGAGACACTTTGACACAGACGGGTGTCATCCATGAGTTGTCC
GATATACTCCTGCCGAGGTCGGTCGACATTACGATCGGGAAACTCATGAAAGCTGCCAAAGGAAGTACTATGATA
AGTCTGTTCAATCGTGCCGGCTTTGAATGGATTCTGAATGGAACTGCGCCACCGGATGACTGGTCATGGCCTGAT
GAGAAGAATCCCGGCGGTGGTATTGGTTGGACGGTGCTGTGTCCCACGGACGATGCCTTTAAGAACCACAATCTC
ACTGAACTCTTCGCTAATCCCATGAGATTGAAATCCATTGTCATGCAACATATCATTCTTTCCCCTTATCCTAAA
GACCAACATCAACGATTAGACGCTAGACATGATTTTGAGGAGATGTACAACAACCAGCCTTTGGTTCTGGAAGAT
ACCGCCACGTATTCGACTCTGAGGGACAATGAATCGTTTTACGGGGATATTGTGTTCAAGTCTACGGGAGCGGAA
GAGGACGGTACGACACAATTCATCGTTGGGATCAAAGACGCACGAGGTACAGATGGCTCCGGAGATTGGGCCAAA
GTTTTGGGATGGGGTCGGAGCACAACTTCCGCTTTTCCTACTTTTGAACCCACACAATTAGATTCCGAACCCGCG
CAAATGGGATTCTCGACAAGGGCAGGATTTATCGGGGGTGCAGCTGGCGGTGTGATTCAAATTGATAGACTCATT
TTACCTTACGAGCCTCCTTGGTGGATTTCTTATGGTGCACCATCGGTGGTTGGATTTGCGGGTATGGTCGCGATA
TGTGGTTTCTTTTATGGTGTTCGAATTGTTTGGGGTTGGGATACGACTGAGGCGACGTATGAGCCTGTTGGTGGA
TTTGGGAGAAATGATGATGAGGAATAG
Transcript >Agabi119p4|010010
ATGCGTCTCTCCGTCTGCCTCGCCGCCCTCCTCGCCCGCCCCGCCCTCGCTCTCTCGTCTACCATCACCGACGTC
CTCAGCGCAGACCCCGACTACGAGGCCCTCCTCCGTCTCCTCCAGCGCACGCGTCTCATCCCCACCCTCAACACT
CTCCCCGCAGCTACTCTCTTTGCCCCCACCAATGACGCCATTAGCAAACACGATCTTTGGGCACACGCCCTCGAC
GACGCCTTCGTCCTCACCGACAACGTCAACGAACAACTCCGCCAGCAGCTCTTCTATCATATGCTCAATTTCTCT
ATTGCCCAGGGACCAGCTCCTGAACACTCTCCACCCCTTCACACTTTCGACACCCTCCTCTATCCCCACAAACCT
CTAGATCCTCCCTCCCACGAACCTCCACCCCATCCTCCCTGGATGCCCATCCCTTCAGGAACTCTGGGCGAAAAG
TCCCAGCGACTACGCGCAGTCCTAGCCGACGAGAACCAGAAAGGCCGGGTCGCCGTTGATGCTTTCGGCAAAGGT
GGTGCCGATATCGTCAAACCTATCGTCAATGCCACGAATGGCGCTGTTCTCGGTATTTCAGATGTCCTAATCCCT
CCCCTAGACCTTGCTACCGTCGTATCTGCGCAACAGTCACTCTCCTATTTCCGTCGCATCGTCACGCCCCACGTC
ATCAAGTTTCTTAATTCGACTTCTGAACTCACCCTGTTCCTCCCGGTTGATAACGCCTGGGACCAACTCAACAAA
TACGAGAGGATATATCTTGAGAGCGAGTTTGCTTCCGACGATCTCAGTCGCATATTTAATATGCATGCCGTTGCA
AAGACAGGCGTAAAGTGGTCTGATTCATTTACCCCAGGCATCAACCTCTCGACGATCGACGGAACAACTCTTGAA
GTAGTCACCACCACCGAGGGTACTAAAGTTTCTGGCGGTGACCTCGTGCACCCAGACATCTATGCTTCCAATGGC
GTCCTTCACCTCGTTTCCTCATTGCTCATTCCCGAAGGCGCATTACAAATTACCCCAGAAAAGTACCTCCTCGCC
CTTAATTGCACATCTTTCGTCTCCATGCTTCGTTCCGTAAACCTTACTAATCTCATCCGTGACACCGAACAGAAA
TATACTATCCTAGCCCCTCAGGATGACGTACTCGATGTCCTTGGTGACAGTGATTTGCCCGAGAAAGGAAGTCCG
GAGCTAAAGAAACTCCTTCAATATCATTTCGTTCCTGGTCACTGGACCGCCGAGAAGCTTGAAAATGGAATGTTG
CTAGAGACGACATTGGAGGAAGAGGGGTTAAAGGGTGGGAAGCAGGTTTTGTCCGTTGATGTCCATCATAGCGGC
AAAGATTCCAAGGGTTTGCAATTTGCTGGAGCCAGTGTCATCGGCGATCCAATCGAACTTGACAACATCTTGGTT
TACTTTCTTTCAAGGCCCATAGTGCCTCCCTCGGATTCCATTTCCACCGCTCTCCCTTCCCTCGACTTGTCCAAC
TTCCTTGCCGCACTCCTTTCTTCCAGCCAATCTGACATCATTAGAACAACACCTCGCACTTCTCTTCTCATTCCG
TACAATTCCGCTTTTAAACGCCTTGGTCTCCTTGTCAGCGCACATCTTCTCAGCACATCCTACAAACAAGATCTT
GAAAAAGTCATTCTTCACCACACACTCTCCGATGTCGAGTACTCGAGCAACCTCGTCAATGGCTCTCAACAAACT
TTCCAAACGTTGGAAGGTAGCGACATCAAACTTGAACGTATGGACAACGGTACCGTTCTCATTAGCCCAAGTGGT
GGCTGGCCTGGCATGAAATCACGTCTTGTTCCACGAGACACTTTGACACAGACGGGTGTCATCCATGAGTTGTCC
GATATACTCCTGCCGAGGTCGGTCGACATTACGATCGGGAAACTCATGAAAGCTGCCAAAGGAAGTACTATGATA
AGTCTGTTCAATCGTGCCGGCTTTGAATGGATTCTGAATGGAACTGCGCCACCGGATGACTGGTCATGGCCTGAT
GAGAAGAATCCCGGCGGTGGTATTGGTTGGACGGTGCTGTGTCCCACGGACGATGCCTTTAAGAACCACAATCTC
ACTGAACTCTTCGCTAATCCCATGAGATTGAAATCCATTGTCATGCAACATATCATTCTTTCCCCTTATCCTAAA
GACCAACATCAACGATTAGACGCTAGACATGATTTTGAGGAGATGTACAACAACCAGCCTTTGGTTCTGGAAGAT
ACCGCCACGTATTCGACTCTGAGGGACAATGAATCGTTTTACGGGGATATTGTGTTCAAGTCTACGGGAGCGGAA
GAGGACGGTACGACACAATTCATCGTTGGGATCAAAGACGCACGAGGTACAGATGGCTCCGGAGATTGGGCCAAA
GTTTTGGGATGGGGTCGGAGCACAACTTCCGCTTTTCCTACTTTTGAACCCACACAATTAGATTCCGAACCCGCG
CAAATGGGATTCTCGACAAGGGCAGGATTTATCGGGGGTGCAGCTGGCGGTGTGATTCAAATTGATAGACTCATT
TTACCTTACGAGCCTCCTTGGTGGATTTCTTATGGTGCACCATCGGTGGTTGGATTTGCGGGTATGGTCGCGATA
TGTGGTTTCTTTTATGGTGTTCGAATTGTTTGGGGTTGGGATACGACTGAGGCGACGTATGAGCCTGTTGGTGGA
TTTGGGAGAAATGATGATGAGGAATAG
Gene >Agabi119p4|010010
ATGCGTCTCTCCGTCTGCCTCGCCGCCCTCCTCGCCCGCCCCGCCCTCGCTCTCTCGTCTACCATCACCGACGTC
CTCAGCGCAGACCCCGACTACGAGGCCCTCCTCCGTCTCCTCCAGCGCACGCGTCTCATCCCCACCCTCAACACT
CTCCCCGCAGCTACTCTCTTTGCCCCCACCAATGACGCCATTAGCAAACACGATCTTTGGGCACACGCCCTCGAC
GACGCCTTCGTCCTCACCGACAACGTCAACGAACAACTCCGCCAGCAGCTCTTCTATCATATGCTCAATTTCTCT
ATTGCCCAGGGACCAGCTCCTGAACACTCTCCACCCCTTCACACTTTCGACACCCTCCTCTATCCCCACAAACCT
CTAGATCCTCCCTCCCACGAACCTCCACCCCATCCTCCCTGGATGCCCATCCCTTCAGGAACTCTGGGCGAAAAG
TCCCAGCGACTACGCGCAGTCCTAGCCGACGAGAACCAGAAAGGCCGGGTCGCCGTTGATGCTTTCGGCAAAGGT
GGTGCCGATATCGTCAAACCTATCGTCAATGCCACGAATGGCGCTGTTCTCGGTATTTCAGATGTCCTAATCCCT
CCCCTAGACCTTGGTATGTCTCCGCATTAACCGTGCCCCGCTCGTCCTCATGCTGTTCTAGCTACCGTCGTATCT
GCGCAACAGTCACTCTCCTATTTCCGTCGCATCGTCACGCCCCACGTCATCAAGTTTCTTAATTCGACTTCTGAA
CTCACCCTGTTCCTCCCGGTTGATAACGCCTGGGACCAACTCAACAAATACGAGAGGATATATCTTGAGAGCGAG
TTTGCTTCCGACGATCTCAGTCGCATATTTAATATGCATGCCGTTGCAAAGACAGGCGTAAAGTGGTCTGATTCA
TTTACCCCAGGCATCAACCGTAATTCATTCCAGTTCAGTCCTTGCAGACCCCTCGCTAACACGCGTCTATAGTCT
CGACGATCGACGGAACAACTCTTGAAGTAGTCACCACCACCGAGGGTACTAAAGTTTCTGGCGGTGACCTCGTGC
ACCCAGACATCTATGCTTCCAATGGCGTCCTTCACCTCGTTTCCTCATTGCTCATTCCCGAAGGCGCATTACAAA
TTACCCCAGAAAAGTACCTCCTCGCCCTTAATTGCACATCTTTCGTCTCCATGCTTCGTTCCGTAAACCTTACTA
ATCTCATCCGTGACACCGAACAGAAATATACTATCCTAGCCCCTCAGGATGACGTACTCGATGTCCTTGGTGACA
GTGATTTGCCCGAGAAAGGAAGTCCGGAGCTAAAGAAACTCCTTCAATATCATTTCGTTCCTGGTCACTGGACCG
CCGAGAAGCTTGAAAATGGAATGTTGCTAGAGACGACATTGGAGGAAGAGGGGTTAAAGGGTGGGAAGCAGGTTT
TGTCCGTTGATGTCCATCATAGCGGCAAAGATTCCAAGGGTTTGCAATTTGCTGGAGCCAGTGTCATCGGCGATC
CAAGTAAGCTTTGATACCTTTTATGCAAAGTGAGATGCTCATAGTCTCGGCAGTCGAACTTGACAACATCTTGGT
TTACTTTCTTTCAAGGCCCATAGTGCCTCCCTCGGATTCCATTTCCACCGCTCTCCCTTCCCTCGACTTGTCCAA
CTTCCTTGCCGCACTCCTTTCTTCCAGCCAATCTGACATCATTAGAACAACACCTCGCACTTCTCTTCTCATTCC
GTACAATTCCGCTTTTAAACGCCTTGGTCTCCTTGTCAGCGCACATCTTCTCAGCACATCCTACAAACAAGATCT
TGAAAAAGTCATTCTTCACCACACACTCTCCGATGTCGAGTACTCGAGCAACCTCGTCAATGGCTCTCAACAAAC
TTTCCAAACGTTGGAAGGTAGCGACATCAAACTTGAACGTATGGACAACGGTACCGTTCTCATTAGCCCAAGTGG
TGGCTGGCCTGGCATGAAATCACGTCTTGTTCCACGAGACACTTTGACACAGACGGGTGTCATCCATGAGTTGTC
CGATATACTCCTGCCGAGGTCGGTCGACATTACGATCGGGAAACTCATGAAAGCTGCCAAAGGAAGTACTATGAT
AAGTCTGTTCAATCGTGCCGGCTTTGAATGGATTCTGAATGGAACTGCGCCACCGGATGACTGGTCATGGCCTGA
TGAGAAGAATCCCGGCGGTGGTATTGGTTGGACGGTGCTGTGTCCCACGGACGATGCCTTTAAGAACCACAATCT
CACTGAACTCTTCGCTAATCCCATGAGATTGAAATCCATTGTCATGCAACATATCATTCTTTCCCCTTATCCTAA
AGACCAACATCAACGATTAGACGCTAGACATGATTTTGAGGAGATGTACAACAACCAGCCTTTGGTTCTGGAAGA
TACCGCCACGTATTCGACTCTGAGGGACAATGAATCGTTTTACGGGGATATTGTGTTCAAGTCTACGGGAGCGGA
AGAGGACGGTACGACACAATTCATCGTTGGGATCAAAGACGCACGAGGTACAGATGGCTCCGGAGATTGGGCCAA
AGTTTTGGGATGGGGTCGGAGCACAACTTCCGCTTTTCCTACTTTTGAACCCACACAATTAGATTCCGAACCCGC
GCAAATGGGATTCTCGACAAGGGCAGGATTTATCGGGGGTGCAGCTGGCGGTGTGATTCAAATTGATAGACTCAT
TTTACCTTACGAGCCTCCTTGGTGGATTTCTTATGGTGCACCATCGGTGGTTGGATTTGCGGGTATGGTCGCGAT
ATGTGGTTTCTTTTATGGTGTTCGAATTGTTTGGGGTTGGGATACGACTGAGGCGACGTATGAGCCTGTTGGTGG
ATTTGGGAGAAATGATGATGAGGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail