Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|009850
Gene name
Locationscaffold_01a:2313471..2314575
Strand+
Gene length (bp)1104
Transcript length (bp)669
Coding sequence length (bp)669
Protein length (aa) 223

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 1.3E-40 10 205

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36136|SHB17_YEAST Sedoheptulose 1,7-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHB17 PE=1 SV=1 8 211 1.0E-42
sp|Q11SV1|GPMA_CYTH3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=gpmA PE=3 SV=1 7 174 3.0E-15
sp|Q7NJF7|GPMA2_GLOVI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Gloeobacter violaceus (strain PCC 7421) GN=gpmA2 PE=3 SV=1 7 174 8.0E-15
sp|Q31SU3|GPMB_SHIBS Probable phosphoglycerate mutase GpmB OS=Shigella boydii serotype 4 (strain Sb227) GN=gpmB PE=3 SV=1 7 203 1.0E-14
sp|B2TZS8|GPMB_SHIB3 Probable phosphoglycerate mutase GpmB OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=gpmB PE=3 SV=1 7 203 1.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36136|SHB17_YEAST Sedoheptulose 1,7-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHB17 PE=1 SV=1 8 211 1.0E-42
sp|Q11SV1|GPMA_CYTH3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=gpmA PE=3 SV=1 7 174 3.0E-15
sp|Q7NJF7|GPMA2_GLOVI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Gloeobacter violaceus (strain PCC 7421) GN=gpmA2 PE=3 SV=1 7 174 8.0E-15
sp|Q31SU3|GPMB_SHIBS Probable phosphoglycerate mutase GpmB OS=Shigella boydii serotype 4 (strain Sb227) GN=gpmB PE=3 SV=1 7 203 1.0E-14
sp|B2TZS8|GPMB_SHIB3 Probable phosphoglycerate mutase GpmB OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=gpmB PE=3 SV=1 7 203 1.0E-14
sp|Q327K0|GPMB_SHIDS Probable phosphoglycerate mutase GpmB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=gpmB PE=3 SV=1 7 203 1.0E-14
sp|D3DFP8|PSPB_HYDTT Putative phosphoserine phosphatase 2 OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=pspB PE=1 SV=1 7 168 1.0E-14
sp|Q1R246|GPMB_ECOUT Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain UTI89 / UPEC) GN=gpmB PE=3 SV=1 7 203 1.0E-14
sp|Q8FA40|GPMB_ECOL6 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gpmB PE=3 SV=1 7 203 1.0E-14
sp|Q0T8R6|GPMB_ECOL5 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=gpmB PE=3 SV=1 7 203 1.0E-14
sp|A1AJW4|GPMB_ECOK1 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O1:K1 / APEC GN=gpmB PE=3 SV=1 7 203 1.0E-14
sp|B7MTE3|GPMB_ECO81 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O81 (strain ED1a) GN=gpmB PE=3 SV=1 7 203 1.0E-14
sp|B7NW76|GPMB_ECO7I Probable phosphoglycerate mutase GpmB OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=gpmB PE=3 SV=1 7 203 1.0E-14
sp|B7MNK4|GPMB_ECO45 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=gpmB PE=3 SV=1 7 203 1.0E-14
sp|Q3YTZ9|GPMB_SHISS Probable phosphoglycerate mutase GpmB OS=Shigella sonnei (strain Ss046) GN=gpmB PE=3 SV=1 7 203 2.0E-14
sp|P0A7A4|GPMB_SHIFL Probable phosphoglycerate mutase GpmB OS=Shigella flexneri GN=gpmB PE=3 SV=1 7 203 2.0E-14
sp|Q0SX17|GPMB_SHIF8 Probable phosphoglycerate mutase GpmB OS=Shigella flexneri serotype 5b (strain 8401) GN=gpmB PE=3 SV=1 7 203 2.0E-14
sp|B1LEK2|GPMB_ECOSM Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=gpmB PE=3 SV=1 7 203 2.0E-14
sp|B6I6P3|GPMB_ECOSE Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain SE11) GN=gpmB PE=3 SV=1 7 203 2.0E-14
sp|B7NH70|GPMB_ECOLU Probable phosphoglycerate mutase GpmB OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=gpmB PE=3 SV=1 7 203 2.0E-14
sp|P0A7A2|GPMB_ECOLI Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain K12) GN=gpmB PE=3 SV=1 7 203 2.0E-14
sp|B1IS24|GPMB_ECOLC Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=gpmB PE=3 SV=1 7 203 2.0E-14
sp|A8A8C4|GPMB_ECOHS Probable phosphoglycerate mutase GpmB OS=Escherichia coli O9:H4 (strain HS) GN=gpmB PE=3 SV=1 7 203 2.0E-14
sp|B1XFK5|GPMB_ECODH Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain K12 / DH10B) GN=gpmB PE=3 SV=1 7 203 2.0E-14
sp|C4ZT77|GPMB_ECOBW Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=gpmB PE=3 SV=1 7 203 2.0E-14
sp|B7LXV9|GPMB_ECO8A Probable phosphoglycerate mutase GpmB OS=Escherichia coli O8 (strain IAI1) GN=gpmB PE=3 SV=1 7 203 2.0E-14
sp|B5Z4S7|GPMB_ECO5E Probable phosphoglycerate mutase GpmB OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=gpmB PE=3 SV=1 7 203 2.0E-14
sp|P0A7A3|GPMB_ECO57 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O157:H7 GN=gpmB PE=3 SV=1 7 203 2.0E-14
sp|B7LEP1|GPMB_ECO55 Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain 55989 / EAEC) GN=gpmB PE=3 SV=1 7 203 2.0E-14
sp|A7ZVT7|GPMB_ECO24 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=gpmB PE=3 SV=1 7 203 2.0E-14
sp|A4W6B3|GPMB_ENT38 Probable phosphoglycerate mutase GpmB OS=Enterobacter sp. (strain 638) GN=gpmB PE=3 SV=1 7 203 6.0E-14
sp|C0Q8F5|GPMB_SALPC Probable phosphoglycerate mutase GpmB OS=Salmonella paratyphi C (strain RKS4594) GN=gpmB PE=3 SV=1 7 205 1.0E-13
sp|Q8ZJU8|GPMB_SALTY Probable phosphoglycerate mutase GpmB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gpmB PE=3 SV=1 7 205 2.0E-13
sp|B4TU55|GPMB_SALSV Probable phosphoglycerate mutase GpmB OS=Salmonella schwarzengrund (strain CVM19633) GN=gpmB PE=3 SV=1 7 205 2.0E-13
sp|A9N7F5|GPMB_SALPB Probable phosphoglycerate mutase GpmB OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=gpmB PE=3 SV=1 7 205 2.0E-13
sp|Q5PK44|GPMB_SALPA Probable phosphoglycerate mutase GpmB OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=gpmB PE=3 SV=1 7 205 2.0E-13
sp|B4T4I9|GPMB_SALNS Probable phosphoglycerate mutase GpmB OS=Salmonella newport (strain SL254) GN=gpmB PE=3 SV=1 7 205 2.0E-13
sp|B4TH18|GPMB_SALHS Probable phosphoglycerate mutase GpmB OS=Salmonella heidelberg (strain SL476) GN=gpmB PE=3 SV=1 7 205 2.0E-13
sp|B5R9W3|GPMB_SALG2 Probable phosphoglycerate mutase GpmB OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=gpmB PE=3 SV=1 7 205 2.0E-13
sp|B5R3B7|GPMB_SALEP Probable phosphoglycerate mutase GpmB OS=Salmonella enteritidis PT4 (strain P125109) GN=gpmB PE=3 SV=1 7 205 2.0E-13
sp|B5FTD9|GPMB_SALDC Probable phosphoglycerate mutase GpmB OS=Salmonella dublin (strain CT_02021853) GN=gpmB PE=3 SV=1 7 205 2.0E-13
sp|B5F543|GPMB_SALA4 Probable phosphoglycerate mutase GpmB OS=Salmonella agona (strain SL483) GN=gpmB PE=3 SV=1 7 205 2.0E-13
sp|O07617|PHOE_BACSU Uncharacterized phosphatase PhoE OS=Bacillus subtilis (strain 168) GN=phoE PE=3 SV=1 7 189 5.0E-13
sp|Q8Z0T4|GPMB_SALTI Probable phosphoglycerate mutase GpmB OS=Salmonella typhi GN=gpmB PE=3 SV=1 7 205 7.0E-13
sp|B1M6A7|GPMA_METRJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=gpmA PE=3 SV=1 7 194 1.0E-12
sp|Q57G26|GPMB_SALCH Probable phosphoglycerate mutase GpmB OS=Salmonella choleraesuis (strain SC-B67) GN=gpmB PE=3 SV=1 7 205 1.0E-12
sp|A9MR94|GPMB_SALAR Probable phosphoglycerate mutase GpmB OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=gpmB PE=3 SV=1 7 205 4.0E-12
sp|B5BAL1|GPMB_SALPK Probable phosphoglycerate mutase GpmB OS=Salmonella paratyphi A (strain AKU_12601) GN=gpmB PE=3 SV=1 7 203 5.0E-12
sp|B7LNT7|GPMB_ESCF3 Probable phosphoglycerate mutase GpmB OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=gpmB PE=3 SV=1 7 203 6.0E-12
sp|A8ALW1|GPMB_CITK8 Probable phosphoglycerate mutase GpmB OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=gpmB PE=3 SV=1 7 203 1.0E-11
sp|A7MIJ0|GPMB_CROS8 Probable phosphoglycerate mutase GpmB OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=gpmB PE=3 SV=1 7 203 1.0E-11
sp|Q9FNJ9|CA1P_ARATH Probable 2-carboxy-D-arabinitol-1-phosphatase OS=Arabidopsis thaliana GN=At5g22620 PE=1 SV=1 9 201 2.0E-11
sp|D3DFG8|PSPA_HYDTT Phosphoserine phosphatase 1 OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=pspA PE=1 SV=1 7 202 4.0E-11
sp|A6TI09|GPMB_KLEP7 Probable phosphoglycerate mutase GpmB OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=gpmB PE=3 SV=1 7 203 8.0E-11
sp|B5Y264|GPMB_KLEP3 Probable phosphoglycerate mutase GpmB OS=Klebsiella pneumoniae (strain 342) GN=gpmB PE=3 SV=1 7 203 2.0E-10
sp|B7KIT8|GPMA_CYAP7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Cyanothece sp. (strain PCC 7424) GN=gpmA PE=3 SV=1 7 177 2.0E-10
sp|B4EY52|GPMB_PROMH Probable phosphoglycerate mutase GpmB OS=Proteus mirabilis (strain HI4320) GN=gpmB PE=3 SV=1 7 203 4.0E-10
sp|A9IXE7|GPMA_BART1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=gpmA PE=3 SV=1 10 174 7.0E-10
sp|Q7N900|GPMB_PHOLL Probable phosphoglycerate mutase GpmB OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=gpmB PE=3 SV=1 7 203 1.0E-09
sp|P52086|COBC_ECOLI Adenosylcobalamin/alpha-ribazole phosphatase OS=Escherichia coli (strain K12) GN=cobC PE=3 SV=1 9 195 1.0E-09
sp|Q98DM0|GPMA_RHILO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium loti (strain MAFF303099) GN=gpmA PE=3 SV=1 10 138 1.0E-09
sp|A7HZ35|GPMA_PARL1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=gpmA PE=3 SV=1 7 195 2.0E-09
sp|B0UBD4|GPMA_METS4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylobacterium sp. (strain 4-46) GN=gpmA PE=3 SV=1 7 188 4.0E-09
sp|Q8L1Z7|GPMA_BARHE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=gpmA PE=3 SV=1 10 174 5.0E-09
sp|A1UTM4|GPMA_BARBK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=gpmA PE=3 SV=1 10 174 6.0E-09
sp|A8G9J4|GPMB_SERP5 Probable phosphoglycerate mutase GpmB OS=Serratia proteamaculans (strain 568) GN=gpmB PE=3 SV=1 7 203 6.0E-09
sp|P00950|PMG1_YEAST Phosphoglycerate mutase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPM1 PE=1 SV=3 7 194 7.0E-09
sp|W5EP13|CA1P_WHEAT 2-carboxy-D-arabinitol-1-phosphatase OS=Triticum aestivum PE=1 SV=1 9 215 7.0E-09
sp|Q6FZ12|GPMA_BARQU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella quintana (strain Toulouse) GN=gpmA PE=3 SV=1 10 174 8.0E-09
sp|P39701|COBC_SALTY Adenosylcobalamin/alpha-ribazole phosphatase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cobC PE=1 SV=3 9 195 1.0E-08
sp|Q2G373|GPMA_NOVAD 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=gpmA PE=3 SV=1 7 205 3.0E-08
sp|Q8KL44|GPMA_RHIEC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=gpmA PE=3 SV=1 7 174 5.0E-08
sp|P58652|COBC_SALTI Adenosylcobalamin/alpha-ribazole phosphatase OS=Salmonella typhi GN=cobC PE=3 SV=1 9 195 5.0E-08
sp|Q1GP88|GPMA_SPHAL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=gpmA PE=3 SV=1 7 194 8.0E-08
sp|B1ZA86|GPMA_METPB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=gpmA PE=3 SV=1 7 194 1.0E-07
sp|B2IEV6|GPMA_BEII9 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=gpmA PE=3 SV=1 7 174 1.0E-07
sp|A5VB15|GPMA_SPHWW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=gpmA PE=3 SV=1 7 194 1.0E-07
sp|B6JCI9|GPMA_OLICO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=gpmA PE=3 SV=1 10 174 2.0E-07
sp|Q3SW71|GPMA_NITWN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=gpmA PE=3 SV=1 10 137 2.0E-07
sp|B8EML2|GPMA_METSB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=gpmA PE=3 SV=1 7 174 3.0E-07
sp|Q38Z74|GPMA2_LACSS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=gpmA2 PE=3 SV=1 7 114 5.0E-07
sp|A6WYJ2|GPMA_OCHA4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=gpmA PE=3 SV=1 10 138 5.0E-07
sp|Q9A634|GPMA_CAUCR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=gpmA PE=3 SV=1 7 114 5.0E-07
sp|B8GYN6|GPMA_CAUCN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=gpmA PE=3 SV=1 7 114 5.0E-07
sp|P36623|PMGY_SCHPO Phosphoglycerate mutase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpm1 PE=1 SV=1 8 181 9.0E-07
sp|B6IYD3|GPMA_RHOCS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=gpmA PE=3 SV=1 7 210 9.0E-07
sp|Q74CR0|GPMA_GEOSL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=gpmA PE=3 SV=1 7 114 1.0E-06
sp|Q5P7N4|GPMA_AROAE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Aromatoleum aromaticum (strain EbN1) GN=gpmA PE=3 SV=1 7 110 1.0E-06
sp|B2KBU4|GPMA_ELUMP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Elusimicrobium minutum (strain Pei191) GN=gpmA PE=3 SV=1 7 114 1.0E-06
sp|Q97FJ6|GPMA_CLOAB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=gpmA PE=3 SV=1 7 209 1.0E-06
sp|Q49ZZ2|GPMA_STAS1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=gpmA PE=3 SV=1 7 174 1.0E-06
sp|P59160|GPMA_BRUSU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella suis biovar 1 (strain 1330) GN=gpmA PE=3 SV=1 10 138 1.0E-06
sp|A9WW62|GPMA_BRUSI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=gpmA PE=3 SV=1 10 138 1.0E-06
sp|A9MCX8|GPMA_BRUC2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=gpmA PE=3 SV=1 10 138 1.0E-06
sp|Q576R3|GPMA_BRUAB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella abortus biovar 1 (strain 9-941) GN=gpmA PE=3 SV=1 10 138 1.0E-06
sp|Q2YJN6|GPMA_BRUA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella abortus (strain 2308) GN=gpmA PE=3 SV=1 10 138 1.0E-06
sp|B2SC37|GPMA_BRUA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella abortus (strain S19) GN=gpmA PE=3 SV=1 10 138 1.0E-06
sp|Q6NJL2|GPMA_CORDI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=gpmA PE=3 SV=2 9 194 1.0E-06
sp|B9L9H5|GPMA_NAUPA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=gpmA PE=3 SV=1 7 194 1.0E-06
sp|A5VVV5|GPMA_BRUO2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=gpmA PE=3 SV=1 10 138 1.0E-06
sp|Q2N682|GPMA_ERYLH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Erythrobacter litoralis (strain HTCC2594) GN=gpmA PE=3 SV=1 7 114 1.0E-06
sp|A1WDX2|GPMA_VEREI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Verminephrobacter eiseniae (strain EF01-2) GN=gpmA PE=3 SV=1 7 175 1.0E-06
sp|Q8YDC9|GPMA_BRUME 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gpmA PE=3 SV=2 10 138 1.0E-06
sp|C0RMJ1|GPMA_BRUMB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=gpmA PE=3 SV=1 10 138 1.0E-06
sp|O94461|YFFL_SCHPO Probable phosphatase C1687.21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1687.21 PE=3 SV=1 9 110 2.0E-06
sp|A7IC75|GPMA_XANP2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=gpmA PE=3 SV=1 10 174 2.0E-06
sp|C4LLD4|GPMA_CORK4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=gpmA PE=3 SV=1 9 174 2.0E-06
sp|Q8A765|GPMA2_BACTN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=gpmA2 PE=3 SV=1 7 114 2.0E-06
sp|A4SDM0|GPMA_CHLPM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=gpmA PE=3 SV=1 7 209 2.0E-06
sp|B2S2B5|GPMA_TREPS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=gpmA PE=3 SV=1 9 114 2.0E-06
sp|P96121|GPMA_TREPA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Treponema pallidum (strain Nichols) GN=gpmA PE=3 SV=1 9 114 2.0E-06
sp|B2VH13|GPMB_ERWT9 Probable phosphoglycerate mutase GpmB OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=gpmB PE=3 SV=1 7 203 2.0E-06
sp|Q89WK1|GPMA_BRADU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=gpmA PE=3 SV=1 10 174 2.0E-06
sp|Q07UT3|GPMA_RHOP5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhodopseudomonas palustris (strain BisA53) GN=gpmA PE=3 SV=1 10 174 2.0E-06
sp|A4YJP8|GPMA_BRASO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bradyrhizobium sp. (strain ORS278) GN=gpmA PE=3 SV=1 10 174 3.0E-06
sp|C3MBY8|GPMA_RHISN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium sp. (strain NGR234) GN=gpmA PE=3 SV=1 10 175 3.0E-06
sp|P64956|Y2253_MYCBO Uncharacterized protein Mb2253c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2253c PE=3 SV=1 9 116 3.0E-06
sp|P9WLH5|Y2228_MYCTU Uncharacterized protein Rv2228c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2228c PE=1 SV=1 9 116 3.0E-06
sp|P9WLH4|Y2228_MYCTO Uncharacterized protein MT2287 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2287 PE=3 SV=1 9 116 3.0E-06
sp|Q7N6S0|GPMA_PHOLL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=gpmA PE=3 SV=1 9 110 3.0E-06
sp|Q9SCS3|PGML4_ARATH Phosphoglycerate mutase-like protein 4 OS=Arabidopsis thaliana GN=At3g50520 PE=2 SV=1 10 177 3.0E-06
sp|A9M1A2|GPMA_NEIM0 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Neisseria meningitidis serogroup C (strain 053442) GN=gpmA PE=3 SV=1 10 114 3.0E-06
sp|Q0C678|GPMA_HYPNA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Hyphomonas neptunium (strain ATCC 15444) GN=gpmA PE=3 SV=1 7 215 4.0E-06
sp|A8IGZ9|GPMA_AZOC5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=gpmA PE=3 SV=1 7 138 4.0E-06
sp|A1KV25|GPMA_NEIMF 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=gpmA PE=3 SV=1 10 114 4.0E-06
sp|B7GUR7|GPMA_BIFLS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=gpmA PE=3 SV=1 9 175 4.0E-06
sp|P59159|GPMA_BIFLO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bifidobacterium longum (strain NCC 2705) GN=gpmA PE=3 SV=1 9 175 4.0E-06
sp|B3DQI6|GPMA_BIFLD 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bifidobacterium longum (strain DJO10A) GN=gpmA PE=3 SV=1 9 175 4.0E-06
sp|C4K389|GPMA_HAMD5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=gpmA PE=3 SV=1 7 174 4.0E-06
sp|Q6MJP3|GPMA_BDEBA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=gpmA PE=3 SV=1 7 114 4.0E-06
sp|Q9JYF7|GPMA_NEIMB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Neisseria meningitidis serogroup B (strain MC58) GN=gpmA PE=3 SV=1 10 114 4.0E-06
sp|B3PXK3|GPMA_RHIE6 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium etli (strain CIAT 652) GN=gpmA PE=3 SV=1 10 138 5.0E-06
sp|B4RIY7|GPMA_NEIG2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=gpmA PE=3 SV=1 10 114 5.0E-06
sp|Q5F7C0|GPMA_NEIG1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=gpmA PE=3 SV=1 10 114 5.0E-06
sp|A1JJB8|GPMB_YERE8 Probable phosphoglycerate mutase GpmB OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=gpmB PE=3 SV=1 7 203 5.0E-06
sp|B8GFF8|GPMA_METPE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=gpmA PE=3 SV=1 7 194 5.0E-06
sp|B0SY17|GPMA_CAUSK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Caulobacter sp. (strain K31) GN=gpmA PE=3 SV=1 7 114 6.0E-06
sp|Q63B92|GPMA_BACCZ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain ZK / E33L) GN=gpmA PE=3 SV=1 7 114 6.0E-06
sp|Q8KFC8|GPMA_CHLTE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=gpmA PE=3 SV=1 7 174 7.0E-06
sp|Q88T35|GPMA2_LACPL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=gpmA2 PE=3 SV=1 7 114 7.0E-06
sp|B4EST0|GPMA_PROMH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Proteus mirabilis (strain HI4320) GN=gpmA PE=3 SV=1 9 174 7.0E-06
sp|Q6HIL9|GPMA_BACHK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=gpmA PE=3 SV=1 7 114 7.0E-06
sp|Q39V40|GPMA_GEOMG 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=gpmA PE=3 SV=1 7 114 7.0E-06
sp|Q21122|F2612_CAEEL 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Caenorhabditis elegans GN=pfkb-1.2 PE=3 SV=2 1 218 7.0E-06
sp|B9J102|GPMA_BACCQ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain Q1) GN=gpmA PE=3 SV=1 7 114 8.0E-06
sp|B7HS46|GPMA_BACC7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain AH187) GN=gpmA PE=3 SV=1 7 114 8.0E-06
sp|Q9JTF2|GPMA_NEIMA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=gpmA PE=3 SV=1 10 114 9.0E-06
sp|C1EUQ5|GPMA_BACC3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain 03BB102) GN=gpmA PE=3 SV=1 7 114 9.0E-06
sp|A0RE96|GPMA_BACAH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus thuringiensis (strain Al Hakam) GN=gpmA PE=3 SV=1 7 114 9.0E-06
sp|B5Y7Q7|GPMA_COPPD 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=gpmA PE=3 SV=1 7 114 9.0E-06
sp|Q3AU60|GPMA_CHLCH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobium chlorochromatii (strain CaD3) GN=gpmA PE=3 SV=1 7 175 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|009850
MSLHRPMPRLFVVRHGQTEWSENGRHTGLSDIPLTAKGEAQVQATAAKLVGDGHLIDPKNLCTVYVSPRQRAHKT
FHILFENVPKVPRHVLTEEAREWDYGEYEGLRTAEILERSPGWNGWTDGYPGGESVEELQSRVDSVIEKVRAYHR
QYYEEGTVSRDVMIVAHGHFGRVLTARWVGFPAAYGTKLTIDAGSITLLSYEHHNLAEPSITALNLSSLLLL*
Coding >Agabi119p4|009850
ATGTCCCTACACCGACCTATGCCTAGACTTTTTGTCGTTCGACACGGACAGACAGAGTGGTCTGAAAATGGGAGA
CATACGGGACTCTCCGATATACCGCTTACCGCCAAAGGAGAAGCTCAAGTCCAGGCAACAGCCGCTAAGCTCGTC
GGCGATGGACACCTGATTGACCCGAAGAACTTATGCACCGTCTATGTGTCCCCGAGGCAAAGAGCCCACAAGACA
TTCCACATCCTATTCGAAAATGTGCCTAAAGTTCCCCGCCATGTACTCACCGAAGAAGCCAGGGAATGGGACTAC
GGGGAATATGAAGGTCTCCGGACGGCAGAGATCCTCGAGAGGAGTCCTGGGTGGAATGGCTGGACGGATGGGTAC
CCCGGAGGTGAGAGTGTCGAAGAATTACAGTCCCGCGTGGATAGCGTCATAGAAAAGGTCCGCGCATACCATCGG
CAATATTATGAAGAAGGGACTGTCTCCCGCGATGTCATGATCGTCGCCCACGGACATTTTGGAAGAGTATTAACC
GCTCGTTGGGTCGGGTTCCCCGCGGCATACGGCACAAAGCTAACTATAGATGCTGGTTCTATCACACTCCTGAGC
TACGAGCATCATAATCTTGCCGAGCCGTCAATAACTGCATTAAATTTGTCCTCTCTGCTCCTCCTGTAG
Transcript >Agabi119p4|009850
ATGTCCCTACACCGACCTATGCCTAGACTTTTTGTCGTTCGACACGGACAGACAGAGTGGTCTGAAAATGGGAGA
CATACGGGACTCTCCGATATACCGCTTACCGCCAAAGGAGAAGCTCAAGTCCAGGCAACAGCCGCTAAGCTCGTC
GGCGATGGACACCTGATTGACCCGAAGAACTTATGCACCGTCTATGTGTCCCCGAGGCAAAGAGCCCACAAGACA
TTCCACATCCTATTCGAAAATGTGCCTAAAGTTCCCCGCCATGTACTCACCGAAGAAGCCAGGGAATGGGACTAC
GGGGAATATGAAGGTCTCCGGACGGCAGAGATCCTCGAGAGGAGTCCTGGGTGGAATGGCTGGACGGATGGGTAC
CCCGGAGGTGAGAGTGTCGAAGAATTACAGTCCCGCGTGGATAGCGTCATAGAAAAGGTCCGCGCATACCATCGG
CAATATTATGAAGAAGGGACTGTCTCCCGCGATGTCATGATCGTCGCCCACGGACATTTTGGAAGAGTATTAACC
GCTCGTTGGGTCGGGTTCCCCGCGGCATACGGCACAAAGCTAACTATAGATGCTGGTTCTATCACACTCCTGAGC
TACGAGCATCATAATCTTGCCGAGCCGTCAATAACTGCATTAAATTTGTCCTCTCTGCTCCTCCTGTAG
Gene >Agabi119p4|009850
ATGTCCCTACACCGACCTATGCCTAGACTTTTTGTCGTTCGACACGGTAAGTTTCCGCAAGATTCAGGCTTATGT
TCTATCATCTCATTTCCGGACAGGACAGACAGAGTGGTCTGAAAATGGGTGAGTCGTTTCTGATCGGGGTTCTTT
GCTCGGTCAACATTGAACGTCTGTTCTTGTAACCAGGAGACATGTGGGTCACTCTTCTCTGTCCATGAAAGCCAC
AAGTAACTCATGAGTATTTTGGTCTTTGGCGTAGACGGGACTCTCCGATATACCGCTTACCGCCAAAGGAGAAGC
TCAAGTCCAGGCAACAGCCGCTAAGCTCGTCGGCGATGGACGTATGTGTTCAGGCGATGGGAAATAGATTTACTC
TAACGCACACATAGACCTGATTGACCCGAAGAACTTATGCACCGTCTATGTGTCCCCGAGGCAAAGAGCCCACAA
GACATTCCACATCCTATTCGAAAATGTGCCTAAAGTTCCCCGCCATGTACTCACCGAAGAAGCCAGGGAATGGGA
CTACGGTAAGACCCGTGCAATTCTTCGTTTCCACTGCCATGTCATAGCCAAATTATAGGGGAATATGAAGGTCTC
CGGACGGCAGAGATCCTCGAGAGGAGTCCTGGGTGGAATGGCTGGACGGATGGGTAAGAACTGCAGCAACACCGG
CGATCGAACAGCGTCTGATGTTGATAAGGTACCCCGGAGGTGAGAGTGTCGAAGAATTACAGTCCCGCGTGGATA
GCGTCATAGAAAAGGTCCGCGCATACCATCGGCAATATTATGAAGAAGGGACTGTCTCCCGCGATGTCATGATCG
TCGCCCACGGACATTTTGGAAGAGTATTAACCGCTCGTTGGGTCGGGTTCCCCGCGGCATACGGTAGGAGCCTGT
GATACCATTTTGTGGCACATTTAACATTATGAGAATAGGCACAAAGCTAACTATAGATGCTGGTTCTGTAAGTAA
TTGTCATGGGCATATATGCAAAGACCAGCTTGCTGACTTTGATAGATCACACTCCTGAGCTACGAGCATCATAAT
CTTGCCGAGCCGTCAATAACTGCATTAAATTTGTCCTCTCTGCTCCTCCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail