Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|009710
Gene name
Locationscaffold_01a:2277081..2277516
Strand-
Gene length (bp)435
Transcript length (bp)333
Coding sequence length (bp)333
Protein length (aa) 111

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00366 Ribosomal_S17 Ribosomal protein S17 1.6E-19 8 75

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0BUP1|RS17_GRABC 30S ribosomal protein S17 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rpsQ PE=3 SV=1 1 84 2.0E-12
sp|Q0VSJ4|RS17_ALCBS 30S ribosomal protein S17 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rpsQ PE=3 SV=1 18 83 2.0E-12
sp|Q3IFM3|RS17_PSEHT 30S ribosomal protein S17 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rpsQ PE=3 SV=1 6 81 3.0E-12
sp|Q92QG1|RS17_RHIME 30S ribosomal protein S17 OS=Rhizobium meliloti (strain 1021) GN=rpsQ PE=3 SV=1 1 74 3.0E-12
sp|Q8UE27|RS17_AGRFC 30S ribosomal protein S17 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rpsQ PE=3 SV=1 1 74 3.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0BUP1|RS17_GRABC 30S ribosomal protein S17 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rpsQ PE=3 SV=1 1 84 2.0E-12
sp|Q0VSJ4|RS17_ALCBS 30S ribosomal protein S17 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rpsQ PE=3 SV=1 18 83 2.0E-12
sp|Q3IFM3|RS17_PSEHT 30S ribosomal protein S17 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rpsQ PE=3 SV=1 6 81 3.0E-12
sp|Q92QG1|RS17_RHIME 30S ribosomal protein S17 OS=Rhizobium meliloti (strain 1021) GN=rpsQ PE=3 SV=1 1 74 3.0E-12
sp|Q8UE27|RS17_AGRFC 30S ribosomal protein S17 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rpsQ PE=3 SV=1 1 74 3.0E-12
sp|A6U868|RS17_SINMW 30S ribosomal protein S17 OS=Sinorhizobium medicae (strain WSM419) GN=rpsQ PE=3 SV=1 1 74 3.0E-12
sp|C3MAY9|RS17_RHISN 30S ribosomal protein S17 OS=Rhizobium sp. (strain NGR234) GN=rpsQ PE=3 SV=1 1 74 6.0E-12
sp|Q5SHP7|RS17_THET8 30S ribosomal protein S17 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpsQ PE=1 SV=3 1 80 9.0E-12
sp|P24321|RS17_THETH 30S ribosomal protein S17 OS=Thermus thermophilus GN=rpsQ PE=1 SV=4 1 80 1.0E-11
sp|P62658|RS17_THET2 30S ribosomal protein S17 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpsQ PE=1 SV=2 1 80 1.0E-11
sp|A6Q1I7|RS17_NITSB 30S ribosomal protein S17 OS=Nitratiruptor sp. (strain SB155-2) GN=rpsQ PE=3 SV=1 5 80 1.0E-11
sp|A5FZV6|RS17_ACICJ 30S ribosomal protein S17 OS=Acidiphilium cryptum (strain JF-5) GN=rpsQ PE=3 SV=1 1 74 1.0E-11
sp|A7ZG03|RS17_CAMC1 30S ribosomal protein S17 OS=Campylobacter concisus (strain 13826) GN=rpsQ PE=3 SV=1 6 78 2.0E-11
sp|A7HZL5|RS17_CAMHC 30S ribosomal protein S17 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=rpsQ PE=3 SV=1 9 80 3.0E-11
sp|Q1WS99|RS17_LACS1 30S ribosomal protein S17 OS=Lactobacillus salivarius (strain UCC118) GN=rpsQ PE=3 SV=1 5 79 4.0E-11
sp|Q2K9K7|RS17_RHIEC 30S ribosomal protein S17 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rpsQ PE=3 SV=1 1 74 4.0E-11
sp|Q8CRG8|RS17_STAES 30S ribosomal protein S17 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpsQ PE=3 SV=1 13 79 4.0E-11
sp|Q5HM08|RS17_STAEQ 30S ribosomal protein S17 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpsQ PE=3 SV=1 13 79 4.0E-11
sp|Q4L8A5|RS17_STAHJ 30S ribosomal protein S17 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpsQ PE=3 SV=1 13 79 4.0E-11
sp|B3PWT0|RS17_RHIE6 30S ribosomal protein S17 OS=Rhizobium etli (strain CIAT 652) GN=rpsQ PE=3 SV=1 1 74 5.0E-11
sp|Q1MID2|RS17_RHIL3 30S ribosomal protein S17 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rpsQ PE=3 SV=1 1 74 5.0E-11
sp|Q5FTZ2|RS17_GLUOX 30S ribosomal protein S17 OS=Gluconobacter oxydans (strain 621H) GN=rpsQ PE=3 SV=1 1 74 5.0E-11
sp|Q2W2K0|RS17_MAGSA 30S ribosomal protein S17 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rpsQ PE=3 SV=1 1 70 5.0E-11
sp|B5ZYU4|RS17_RHILW 30S ribosomal protein S17 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rpsQ PE=3 SV=1 1 74 5.0E-11
sp|Q8NVB4|RS17_STAAW 30S ribosomal protein S17 OS=Staphylococcus aureus (strain MW2) GN=rpsQ PE=3 SV=1 13 79 6.0E-11
sp|A8Z348|RS17_STAAT 30S ribosomal protein S17 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rpsQ PE=3 SV=1 13 79 6.0E-11
sp|Q6G780|RS17_STAAS 30S ribosomal protein S17 OS=Staphylococcus aureus (strain MSSA476) GN=rpsQ PE=3 SV=1 13 79 6.0E-11
sp|Q6GEJ2|RS17_STAAR 30S ribosomal protein S17 OS=Staphylococcus aureus (strain MRSA252) GN=rpsQ PE=3 SV=1 13 79 6.0E-11
sp|A6QJ83|RS17_STAAE 30S ribosomal protein S17 OS=Staphylococcus aureus (strain Newman) GN=rpsQ PE=3 SV=1 13 79 6.0E-11
sp|Q5HDW7|RS17_STAAC 30S ribosomal protein S17 OS=Staphylococcus aureus (strain COL) GN=rpsQ PE=3 SV=1 13 79 6.0E-11
sp|Q2YYK6|RS17_STAAB 30S ribosomal protein S17 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rpsQ PE=3 SV=1 13 79 6.0E-11
sp|A5IV25|RS17_STAA9 30S ribosomal protein S17 OS=Staphylococcus aureus (strain JH9) GN=rpsQ PE=3 SV=1 13 79 6.0E-11
sp|Q2FW15|RS17_STAA8 30S ribosomal protein S17 OS=Staphylococcus aureus (strain NCTC 8325) GN=rpsQ PE=3 SV=1 13 79 6.0E-11
sp|Q2FEP8|RS17_STAA3 30S ribosomal protein S17 OS=Staphylococcus aureus (strain USA300) GN=rpsQ PE=3 SV=1 13 79 6.0E-11
sp|A6U3W6|RS17_STAA2 30S ribosomal protein S17 OS=Staphylococcus aureus (strain JH1) GN=rpsQ PE=3 SV=1 13 79 6.0E-11
sp|Q03ZN6|RS17_LEUMM 30S ribosomal protein S17 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rpsQ PE=3 SV=1 5 81 6.0E-11
sp|A7HM43|RS17_FERNB 30S ribosomal protein S17 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=rpsQ PE=3 SV=1 1 79 6.0E-11
sp|B9DM38|RS17_STACT 30S ribosomal protein S17 OS=Staphylococcus carnosus (strain TM300) GN=rpsQ PE=3 SV=1 13 79 7.0E-11
sp|A1REC3|RS17_SHESW 30S ribosomal protein S17 OS=Shewanella sp. (strain W3-18-1) GN=rpsQ PE=3 SV=1 6 78 8.0E-11
sp|A4YBX4|RS17_SHEPC 30S ribosomal protein S17 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rpsQ PE=3 SV=1 6 78 8.0E-11
sp|A9KWB1|RS17_SHEB9 30S ribosomal protein S17 OS=Shewanella baltica (strain OS195) GN=rpsQ PE=3 SV=1 6 78 8.0E-11
sp|A6WHT7|RS17_SHEB8 30S ribosomal protein S17 OS=Shewanella baltica (strain OS185) GN=rpsQ PE=3 SV=1 6 78 8.0E-11
sp|A3DA63|RS17_SHEB5 30S ribosomal protein S17 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rpsQ PE=3 SV=1 6 78 8.0E-11
sp|B8EBJ6|RS17_SHEB2 30S ribosomal protein S17 OS=Shewanella baltica (strain OS223) GN=rpsQ PE=3 SV=1 6 78 8.0E-11
sp|Q0I096|RS17_SHESR 30S ribosomal protein S17 OS=Shewanella sp. (strain MR-7) GN=rpsQ PE=3 SV=1 6 78 8.0E-11
sp|Q0HNS8|RS17_SHESM 30S ribosomal protein S17 OS=Shewanella sp. (strain MR-4) GN=rpsQ PE=3 SV=1 6 78 8.0E-11
sp|A0KRN3|RS17_SHESA 30S ribosomal protein S17 OS=Shewanella sp. (strain ANA-3) GN=rpsQ PE=3 SV=1 6 78 8.0E-11
sp|Q8EK60|RS17_SHEON 30S ribosomal protein S17 OS=Shewanella oneidensis (strain MR-1) GN=rpsQ PE=3 SV=1 6 78 8.0E-11
sp|A4SSZ7|RS17_AERS4 30S ribosomal protein S17 OS=Aeromonas salmonicida (strain A449) GN=rpsQ PE=3 SV=1 6 79 8.0E-11
sp|B3E7U4|RS17_GEOLS 30S ribosomal protein S17 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rpsQ PE=3 SV=1 8 80 8.0E-11
sp|B9JVP6|RS17_AGRVS 30S ribosomal protein S17 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rpsQ PE=3 SV=1 1 74 9.0E-11
sp|Q81J33|RS17_BACCR 30S ribosomal protein S17 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rpsQ PE=3 SV=1 13 80 9.0E-11
sp|B9JDT7|RS17_AGRRK 30S ribosomal protein S17 OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=rpsQ PE=3 SV=1 1 74 9.0E-11
sp|B6IRR5|RS17_RHOCS 30S ribosomal protein S17 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rpsQ PE=3 SV=1 1 74 1.0E-10
sp|Q2RQW9|RS17_RHORT 30S ribosomal protein S17 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rpsQ PE=3 SV=1 1 70 1.0E-10
sp|A1S227|RS17_SHEAM 30S ribosomal protein S17 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rpsQ PE=3 SV=1 6 78 1.0E-10
sp|Q17ZC9|RS17_HELAH 30S ribosomal protein S17 OS=Helicobacter acinonychis (strain Sheeba) GN=rpsQ PE=3 SV=1 5 78 1.0E-10
sp|Q7A462|RS17_STAAN 30S ribosomal protein S17 OS=Staphylococcus aureus (strain N315) GN=rpsQ PE=1 SV=1 13 79 1.0E-10
sp|Q99S30|RS17_STAAM 30S ribosomal protein S17 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rpsQ PE=3 SV=1 13 79 1.0E-10
sp|A7X5F0|RS17_STAA1 30S ribosomal protein S17 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rpsQ PE=3 SV=1 13 79 1.0E-10
sp|Q5HS99|RS17_CAMJR 30S ribosomal protein S17 OS=Campylobacter jejuni (strain RM1221) GN=rpsQ PE=3 SV=1 6 78 2.0E-10
sp|A1W1V1|RS17_CAMJJ 30S ribosomal protein S17 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=rpsQ PE=3 SV=1 6 78 2.0E-10
sp|Q9PLY0|RS17_CAMJE 30S ribosomal protein S17 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=rpsQ PE=3 SV=1 6 78 2.0E-10
sp|A8FP12|RS17_CAMJ8 30S ribosomal protein S17 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=rpsQ PE=3 SV=1 6 78 2.0E-10
sp|Q49ZF9|RS17_STAS1 30S ribosomal protein S17 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rpsQ PE=3 SV=1 13 79 2.0E-10
sp|Q6HPP9|RS17_BACHK 30S ribosomal protein S17 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rpsQ PE=3 SV=1 13 80 2.0E-10
sp|Q63H81|RS17_BACCZ 30S ribosomal protein S17 OS=Bacillus cereus (strain ZK / E33L) GN=rpsQ PE=3 SV=1 13 80 2.0E-10
sp|B9IZK3|RS17_BACCQ 30S ribosomal protein S17 OS=Bacillus cereus (strain Q1) GN=rpsQ PE=3 SV=1 13 80 2.0E-10
sp|B7HQV3|RS17_BACC7 30S ribosomal protein S17 OS=Bacillus cereus (strain AH187) GN=rpsQ PE=3 SV=1 13 80 2.0E-10
sp|B7HJ57|RS17_BACC4 30S ribosomal protein S17 OS=Bacillus cereus (strain B4264) GN=rpsQ PE=3 SV=1 13 80 2.0E-10
sp|C1ET48|RS17_BACC3 30S ribosomal protein S17 OS=Bacillus cereus (strain 03BB102) GN=rpsQ PE=3 SV=1 13 80 2.0E-10
sp|B7IT28|RS17_BACC2 30S ribosomal protein S17 OS=Bacillus cereus (strain G9842) GN=rpsQ PE=3 SV=1 13 80 2.0E-10
sp|Q73F87|RS17_BACC1 30S ribosomal protein S17 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rpsQ PE=3 SV=1 13 80 2.0E-10
sp|B7JKC8|RS17_BACC0 30S ribosomal protein S17 OS=Bacillus cereus (strain AH820) GN=rpsQ PE=3 SV=1 13 80 2.0E-10
sp|Q81VS1|RS17_BACAN 30S ribosomal protein S17 OS=Bacillus anthracis GN=rpsQ PE=3 SV=1 13 80 2.0E-10
sp|A0R8I9|RS17_BACAH 30S ribosomal protein S17 OS=Bacillus thuringiensis (strain Al Hakam) GN=rpsQ PE=3 SV=1 13 80 2.0E-10
sp|C3LJ91|RS17_BACAC 30S ribosomal protein S17 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rpsQ PE=3 SV=1 13 80 2.0E-10
sp|C3P9R4|RS17_BACAA 30S ribosomal protein S17 OS=Bacillus anthracis (strain A0248) GN=rpsQ PE=3 SV=1 13 80 2.0E-10
sp|A9VP86|RS17_BACWK 30S ribosomal protein S17 OS=Bacillus weihenstephanensis (strain KBAB4) GN=rpsQ PE=3 SV=1 13 80 2.0E-10
sp|A7H103|RS17_CAMC5 30S ribosomal protein S17 OS=Campylobacter curvus (strain 525.92) GN=rpsQ PE=3 SV=1 6 78 2.0E-10
sp|A7GK29|RS17_BACCN 30S ribosomal protein S17 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rpsQ PE=3 SV=1 13 80 2.0E-10
sp|P66449|RS17_HELPY 30S ribosomal protein S17 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rpsQ PE=3 SV=1 5 78 3.0E-10
sp|B2UV73|RS17_HELPS 30S ribosomal protein S17 OS=Helicobacter pylori (strain Shi470) GN=rpsQ PE=3 SV=1 5 78 3.0E-10
sp|P66450|RS17_HELPJ 30S ribosomal protein S17 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rpsQ PE=3 SV=1 5 78 3.0E-10
sp|Q1CRV0|RS17_HELPH 30S ribosomal protein S17 OS=Helicobacter pylori (strain HPAG1) GN=rpsQ PE=3 SV=1 5 78 3.0E-10
sp|B5Z8V8|RS17_HELPG 30S ribosomal protein S17 OS=Helicobacter pylori (strain G27) GN=rpsQ PE=3 SV=1 5 78 3.0E-10
sp|B6JNE8|RS17_HELP2 30S ribosomal protein S17 OS=Helicobacter pylori (strain P12) GN=rpsQ PE=3 SV=1 5 78 3.0E-10
sp|Q28UU5|RS17_JANSC 30S ribosomal protein S17 OS=Jannaschia sp. (strain CCS1) GN=rpsQ PE=3 SV=1 1 74 3.0E-10
sp|B0TM03|RS17_SHEHH 30S ribosomal protein S17 OS=Shewanella halifaxensis (strain HAW-EB4) GN=rpsQ PE=3 SV=1 6 78 3.0E-10
sp|A8ESV2|RS17_ARCB4 30S ribosomal protein S17 OS=Arcobacter butzleri (strain RM4018) GN=rpsQ PE=3 SV=1 6 78 4.0E-10
sp|B6EPT4|RS17_ALISL 30S ribosomal protein S17 OS=Aliivibrio salmonicida (strain LFI1238) GN=rpsQ PE=3 SV=1 6 83 4.0E-10
sp|A0L5Y2|RS17_MAGMM 30S ribosomal protein S17 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rpsQ PE=3 SV=1 1 74 4.0E-10
sp|Q5QXX3|RS17_IDILO 30S ribosomal protein S17 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rpsQ PE=3 SV=1 6 78 4.0E-10
sp|A0KF30|RS17_AERHH 30S ribosomal protein S17 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rpsQ PE=3 SV=1 6 74 5.0E-10
sp|A8F4S0|RS17_PSELT 30S ribosomal protein S17 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rpsQ PE=3 SV=1 6 79 5.0E-10
sp|A7H647|RS17_CAMJD 30S ribosomal protein S17 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=rpsQ PE=3 SV=1 6 78 6.0E-10
sp|A6X0C7|RS17_OCHA4 30S ribosomal protein S17 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rpsQ PE=3 SV=1 1 74 6.0E-10
sp|A8LM66|RS17_DINSH 30S ribosomal protein S17 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rpsQ PE=3 SV=1 1 74 6.0E-10
sp|Q65P98|RS17_BACLD 30S ribosomal protein S17 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rpsQ PE=3 SV=1 5 80 7.0E-10
sp|Q1GK20|RS17_RUEST 30S ribosomal protein S17 OS=Ruegeria sp. (strain TM1040) GN=rpsQ PE=3 SV=1 1 74 7.0E-10
sp|Q8ETX4|RS17_OCEIH 30S ribosomal protein S17 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rpsQ PE=3 SV=1 13 74 8.0E-10
sp|B8GV49|RS17_THISH 30S ribosomal protein S17 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=rpsQ PE=3 SV=1 13 79 8.0E-10
sp|Q089P5|RS17_SHEFN 30S ribosomal protein S17 OS=Shewanella frigidimarina (strain NCIMB 400) GN=rpsQ PE=3 SV=1 6 78 9.0E-10
sp|Q12SV0|RS17_SHEDO 30S ribosomal protein S17 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rpsQ PE=3 SV=1 6 78 9.0E-10
sp|P12874|RS17_BACSU 30S ribosomal protein S17 OS=Bacillus subtilis (strain 168) GN=rpsQ PE=1 SV=3 5 80 9.0E-10
sp|A8G1D9|RS17_SHESH 30S ribosomal protein S17 OS=Shewanella sediminis (strain HAW-EB3) GN=rpsQ PE=3 SV=1 6 78 1.0E-09
sp|Q2N9C0|RS17_ERYLH 30S ribosomal protein S17 OS=Erythrobacter litoralis (strain HTCC2594) GN=rpsQ PE=3 SV=1 1 75 1.0E-09
sp|A1WVB3|RS17_HALHL 30S ribosomal protein S17 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rpsQ PE=3 SV=1 13 79 1.0E-09
sp|A8GYY5|RS17_SHEPA 30S ribosomal protein S17 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rpsQ PE=3 SV=1 6 78 1.0E-09
sp|B9E9K0|RS17_MACCJ 30S ribosomal protein S17 OS=Macrococcus caseolyticus (strain JCSC5402) GN=rpsQ PE=3 SV=1 13 79 1.0E-09
sp|C4K7A9|RS17_HAMD5 30S ribosomal protein S17 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rpsQ PE=3 SV=1 13 79 2.0E-09
sp|Q88XX7|RS17_LACPL 30S ribosomal protein S17 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpsQ PE=3 SV=1 5 79 2.0E-09
sp|C5CGQ5|RS17_KOSOT 30S ribosomal protein S17 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=rpsQ PE=3 SV=1 1 88 2.0E-09
sp|B3WAK8|RS17_LACCB 30S ribosomal protein S17 OS=Lactobacillus casei (strain BL23) GN=rpsQ PE=3 SV=1 5 79 2.0E-09
sp|Q034Z2|RS17_LACC3 30S ribosomal protein S17 OS=Lactobacillus casei (strain ATCC 334) GN=rpsQ PE=3 SV=1 5 79 2.0E-09
sp|Q7M8E2|RS17_WOLSU 30S ribosomal protein S17 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rpsQ PE=3 SV=1 5 78 2.0E-09
sp|B2VK55|RS17_ERWT9 30S ribosomal protein S17 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rpsQ PE=3 SV=1 6 79 2.0E-09
sp|Q8G082|RS17_BRUSU 30S ribosomal protein S17 OS=Brucella suis biovar 1 (strain 1330) GN=rpsQ PE=3 SV=1 1 74 2.0E-09
sp|A5VQZ7|RS17_BRUO2 30S ribosomal protein S17 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rpsQ PE=3 SV=1 1 74 2.0E-09
sp|Q8YHN1|RS17_BRUME 30S ribosomal protein S17 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rpsQ PE=3 SV=1 1 74 2.0E-09
sp|C0RJJ2|RS17_BRUMB 30S ribosomal protein S17 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rpsQ PE=3 SV=1 1 74 2.0E-09
sp|A9M5P1|RS17_BRUC2 30S ribosomal protein S17 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rpsQ PE=3 SV=1 1 74 2.0E-09
sp|Q57CR7|RS17_BRUAB 30S ribosomal protein S17 OS=Brucella abortus biovar 1 (strain 9-941) GN=rpsQ PE=3 SV=1 1 74 2.0E-09
sp|Q2YRA4|RS17_BRUA2 30S ribosomal protein S17 OS=Brucella abortus (strain 2308) GN=rpsQ PE=3 SV=1 1 74 2.0E-09
sp|B2S670|RS17_BRUA1 30S ribosomal protein S17 OS=Brucella abortus (strain S19) GN=rpsQ PE=3 SV=1 1 74 2.0E-09
sp|B8CNE2|RS17_SHEPW 30S ribosomal protein S17 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rpsQ PE=3 SV=1 6 78 2.0E-09
sp|B1YGV9|RS17_EXIS2 30S ribosomal protein S17 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rpsQ PE=3 SV=1 5 79 2.0E-09
sp|Q7NQG1|RS17_CHRVO 30S ribosomal protein S17 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rpsQ PE=3 SV=1 6 74 3.0E-09
sp|Q16AD5|RS17_ROSDO 30S ribosomal protein S17 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rpsQ PE=3 SV=1 1 74 3.0E-09
sp|A6LLM2|RS17_THEM4 30S ribosomal protein S17 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rpsQ PE=3 SV=1 1 85 3.0E-09
sp|B1KMX4|RS17_SHEWM 30S ribosomal protein S17 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rpsQ PE=3 SV=1 6 78 3.0E-09
sp|A1ALV0|RS17_PELPD 30S ribosomal protein S17 OS=Pelobacter propionicus (strain DSM 2379) GN=rpsQ PE=3 SV=1 7 77 4.0E-09
sp|Q6FZD1|RS17_BARQU 30S ribosomal protein S17 OS=Bartonella quintana (strain Toulouse) GN=rpsQ PE=3 SV=1 1 74 4.0E-09
sp|Q3SSV7|RS17_NITWN 30S ribosomal protein S17 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rpsQ PE=3 SV=1 1 74 4.0E-09
sp|A8AQK7|RS17_CITK8 30S ribosomal protein S17 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rpsQ PE=3 SV=1 6 79 5.0E-09
sp|A4YSK1|RS17_BRASO 30S ribosomal protein S17 OS=Bradyrhizobium sp. (strain ORS278) GN=rpsQ PE=3 SV=1 1 74 5.0E-09
sp|A5ELL8|RS17_BRASB 30S ribosomal protein S17 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rpsQ PE=3 SV=1 1 74 5.0E-09
sp|B7IHV5|RS17_THEAB 30S ribosomal protein S17 OS=Thermosipho africanus (strain TCF52B) GN=rpsQ PE=3 SV=1 1 88 5.0E-09
sp|Q8K959|RS17_BUCAP 30S ribosomal protein S17 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rpsQ PE=3 SV=1 6 79 5.0E-09
sp|Q1AU38|RS17_RUBXD 30S ribosomal protein S17 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rpsQ PE=3 SV=1 18 78 5.0E-09
sp|P23828|RS17_GEOSE 30S ribosomal protein S17 OS=Geobacillus stearothermophilus GN=rpsQ PE=1 SV=2 13 79 6.0E-09
sp|Q04G76|RS17_OENOB 30S ribosomal protein S17 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rpsQ PE=3 SV=1 13 79 6.0E-09
sp|B0CH23|RS17_BRUSI 30S ribosomal protein S17 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rpsQ PE=3 SV=1 1 74 6.0E-09
sp|B9K895|RS17_THENN 30S ribosomal protein S17 OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=rpsQ PE=3 SV=1 1 87 6.0E-09
sp|Q2NQN1|RS17_SODGM 30S ribosomal protein S17 OS=Sodalis glossinidius (strain morsitans) GN=rpsQ PE=3 SV=1 6 79 6.0E-09
sp|Q211F7|RS17_RHOPB 30S ribosomal protein S17 OS=Rhodopseudomonas palustris (strain BisB18) GN=rpsQ PE=3 SV=1 1 74 6.0E-09
sp|Q07KM7|RS17_RHOP5 30S ribosomal protein S17 OS=Rhodopseudomonas palustris (strain BisA53) GN=rpsQ PE=3 SV=1 1 74 6.0E-09
sp|Q5LW49|RS17_RUEPO 30S ribosomal protein S17 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rpsQ PE=3 SV=1 1 74 7.0E-09
sp|Q2SU36|RS17_BURTA 30S ribosomal protein S17 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rpsQ PE=3 SV=1 13 80 7.0E-09
sp|B3QBX1|RS17_RHOPT 30S ribosomal protein S17 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rpsQ PE=3 SV=1 1 74 7.0E-09
sp|Q6N4U3|RS17_RHOPA 30S ribosomal protein S17 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rpsQ PE=1 SV=3 1 74 7.0E-09
sp|A7Z0P7|RS17_BACMF 30S ribosomal protein S17 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rpsQ PE=3 SV=1 5 80 8.0E-09
sp|C4L7T9|RS17_TOLAT 30S ribosomal protein S17 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rpsQ PE=3 SV=1 6 74 8.0E-09
sp|Q9HWE4|RS17_PSEAE 30S ribosomal protein S17 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rpsQ PE=3 SV=1 13 79 8.0E-09
sp|Q02T71|RS17_PSEAB 30S ribosomal protein S17 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rpsQ PE=3 SV=1 13 79 8.0E-09
sp|B7V653|RS17_PSEA8 30S ribosomal protein S17 OS=Pseudomonas aeruginosa (strain LESB58) GN=rpsQ PE=3 SV=1 13 79 8.0E-09
sp|A6UZJ7|RS17_PSEA7 30S ribosomal protein S17 OS=Pseudomonas aeruginosa (strain PA7) GN=rpsQ PE=3 SV=1 13 79 8.0E-09
sp|Q3YWU8|RS17_SHISS 30S ribosomal protein S17 OS=Shigella sonnei (strain Ss046) GN=rpsQ PE=3 SV=1 6 79 8.0E-09
sp|P0AG66|RS17_SHIFL 30S ribosomal protein S17 OS=Shigella flexneri GN=rpsQ PE=3 SV=2 6 79 8.0E-09
sp|Q0SZZ1|RS17_SHIF8 30S ribosomal protein S17 OS=Shigella flexneri serotype 5b (strain 8401) GN=rpsQ PE=3 SV=1 6 79 8.0E-09
sp|Q32B40|RS17_SHIDS 30S ribosomal protein S17 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rpsQ PE=3 SV=1 6 79 8.0E-09
sp|Q31VW5|RS17_SHIBS 30S ribosomal protein S17 OS=Shigella boydii serotype 4 (strain Sb227) GN=rpsQ PE=3 SV=1 6 79 8.0E-09
sp|B2U2S9|RS17_SHIB3 30S ribosomal protein S17 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rpsQ PE=3 SV=1 6 79 8.0E-09
sp|B7LRS7|RS17_ESCF3 30S ribosomal protein S17 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rpsQ PE=3 SV=1 6 79 8.0E-09
sp|Q1R616|RS17_ECOUT 30S ribosomal protein S17 OS=Escherichia coli (strain UTI89 / UPEC) GN=rpsQ PE=3 SV=1 6 79 8.0E-09
sp|B1LHC5|RS17_ECOSM 30S ribosomal protein S17 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rpsQ PE=3 SV=1 6 79 8.0E-09
sp|B6I225|RS17_ECOSE 30S ribosomal protein S17 OS=Escherichia coli (strain SE11) GN=rpsQ PE=3 SV=1 6 79 8.0E-09
sp|B7NDT2|RS17_ECOLU 30S ribosomal protein S17 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rpsQ PE=3 SV=1 6 79 8.0E-09
sp|P0AG63|RS17_ECOLI 30S ribosomal protein S17 OS=Escherichia coli (strain K12) GN=rpsQ PE=1 SV=2 6 79 8.0E-09
sp|B1IPY8|RS17_ECOLC 30S ribosomal protein S17 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rpsQ PE=3 SV=1 6 79 8.0E-09
sp|P0AG64|RS17_ECOL6 30S ribosomal protein S17 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rpsQ PE=3 SV=2 6 79 8.0E-09
sp|Q0TCF0|RS17_ECOL5 30S ribosomal protein S17 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rpsQ PE=3 SV=1 6 79 8.0E-09
sp|A1AGK0|RS17_ECOK1 30S ribosomal protein S17 OS=Escherichia coli O1:K1 / APEC GN=rpsQ PE=3 SV=1 6 79 8.0E-09
sp|A8A5B6|RS17_ECOHS 30S ribosomal protein S17 OS=Escherichia coli O9:H4 (strain HS) GN=rpsQ PE=3 SV=1 6 79 8.0E-09
sp|B1X6G3|RS17_ECODH 30S ribosomal protein S17 OS=Escherichia coli (strain K12 / DH10B) GN=rpsQ PE=3 SV=1 6 79 8.0E-09
sp|C4ZUG6|RS17_ECOBW 30S ribosomal protein S17 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rpsQ PE=3 SV=1 6 79 8.0E-09
sp|B7M1M5|RS17_ECO8A 30S ribosomal protein S17 OS=Escherichia coli O8 (strain IAI1) GN=rpsQ PE=3 SV=1 6 79 8.0E-09
sp|B7N0V1|RS17_ECO81 30S ribosomal protein S17 OS=Escherichia coli O81 (strain ED1a) GN=rpsQ PE=3 SV=1 6 79 8.0E-09
sp|B7NLN0|RS17_ECO7I 30S ribosomal protein S17 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rpsQ PE=3 SV=1 6 79 8.0E-09
sp|B5YTN2|RS17_ECO5E 30S ribosomal protein S17 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rpsQ PE=3 SV=1 6 79 8.0E-09
sp|P0AG65|RS17_ECO57 30S ribosomal protein S17 OS=Escherichia coli O157:H7 GN=rpsQ PE=3 SV=2 6 79 8.0E-09
sp|B7L4K0|RS17_ECO55 30S ribosomal protein S17 OS=Escherichia coli (strain 55989 / EAEC) GN=rpsQ PE=3 SV=1 6 79 8.0E-09
sp|B7MCS6|RS17_ECO45 30S ribosomal protein S17 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rpsQ PE=3 SV=1 6 79 8.0E-09
sp|B7UK35|RS17_ECO27 30S ribosomal protein S17 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rpsQ PE=3 SV=1 6 79 8.0E-09
sp|A7ZSK0|RS17_ECO24 30S ribosomal protein S17 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rpsQ PE=3 SV=1 6 79 8.0E-09
sp|A7MPH2|RS17_CROS8 30S ribosomal protein S17 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rpsQ PE=3 SV=1 6 79 8.0E-09
sp|B9KLA0|RS17_RHOSK 30S ribosomal protein S17 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rpsQ PE=3 SV=1 1 72 8.0E-09
sp|Q3J5R3|RS17_RHOS4 30S ribosomal protein S17 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rpsQ PE=3 SV=1 1 72 8.0E-09
sp|A3PGM0|RS17_RHOS1 30S ribosomal protein S17 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rpsQ PE=3 SV=1 1 72 8.0E-09
sp|A4WVJ9|RS17_RHOS5 30S ribosomal protein S17 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rpsQ PE=3 SV=1 1 72 8.0E-09
sp|Q0ABG6|RS17_ALKEH 30S ribosomal protein S17 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rpsQ PE=3 SV=1 6 79 8.0E-09
sp|Q605C1|RS17_METCA 30S ribosomal protein S17 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rpsQ PE=3 SV=1 13 79 9.0E-09
sp|A3Q991|RS17_SHELP 30S ribosomal protein S17 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rpsQ PE=3 SV=1 6 78 9.0E-09
sp|P66451|RS17_SALTY 30S ribosomal protein S17 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rpsQ PE=3 SV=2 6 79 9.0E-09
sp|P66452|RS17_SALTI 30S ribosomal protein S17 OS=Salmonella typhi GN=rpsQ PE=3 SV=2 6 79 9.0E-09
sp|B4TXD3|RS17_SALSV 30S ribosomal protein S17 OS=Salmonella schwarzengrund (strain CVM19633) GN=rpsQ PE=3 SV=1 6 79 9.0E-09
sp|B5BGX7|RS17_SALPK 30S ribosomal protein S17 OS=Salmonella paratyphi A (strain AKU_12601) GN=rpsQ PE=3 SV=1 6 79 9.0E-09
sp|C0Q0A7|RS17_SALPC 30S ribosomal protein S17 OS=Salmonella paratyphi C (strain RKS4594) GN=rpsQ PE=3 SV=1 6 79 9.0E-09
sp|A9MSY9|RS17_SALPB 30S ribosomal protein S17 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rpsQ PE=3 SV=1 6 79 9.0E-09
sp|Q5PIU2|RS17_SALPA 30S ribosomal protein S17 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rpsQ PE=3 SV=1 6 79 9.0E-09
sp|B4SUT1|RS17_SALNS 30S ribosomal protein S17 OS=Salmonella newport (strain SL254) GN=rpsQ PE=3 SV=1 6 79 9.0E-09
sp|B4TKK6|RS17_SALHS 30S ribosomal protein S17 OS=Salmonella heidelberg (strain SL476) GN=rpsQ PE=3 SV=1 6 79 9.0E-09
sp|B5RH24|RS17_SALG2 30S ribosomal protein S17 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rpsQ PE=3 SV=1 6 79 9.0E-09
sp|B5R282|RS17_SALEP 30S ribosomal protein S17 OS=Salmonella enteritidis PT4 (strain P125109) GN=rpsQ PE=3 SV=1 6 79 9.0E-09
sp|B5FJK5|RS17_SALDC 30S ribosomal protein S17 OS=Salmonella dublin (strain CT_02021853) GN=rpsQ PE=3 SV=1 6 79 9.0E-09
sp|Q57J41|RS17_SALCH 30S ribosomal protein S17 OS=Salmonella choleraesuis (strain SC-B67) GN=rpsQ PE=3 SV=1 6 79 9.0E-09
sp|A9MN57|RS17_SALAR 30S ribosomal protein S17 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rpsQ PE=3 SV=1 6 79 9.0E-09
sp|B5F7T6|RS17_SALA4 30S ribosomal protein S17 OS=Salmonella agona (strain SL483) GN=rpsQ PE=3 SV=1 6 79 9.0E-09
sp|Q1QN21|RS17_NITHX 30S ribosomal protein S17 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rpsQ PE=3 SV=1 1 74 9.0E-09
sp|Q5WLQ3|RS17_BACSK 30S ribosomal protein S17 OS=Bacillus clausii (strain KSM-K16) GN=rpsQ PE=3 SV=1 5 82 1.0E-08
sp|A8F994|RS17_BACP2 30S ribosomal protein S17 OS=Bacillus pumilus (strain SAFR-032) GN=rpsQ PE=3 SV=1 5 80 1.0E-08
sp|B8D840|RS17_BUCAT 30S ribosomal protein S17 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=rpsQ PE=3 SV=1 6 79 1.0E-08
sp|P57582|RS17_BUCAI 30S ribosomal protein S17 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rpsQ PE=3 SV=1 6 79 1.0E-08
sp|B8D9T8|RS17_BUCA5 30S ribosomal protein S17 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=rpsQ PE=3 SV=1 6 79 1.0E-08
sp|Q39KF8|RS17_BURL3 30S ribosomal protein S17 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rpsQ PE=3 SV=1 13 80 1.0E-08
sp|B4E5C9|RS17_BURCJ 30S ribosomal protein S17 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rpsQ PE=3 SV=1 13 80 1.0E-08
sp|A0K3N4|RS17_BURCH 30S ribosomal protein S17 OS=Burkholderia cenocepacia (strain HI2424) GN=rpsQ PE=3 SV=1 13 80 1.0E-08
sp|B1JU31|RS17_BURCC 30S ribosomal protein S17 OS=Burkholderia cenocepacia (strain MC0-3) GN=rpsQ PE=3 SV=1 13 80 1.0E-08
sp|Q1BRV7|RS17_BURCA 30S ribosomal protein S17 OS=Burkholderia cenocepacia (strain AU 1054) GN=rpsQ PE=3 SV=1 13 80 1.0E-08
sp|P49504|RR17_ODOSI 30S ribosomal protein S17, chloroplastic OS=Odontella sinensis GN=rps17 PE=3 SV=1 8 78 1.0E-08
sp|B1LBN1|RS17_THESQ 30S ribosomal protein S17 OS=Thermotoga sp. (strain RQ2) GN=rpsQ PE=3 SV=1 1 87 1.0E-08
sp|Q057B3|RS17_BUCCC 30S ribosomal protein S17 OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=rpsQ PE=3 SV=1 5 83 1.0E-08
sp|A5IM92|RS17_THEP1 30S ribosomal protein S17 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rpsQ PE=3 SV=1 1 87 1.0E-08
sp|Q2YAY8|RS17_NITMU 30S ribosomal protein S17 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rpsQ PE=3 SV=1 13 72 2.0E-08
sp|C6DG65|RS17_PECCP 30S ribosomal protein S17 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rpsQ PE=3 SV=1 6 79 2.0E-08
sp|Q6CZX9|RS17_PECAS 30S ribosomal protein S17 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rpsQ PE=3 SV=1 6 79 2.0E-08
sp|A4JAP9|RS17_BURVG 30S ribosomal protein S17 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rpsQ PE=3 SV=1 13 80 2.0E-08
sp|Q0BJ37|RS17_BURCM 30S ribosomal protein S17 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rpsQ PE=3 SV=1 13 80 2.0E-08
sp|B1YRN8|RS17_BURA4 30S ribosomal protein S17 OS=Burkholderia ambifaria (strain MC40-6) GN=rpsQ PE=3 SV=1 13 80 2.0E-08
sp|Q30TV5|RS17_SULDN 30S ribosomal protein S17 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=rpsQ PE=3 SV=1 6 78 2.0E-08
sp|Q5NQ56|RS17_ZYMMO 30S ribosomal protein S17 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rpsQ PE=3 SV=1 1 72 2.0E-08
sp|O66439|RS17_AQUAE 30S ribosomal protein S17 OS=Aquifex aeolicus (strain VF5) GN=rpsQ PE=3 SV=1 6 79 2.0E-08
sp|A6VLJ7|RS17_ACTSZ 30S ribosomal protein S17 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rpsQ PE=3 SV=1 6 79 2.0E-08
sp|B2S2E5|RS17_TREPS 30S ribosomal protein S17 OS=Treponema pallidum subsp. pallidum (strain SS14) GN=rpsQ PE=3 SV=1 6 79 2.0E-08
sp|O83228|RS17_TREPA 30S ribosomal protein S17 OS=Treponema pallidum (strain Nichols) GN=rpsQ PE=3 SV=1 6 79 2.0E-08
sp|Q89J93|RS17_BRADU 30S ribosomal protein S17 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rpsQ PE=3 SV=1 1 74 2.0E-08
sp|B0BSU0|RS17_ACTPJ 30S ribosomal protein S17 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rpsQ PE=3 SV=1 6 83 2.0E-08
sp|B3GZ20|RS17_ACTP7 30S ribosomal protein S17 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rpsQ PE=3 SV=1 6 83 2.0E-08
sp|A3N367|RS17_ACTP2 30S ribosomal protein S17 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rpsQ PE=3 SV=1 6 83 2.0E-08
sp|Q1H4M8|RS17_METFK 30S ribosomal protein S17 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=rpsQ PE=3 SV=1 13 79 2.0E-08
sp|B2JI57|RS17_BURP8 30S ribosomal protein S17 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rpsQ PE=3 SV=1 13 80 2.0E-08
sp|C0MCB9|RS17_STRS7 30S ribosomal protein S17 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rpsQ PE=3 SV=1 13 80 2.0E-08
sp|B4U509|RS17_STREM 30S ribosomal protein S17 OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=rpsQ PE=3 SV=1 13 80 2.0E-08
sp|C0M919|RS17_STRE4 30S ribosomal protein S17 OS=Streptococcus equi subsp. equi (strain 4047) GN=rpsQ PE=3 SV=1 13 80 2.0E-08
sp|Q65QW4|RS17_MANSM 30S ribosomal protein S17 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rpsQ PE=3 SV=1 6 79 2.0E-08
sp|C5D3S6|RS17_GEOSW 30S ribosomal protein S17 OS=Geobacillus sp. (strain WCH70) GN=rpsQ PE=3 SV=1 13 79 2.0E-08
sp|Q2GL50|RS17_ANAPZ 30S ribosomal protein S17 OS=Anaplasma phagocytophilum (strain HZ) GN=rpsQ PE=3 SV=1 1 74 2.0E-08
sp|A4WFB9|RS17_ENT38 30S ribosomal protein S17 OS=Enterobacter sp. (strain 638) GN=rpsQ PE=3 SV=1 6 74 2.0E-08
sp|Q2S3Q5|RS17_SALRD 30S ribosomal protein S17 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=rpsQ PE=3 SV=1 10 79 3.0E-08
sp|A7FNM6|RS17_YERP3 30S ribosomal protein S17 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rpsQ PE=3 SV=1 6 74 3.0E-08
sp|Q5PA67|RS17_ANAMM 30S ribosomal protein S17 OS=Anaplasma marginale (strain St. Maries) GN=rpsQ PE=3 SV=1 1 74 3.0E-08
sp|P55829|RS17_AGGAC 30S ribosomal protein S17 OS=Aggregatibacter actinomycetemcomitans GN=rpsQ PE=3 SV=2 6 79 3.0E-08
sp|Q7VKE0|RS17_HAEDU 30S ribosomal protein S17 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rpsQ PE=3 SV=1 6 83 3.0E-08
sp|Q63Q20|RS17_BURPS 30S ribosomal protein S17 OS=Burkholderia pseudomallei (strain K96243) GN=rpsQ PE=3 SV=1 13 80 3.0E-08
sp|A3NEH0|RS17_BURP6 30S ribosomal protein S17 OS=Burkholderia pseudomallei (strain 668) GN=rpsQ PE=3 SV=1 13 80 3.0E-08
sp|Q3JMS2|RS17_BURP1 30S ribosomal protein S17 OS=Burkholderia pseudomallei (strain 1710b) GN=rpsQ PE=3 SV=1 13 80 3.0E-08
sp|A3P0A4|RS17_BURP0 30S ribosomal protein S17 OS=Burkholderia pseudomallei (strain 1106a) GN=rpsQ PE=3 SV=1 13 80 3.0E-08
sp|A1V894|RS17_BURMS 30S ribosomal protein S17 OS=Burkholderia mallei (strain SAVP1) GN=rpsQ PE=3 SV=1 13 80 3.0E-08
sp|Q62GL4|RS17_BURMA 30S ribosomal protein S17 OS=Burkholderia mallei (strain ATCC 23344) GN=rpsQ PE=3 SV=1 13 80 3.0E-08
sp|A2S7I5|RS17_BURM9 30S ribosomal protein S17 OS=Burkholderia mallei (strain NCTC 10229) GN=rpsQ PE=3 SV=1 13 80 3.0E-08
sp|A3MRW3|RS17_BURM7 30S ribosomal protein S17 OS=Burkholderia mallei (strain NCTC 10247) GN=rpsQ PE=3 SV=1 13 80 3.0E-08
sp|A2RC23|RS17_STRPG 30S ribosomal protein S17 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rpsQ PE=3 SV=1 13 80 3.0E-08
sp|Q5XEC6|RS17_STRP6 30S ribosomal protein S17 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rpsQ PE=3 SV=1 13 80 3.0E-08
sp|B1JIX0|RS17_YERPY 30S ribosomal protein S17 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rpsQ PE=3 SV=1 6 82 3.0E-08
sp|Q664T0|RS17_YERPS 30S ribosomal protein S17 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rpsQ PE=3 SV=1 6 82 3.0E-08
sp|A4TH01|RS17_YERPP 30S ribosomal protein S17 OS=Yersinia pestis (strain Pestoides F) GN=rpsQ PE=3 SV=1 6 82 3.0E-08
sp|Q1CCV3|RS17_YERPN 30S ribosomal protein S17 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rpsQ PE=3 SV=1 6 82 3.0E-08
sp|Q8ZJA3|RS17_YERPE 30S ribosomal protein S17 OS=Yersinia pestis GN=rpsQ PE=3 SV=1 6 82 3.0E-08
sp|B2K5M1|RS17_YERPB 30S ribosomal protein S17 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rpsQ PE=3 SV=1 6 82 3.0E-08
sp|Q1C2V6|RS17_YERPA 30S ribosomal protein S17 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rpsQ PE=3 SV=1 6 82 3.0E-08
sp|A1JS24|RS17_YERE8 30S ribosomal protein S17 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rpsQ PE=3 SV=1 6 82 3.0E-08
sp|Q03IG0|RS17_STRTD 30S ribosomal protein S17 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rpsQ PE=3 SV=1 13 80 3.0E-08
sp|A8GKI8|RS17_SERP5 30S ribosomal protein S17 OS=Serratia proteamaculans (strain 568) GN=rpsQ PE=3 SV=1 6 82 3.0E-08
sp|C1CP97|RS17_STRZT 30S ribosomal protein S17 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rpsQ PE=3 SV=1 5 80 3.0E-08
sp|C1CIA6|RS17_STRZP 30S ribosomal protein S17 OS=Streptococcus pneumoniae (strain P1031) GN=rpsQ PE=3 SV=1 5 80 3.0E-08
sp|C1CC15|RS17_STRZJ 30S ribosomal protein S17 OS=Streptococcus pneumoniae (strain JJA) GN=rpsQ PE=3 SV=1 5 80 3.0E-08
sp|A4VSG3|RS17_STRSY 30S ribosomal protein S17 OS=Streptococcus suis (strain 05ZYH33) GN=rpsQ PE=3 SV=1 5 80 3.0E-08
sp|A3CK72|RS17_STRSV 30S ribosomal protein S17 OS=Streptococcus sanguinis (strain SK36) GN=rpsQ PE=3 SV=1 5 80 3.0E-08
sp|A4VYQ2|RS17_STRS2 30S ribosomal protein S17 OS=Streptococcus suis (strain 98HAH33) GN=rpsQ PE=3 SV=1 5 80 3.0E-08
sp|P0A4B4|RS17_STRR6 30S ribosomal protein S17 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpsQ PE=3 SV=1 5 80 3.0E-08
sp|B2IS49|RS17_STRPS 30S ribosomal protein S17 OS=Streptococcus pneumoniae (strain CGSP14) GN=rpsQ PE=3 SV=1 5 80 3.0E-08
sp|P0A4B3|RS17_STRPN 30S ribosomal protein S17 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpsQ PE=3 SV=1 5 80 3.0E-08
sp|B8ZKG6|RS17_STRPJ 30S ribosomal protein S17 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rpsQ PE=3 SV=1 5 80 3.0E-08
sp|B1I8K7|RS17_STRPI 30S ribosomal protein S17 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rpsQ PE=3 SV=1 5 80 3.0E-08
sp|C1CAM1|RS17_STRP7 30S ribosomal protein S17 OS=Streptococcus pneumoniae (strain 70585) GN=rpsQ PE=3 SV=1 5 80 3.0E-08
sp|B5E6G4|RS17_STRP4 30S ribosomal protein S17 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rpsQ PE=3 SV=1 5 80 3.0E-08
sp|Q04MM7|RS17_STRP2 30S ribosomal protein S17 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpsQ PE=3 SV=1 5 80 3.0E-08
sp|A8AZL6|RS17_STRGC 30S ribosomal protein S17 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rpsQ PE=3 SV=1 5 80 3.0E-08
sp|Q839F5|RS17_ENTFA 30S ribosomal protein S17 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rpsQ PE=3 SV=1 5 80 3.0E-08
sp|B7GJ76|RS17_ANOFW 30S ribosomal protein S17 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rpsQ PE=3 SV=1 5 79 3.0E-08
sp|Q6G2X4|RS17_BARHE 30S ribosomal protein S17 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rpsQ PE=3 SV=1 1 74 3.0E-08
sp|Q8D203|RS17_WIGBR 30S ribosomal protein S17 OS=Wigglesworthia glossinidia brevipalpis GN=rpsQ PE=3 SV=1 5 80 3.0E-08
sp|A9ADK2|RS17_BURM1 30S ribosomal protein S17 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rpsQ PE=3 SV=1 13 80 3.0E-08
sp|Q5L414|RS17_GEOKA 30S ribosomal protein S17 OS=Geobacillus kaustophilus (strain HTA426) GN=rpsQ PE=3 SV=1 13 79 3.0E-08
sp|B0U0Y0|RS17_FRAP2 30S ribosomal protein S17 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=rpsQ PE=3 SV=1 5 78 4.0E-08
sp|Q5E8A6|RS17_VIBF1 30S ribosomal protein S17 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rpsQ PE=3 SV=1 6 83 4.0E-08
sp|Q134T8|RS17_RHOPS 30S ribosomal protein S17 OS=Rhodopseudomonas palustris (strain BisB5) GN=rpsQ PE=3 SV=1 1 74 4.0E-08
sp|Q2IXQ1|RS17_RHOP2 30S ribosomal protein S17 OS=Rhodopseudomonas palustris (strain HaA2) GN=rpsQ PE=3 SV=1 1 74 4.0E-08
sp|A4IJJ8|RS17_GEOTN 30S ribosomal protein S17 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rpsQ PE=3 SV=1 13 79 4.0E-08
sp|B5XJ45|RS17_STRPZ 30S ribosomal protein S17 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=rpsQ PE=3 SV=1 13 79 4.0E-08
sp|P0DE79|RS17_STRPQ 30S ribosomal protein S17 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rpsQ PE=3 SV=1 13 79 4.0E-08
sp|Q48VU0|RS17_STRPM 30S ribosomal protein S17 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rpsQ PE=3 SV=1 13 79 4.0E-08
sp|Q1J905|RS17_STRPF 30S ribosomal protein S17 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rpsQ PE=3 SV=1 13 79 4.0E-08
sp|Q1JJ53|RS17_STRPD 30S ribosomal protein S17 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rpsQ PE=3 SV=1 13 79 4.0E-08
sp|Q1JP08|RS17_STRPC 30S ribosomal protein S17 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rpsQ PE=3 SV=1 13 79 4.0E-08
sp|Q1JE49|RS17_STRPB 30S ribosomal protein S17 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rpsQ PE=3 SV=1 13 79 4.0E-08
sp|Q7CNP8|RS17_STRP8 30S ribosomal protein S17 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rpsQ PE=3 SV=1 13 79 4.0E-08
sp|P0DE78|RS17_STRP3 30S ribosomal protein S17 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rpsQ PE=3 SV=1 13 79 4.0E-08
sp|Q9A1W5|RS17_STRP1 30S ribosomal protein S17 OS=Streptococcus pyogenes serotype M1 GN=rpsQ PE=3 SV=1 13 79 4.0E-08
sp|Q8E2C5|RS17_STRA5 30S ribosomal protein S17 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rpsQ PE=3 SV=1 13 79 4.0E-08
sp|Q8E7T2|RS17_STRA3 30S ribosomal protein S17 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rpsQ PE=3 SV=1 13 79 4.0E-08
sp|Q3K3W0|RS17_STRA1 30S ribosomal protein S17 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rpsQ PE=3 SV=1 13 79 4.0E-08
sp|O31164|RS17_SPICI 30S ribosomal protein S17 OS=Spiroplasma citri GN=rpsQ PE=3 SV=1 5 83 4.0E-08
sp|A0PXV5|RS17_CLONN 30S ribosomal protein S17 OS=Clostridium novyi (strain NT) GN=rpsQ PE=3 SV=1 13 79 4.0E-08
sp|B8F764|RS17_HAEPS 30S ribosomal protein S17 OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=rpsQ PE=3 SV=1 6 83 4.0E-08
sp|Q0ANQ9|RS17_MARMM 30S ribosomal protein S17 OS=Maricaulis maris (strain MCS10) GN=rpsQ PE=3 SV=1 1 74 4.0E-08
sp|Q7VQD9|RS17_BLOFL 30S ribosomal protein S17 OS=Blochmannia floridanus GN=rpsQ PE=3 SV=1 5 79 4.0E-08
sp|P38519|RS17_THEMA 30S ribosomal protein S17 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rpsQ PE=3 SV=2 1 85 5.0E-08
sp|Q5GSV3|RS17_WOLTR 30S ribosomal protein S17 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=rpsQ PE=3 SV=1 1 74 5.0E-08
sp|Q0BNR8|RS17_FRATO 30S ribosomal protein S17 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rpsQ PE=3 SV=1 5 78 5.0E-08
sp|Q2A5G1|RS17_FRATH 30S ribosomal protein S17 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rpsQ PE=3 SV=1 5 78 5.0E-08
sp|A7N9T4|RS17_FRATF 30S ribosomal protein S17 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rpsQ PE=3 SV=1 5 78 5.0E-08
sp|Q02W33|RS17_LACLS 30S ribosomal protein S17 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rpsQ PE=3 SV=1 5 80 5.0E-08
sp|Q4FUE7|RS17_PSYA2 30S ribosomal protein S17 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rpsQ PE=3 SV=1 5 79 5.0E-08
sp|P46175|RS17_BUCAK 30S ribosomal protein S17 OS=Buchnera aphidicola subsp. Acyrthosiphon kondoi GN=rpsQ PE=3 SV=1 6 74 5.0E-08
sp|A4IZS5|RS17_FRATW 30S ribosomal protein S17 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rpsQ PE=3 SV=1 5 78 6.0E-08
sp|Q5NHV9|RS17_FRATT 30S ribosomal protein S17 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rpsQ PE=3 SV=1 5 78 6.0E-08
sp|A0Q4J2|RS17_FRATN 30S ribosomal protein S17 OS=Francisella tularensis subsp. novicida (strain U112) GN=rpsQ PE=3 SV=1 5 78 6.0E-08
sp|B2SDX6|RS17_FRATM 30S ribosomal protein S17 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rpsQ PE=3 SV=1 5 78 6.0E-08
sp|Q14JB1|RS17_FRAT1 30S ribosomal protein S17 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rpsQ PE=3 SV=1 5 78 6.0E-08
sp|Q1QDH7|RS17_PSYCK 30S ribosomal protein S17 OS=Psychrobacter cryohalolentis (strain K5) GN=rpsQ PE=3 SV=1 5 79 6.0E-08
sp|A0ALV9|RS17_LISW6 30S ribosomal protein S17 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rpsQ PE=3 SV=1 16 81 6.0E-08
sp|Q927L6|RS17_LISMO 30S ribosomal protein S17 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpsQ PE=3 SV=1 16 81 6.0E-08
sp|B8DB17|RS17_LISMH 30S ribosomal protein S17 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rpsQ PE=3 SV=1 16 81 6.0E-08
sp|Q71WF5|RS17_LISMF 30S ribosomal protein S17 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpsQ PE=3 SV=1 16 81 6.0E-08
sp|C1KZH1|RS17_LISMC 30S ribosomal protein S17 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rpsQ PE=3 SV=1 16 81 6.0E-08
sp|Q7ANU5|RS17_LISIN 30S ribosomal protein S17 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rpsQ PE=3 SV=1 16 81 6.0E-08
sp|B6JEU2|RS17_OLICO 30S ribosomal protein S17 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rpsQ PE=3 SV=1 1 74 6.0E-08
sp|Q488A2|RS17_COLP3 30S ribosomal protein S17 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rpsQ PE=3 SV=1 6 78 6.0E-08
sp|B0K5Q2|RS17_THEPX 30S ribosomal protein S17 OS=Thermoanaerobacter sp. (strain X514) GN=rpsQ PE=3 SV=1 13 79 7.0E-08
sp|B0KCK9|RS17_THEP3 30S ribosomal protein S17 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpsQ PE=3 SV=1 13 79 7.0E-08
sp|Q74L80|RS17_LACJO 30S ribosomal protein S17 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rpsQ PE=3 SV=1 5 79 7.0E-08
sp|Q046B6|RS17_LACGA 30S ribosomal protein S17 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rpsQ PE=3 SV=1 5 79 7.0E-08
sp|Q1LTC9|RS17_BAUCH 30S ribosomal protein S17 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rpsQ PE=3 SV=1 5 83 7.0E-08
sp|Q67JV2|RS17_SYMTH 30S ribosomal protein S17 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rpsQ PE=3 SV=1 8 80 8.0E-08
sp|Q9CL40|RS17_PASMU 30S ribosomal protein S17 OS=Pasteurella multocida (strain Pm70) GN=rpsQ PE=3 SV=1 6 74 8.0E-08
sp|Q2JIL8|RS17_SYNJB 30S ribosomal protein S17 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=rpsQ PE=3 SV=1 8 80 8.0E-08
sp|B9DSV9|RS17_STRU0 30S ribosomal protein S17 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rpsQ PE=3 SV=1 13 80 9.0E-08
sp|Q2GH47|RS17_EHRCR 30S ribosomal protein S17 OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=rpsQ PE=3 SV=2 5 74 9.0E-08
sp|Q1R0G6|RS17_CHRSD 30S ribosomal protein S17 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rpsQ PE=3 SV=1 13 79 1.0E-07
sp|A1B036|RS17_PARDP 30S ribosomal protein S17 OS=Paracoccus denitrificans (strain Pd 1222) GN=rpsQ PE=3 SV=1 1 74 1.0E-07
sp|B5ELY8|RS17_ACIF5 30S ribosomal protein S17 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rpsQ PE=3 SV=1 3 84 1.0E-07
sp|B7J476|RS17_ACIF2 30S ribosomal protein S17 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rpsQ PE=3 SV=1 3 84 1.0E-07
sp|A6TEW3|RS17_KLEP7 30S ribosomal protein S17 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rpsQ PE=3 SV=1 6 79 1.0E-07
sp|Q15YN0|RS17_PSEA6 30S ribosomal protein S17 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rpsQ PE=3 SV=1 6 78 1.0E-07
sp|Q8DS22|RS17_STRMU 30S ribosomal protein S17 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rpsQ PE=3 SV=1 13 80 1.0E-07
sp|A8MLE9|RS17_ALKOO 30S ribosomal protein S17 OS=Alkaliphilus oremlandii (strain OhILAs) GN=rpsQ PE=3 SV=1 13 79 1.0E-07
sp|B0UX22|RS17_HISS2 30S ribosomal protein S17 OS=Histophilus somni (strain 2336) GN=rpsQ PE=3 SV=1 6 74 1.0E-07
sp|Q0I154|RS17_HAES1 30S ribosomal protein S17 OS=Haemophilus somnus (strain 129Pt) GN=rpsQ PE=3 SV=1 6 74 1.0E-07
sp|Q9Z9K5|RS17_BACHD 30S ribosomal protein S17 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpsQ PE=3 SV=1 13 80 1.0E-07
sp|A9NEE2|RS17_ACHLI 30S ribosomal protein S17 OS=Acholeplasma laidlawii (strain PG-8A) GN=rpsQ PE=3 SV=1 13 74 2.0E-07
sp|Q2JV90|RS17_SYNJA 30S ribosomal protein S17 OS=Synechococcus sp. (strain JA-3-3Ab) GN=rpsQ PE=3 SV=1 1 80 2.0E-07
sp|Q13TH9|RS17_BURXL 30S ribosomal protein S17 OS=Burkholderia xenovorans (strain LB400) GN=rpsQ PE=3 SV=1 13 80 2.0E-07
sp|B2T742|RS17_BURPP 30S ribosomal protein S17 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rpsQ PE=3 SV=1 13 80 2.0E-07
sp|A0T0Y2|RR17_THAPS 30S ribosomal protein S17, chloroplastic OS=Thalassiosira pseudonana GN=rps17 PE=3 SV=1 8 78 2.0E-07
sp|P44383|RS17_HAEIN 30S ribosomal protein S17 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rpsQ PE=3 SV=2 6 79 2.0E-07
sp|A5UHT9|RS17_HAEIG 30S ribosomal protein S17 OS=Haemophilus influenzae (strain PittGG) GN=rpsQ PE=3 SV=1 6 79 2.0E-07
sp|A5UDT8|RS17_HAEIE 30S ribosomal protein S17 OS=Haemophilus influenzae (strain PittEE) GN=rpsQ PE=3 SV=1 6 79 2.0E-07
sp|Q4QMB3|RS17_HAEI8 30S ribosomal protein S17 OS=Haemophilus influenzae (strain 86-028NP) GN=rpsQ PE=3 SV=1 6 79 2.0E-07
sp|C0ZII9|RS17_BREBN 30S ribosomal protein S17 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rpsQ PE=3 SV=1 13 80 2.0E-07
sp|Q5HAT1|RS17_EHRRW 30S ribosomal protein S17 OS=Ehrlichia ruminantium (strain Welgevonden) GN=rpsQ PE=3 SV=2 1 74 2.0E-07
sp|Q5FFU9|RS17_EHRRG 30S ribosomal protein S17 OS=Ehrlichia ruminantium (strain Gardel) GN=rpsQ PE=3 SV=1 1 74 2.0E-07
sp|B1I1J7|RS17_DESAP 30S ribosomal protein S17 OS=Desulforudis audaxviator (strain MP104C) GN=rpsQ PE=3 SV=1 13 79 2.0E-07
sp|Q5M2C2|RS17_STRT2 30S ribosomal protein S17 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rpsQ PE=3 SV=1 13 80 2.0E-07
sp|Q5LXS0|RS17_STRT1 30S ribosomal protein S17 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rpsQ PE=3 SV=1 13 80 2.0E-07
sp|Q5FM81|RS17_LACAC 30S ribosomal protein S17 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rpsQ PE=3 SV=1 5 79 2.0E-07
sp|Q6F7S1|RS17_ACIAD 30S ribosomal protein S17 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rpsQ PE=3 SV=1 13 79 2.0E-07
sp|C4K2H0|RS17_RICPU 30S ribosomal protein S17 OS=Rickettsia peacockii (strain Rustic) GN=rpsQ PE=3 SV=1 1 74 3.0E-07
sp|Q92GX5|RS17_RICCN 30S ribosomal protein S17 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rpsQ PE=3 SV=2 1 74 3.0E-07
sp|Q3YRL8|RS17_EHRCJ 30S ribosomal protein S17 OS=Ehrlichia canis (strain Jake) GN=rpsQ PE=3 SV=1 5 74 3.0E-07
sp|B0T2D1|RS17_CAUSK 30S ribosomal protein S17 OS=Caulobacter sp. (strain K31) GN=rpsQ PE=3 SV=1 1 74 3.0E-07
sp|Q6YR12|RS17_ONYPE 30S ribosomal protein S17 OS=Onion yellows phytoplasma (strain OY-M) GN=rpsQ PE=3 SV=1 16 78 3.0E-07
sp|Q2NIW3|RS17_AYWBP 30S ribosomal protein S17 OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=rpsQ PE=3 SV=1 16 78 3.0E-07
sp|Q68W87|RS17_RICTY 30S ribosomal protein S17 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rpsQ PE=3 SV=1 1 74 3.0E-07
sp|A8YXL4|RS17_LACH4 30S ribosomal protein S17 OS=Lactobacillus helveticus (strain DPC 4571) GN=rpsQ PE=3 SV=1 5 79 3.0E-07
sp|B5YG38|RS17_THEYD 30S ribosomal protein S17 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=rpsQ PE=3 SV=1 1 80 3.0E-07
sp|A2RNP6|RS17_LACLM 30S ribosomal protein S17 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rpsQ PE=3 SV=1 5 80 3.0E-07
sp|Q9CDX1|RS17_LACLA 30S ribosomal protein S17 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rpsQ PE=3 SV=1 5 80 3.0E-07
sp|A8M520|RS17_SALAI 30S ribosomal protein S17 OS=Salinispora arenicola (strain CNS-205) GN=rpsQ PE=3 SV=1 5 79 4.0E-07
sp|Q87T04|RS17_VIBPA 30S ribosomal protein S17 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rpsQ PE=3 SV=1 7 79 4.0E-07
sp|A2SLE8|RS17_METPP 30S ribosomal protein S17 OS=Methylibium petroleiphilum (strain PM1) GN=rpsQ PE=3 SV=1 18 79 4.0E-07
sp|A7HWS0|RS17_PARL1 30S ribosomal protein S17 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rpsQ PE=3 SV=1 1 74 4.0E-07
sp|B3R000|RS17_PHYMT 30S ribosomal protein S17 OS=Phytoplasma mali (strain AT) GN=rpsQ PE=3 SV=1 16 78 4.0E-07
sp|A8GT60|RS17_RICRS 30S ribosomal protein S17 OS=Rickettsia rickettsii (strain Sheila Smith) GN=rpsQ PE=3 SV=1 1 74 4.0E-07
sp|Q9A8U4|RS17_CAUCR 30S ribosomal protein S17 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rpsQ PE=3 SV=1 1 74 4.0E-07
sp|B8H4E3|RS17_CAUCN 30S ribosomal protein S17 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rpsQ PE=3 SV=1 1 74 4.0E-07
sp|Q6LVA7|RS17_PHOPR 30S ribosomal protein S17 OS=Photobacterium profundum GN=rpsQ PE=3 SV=1 13 79 4.0E-07
sp|Q85FV4|RR17_CYAME 30S ribosomal protein S17, chloroplastic OS=Cyanidioschyzon merolae GN=rps17 PE=3 SV=1 6 72 4.0E-07
sp|Q4FLM7|RS17_PELUB 30S ribosomal protein S17 OS=Pelagibacter ubique (strain HTCC1062) GN=rpsQ PE=3 SV=1 1 74 4.0E-07
sp|C3PP98|RS17_RICAE 30S ribosomal protein S17 OS=Rickettsia africae (strain ESF-5) GN=rpsQ PE=3 SV=1 1 74 5.0E-07
sp|Q4ZMQ3|RS17_PSEU2 30S ribosomal protein S17 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rpsQ PE=3 SV=1 13 79 5.0E-07
sp|Q889W2|RS17_PSESM 30S ribosomal protein S17 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rpsQ PE=3 SV=1 13 79 5.0E-07
sp|Q48D45|RS17_PSE14 30S ribosomal protein S17 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rpsQ PE=3 SV=1 13 79 5.0E-07
sp|C4KZN7|RS17_EXISA 30S ribosomal protein S17 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rpsQ PE=3 SV=1 13 74 5.0E-07
sp|B0BUQ1|RS17_RICRO 30S ribosomal protein S17 OS=Rickettsia rickettsii (strain Iowa) GN=rpsQ PE=3 SV=1 1 74 5.0E-07
sp|Q4UMS0|RS17_RICFE 30S ribosomal protein S17 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rpsQ PE=3 SV=1 1 74 5.0E-07
sp|Q1IX81|RS17_DEIGD 30S ribosomal protein S17 OS=Deinococcus geothermalis (strain DSM 11300) GN=rpsQ PE=3 SV=1 18 81 5.0E-07
sp|Q4A5D0|RS17_MYCS5 30S ribosomal protein S17 OS=Mycoplasma synoviae (strain 53) GN=rpsQ PE=3 SV=2 6 78 5.0E-07
sp|B0V6X7|RS17_ACIBY 30S ribosomal protein S17 OS=Acinetobacter baumannii (strain AYE) GN=rpsQ PE=3 SV=1 13 80 6.0E-07
sp|A3M975|RS17_ACIBT 30S ribosomal protein S17 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rpsQ PE=3 SV=1 13 80 6.0E-07
sp|B0VQS7|RS17_ACIBS 30S ribosomal protein S17 OS=Acinetobacter baumannii (strain SDF) GN=rpsQ PE=3 SV=1 13 80 6.0E-07
sp|B2HZ99|RS17_ACIBC 30S ribosomal protein S17 OS=Acinetobacter baumannii (strain ACICU) GN=rpsQ PE=3 SV=1 13 80 6.0E-07
sp|B7IA30|RS17_ACIB5 30S ribosomal protein S17 OS=Acinetobacter baumannii (strain AB0057) GN=rpsQ PE=3 SV=1 13 80 6.0E-07
sp|B7GW11|RS17_ACIB3 30S ribosomal protein S17 OS=Acinetobacter baumannii (strain AB307-0294) GN=rpsQ PE=3 SV=1 13 80 6.0E-07
sp|Q9L0D1|RS17_STRCO 30S ribosomal protein S17 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=rpsQ PE=3 SV=1 7 79 6.0E-07
sp|Q9ZCR4|RS17_RICPR 30S ribosomal protein S17 OS=Rickettsia prowazekii (strain Madrid E) GN=rpsQ PE=3 SV=1 1 74 6.0E-07
sp|A8GPE1|RS17_RICAH 30S ribosomal protein S17 OS=Rickettsia akari (strain Hartford) GN=rpsQ PE=3 SV=1 1 74 6.0E-07
sp|C6E4P8|RS17_GEOSM 30S ribosomal protein S17 OS=Geobacter sp. (strain M21) GN=rpsQ PE=3 SV=1 8 80 6.0E-07
sp|A4XBN7|RS17_SALTO 30S ribosomal protein S17 OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=rpsQ PE=3 SV=1 5 79 7.0E-07
sp|P51305|RR17_PORPU 30S ribosomal protein S17, chloroplastic OS=Porphyra purpurea GN=rps17 PE=3 SV=1 13 82 7.0E-07
sp|B3R7R4|RS17_CUPTR 30S ribosomal protein S17 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rpsQ PE=3 SV=1 13 80 7.0E-07
sp|Q0K628|RS17_CUPNH 30S ribosomal protein S17 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rpsQ PE=3 SV=1 13 80 7.0E-07
sp|Q7NEG1|RS17_GLOVI 30S ribosomal protein S17 OS=Gloeobacter violaceus (strain PCC 7421) GN=rpsQ PE=3 SV=1 8 78 7.0E-07
sp|B9MKH2|RS17_CALBD 30S ribosomal protein S17 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rpsQ PE=3 SV=1 8 79 7.0E-07
sp|B2IK71|RS17_BEII9 30S ribosomal protein S17 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rpsQ PE=3 SV=1 1 74 7.0E-07
sp|Q46WF3|RS17_CUPPJ 30S ribosomal protein S17 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rpsQ PE=3 SV=1 13 80 7.0E-07
sp|B5EFQ9|RS17_GEOBB 30S ribosomal protein S17 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=rpsQ PE=3 SV=1 8 80 8.0E-07
sp|A6LPS0|RS17_CLOB8 30S ribosomal protein S17 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rpsQ PE=3 SV=1 13 79 8.0E-07
sp|Q98PZ1|RS17_MYCPU 30S ribosomal protein S17 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rpsQ PE=3 SV=1 18 78 9.0E-07
sp|A7N0I6|RS17_VIBCB 30S ribosomal protein S17 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rpsQ PE=3 SV=1 7 79 9.0E-07
sp|B1W3Z8|RS17_STRGG 30S ribosomal protein S17 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=rpsQ PE=3 SV=1 7 79 9.0E-07
sp|Q1RHN0|RS17_RICBR 30S ribosomal protein S17 OS=Rickettsia bellii (strain RML369-C) GN=rpsQ PE=3 SV=1 1 74 9.0E-07
sp|A8GVC3|RS17_RICB8 30S ribosomal protein S17 OS=Rickettsia bellii (strain OSU 85-389) GN=rpsQ PE=3 SV=1 1 74 9.0E-07
sp|Q1LI46|RS17_CUPMC 30S ribosomal protein S17 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rpsQ PE=3 SV=1 13 80 9.0E-07
sp|Q98N48|RS17_RHILO 30S ribosomal protein S17 OS=Rhizobium loti (strain MAFF303099) GN=rpsQ PE=3 SV=1 1 74 9.0E-07
sp|A5EX90|RS17_DICNV 30S ribosomal protein S17 OS=Dichelobacter nodosus (strain VCS1703A) GN=rpsQ PE=3 SV=1 5 79 9.0E-07
sp|O24698|RS17_SYNP6 30S ribosomal protein S17 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rpsQ PE=3 SV=1 8 83 9.0E-07
sp|Q31L16|RS17_SYNE7 30S ribosomal protein S17 OS=Synechococcus elongatus (strain PCC 7942) GN=rpsQ PE=3 SV=1 8 83 9.0E-07
sp|Q3A9S5|RS17_CARHZ 30S ribosomal protein S17 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rpsQ PE=3 SV=1 13 79 1.0E-06
sp|Q18CG8|RS17_PEPD6 30S ribosomal protein S17 OS=Peptoclostridium difficile (strain 630) GN=rpsQ PE=3 SV=1 13 78 1.0E-06
sp|Q31IX3|RS17_THICR 30S ribosomal protein S17 OS=Thiomicrospira crunogena (strain XCL-2) GN=rpsQ PE=3 SV=1 6 77 1.0E-06
sp|A8EZK7|RS17_RICCK 30S ribosomal protein S17 OS=Rickettsia canadensis (strain McKiel) GN=rpsQ PE=3 SV=1 1 74 1.0E-06
sp|C1DKM2|RS17_AZOVD 30S ribosomal protein S17 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rpsQ PE=3 SV=1 13 74 1.0E-06
sp|Q46IR8|RS17_PROMT 30S ribosomal protein S17 OS=Prochlorococcus marinus (strain NATL2A) GN=rpsQ PE=3 SV=1 13 89 1.0E-06
sp|A2C4Z0|RS17_PROM1 30S ribosomal protein S17 OS=Prochlorococcus marinus (strain NATL1A) GN=rpsQ PE=3 SV=1 13 89 1.0E-06
sp|B8ELF4|RS17_METSB 30S ribosomal protein S17 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rpsQ PE=3 SV=1 1 74 1.0E-06
sp|Q493J9|RS17_BLOPB 30S ribosomal protein S17 OS=Blochmannia pennsylvanicus (strain BPEN) GN=rpsQ PE=3 SV=1 16 79 1.0E-06
sp|Q39XZ7|RS17_GEOMG 30S ribosomal protein S17 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rpsQ PE=3 SV=1 8 78 1.0E-06
sp|A1TYK6|RS17_MARHV 30S ribosomal protein S17 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rpsQ PE=3 SV=1 13 74 1.0E-06
sp|C5BQ70|RS17_TERTT 30S ribosomal protein S17 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=rpsQ PE=3 SV=1 13 77 1.0E-06
sp|Q89A75|RS17_BUCBP 30S ribosomal protein S17 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rpsQ PE=3 SV=1 13 79 1.0E-06
sp|A5N4Q6|RS17_CLOK5 30S ribosomal protein S17 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rpsQ PE=3 SV=1 8 79 1.0E-06
sp|B9DYB8|RS17_CLOK1 30S ribosomal protein S17 OS=Clostridium kluyveri (strain NBRC 12016) GN=rpsQ PE=3 SV=1 8 79 1.0E-06
sp|B4F1J3|RS17_PROMH 30S ribosomal protein S17 OS=Proteus mirabilis (strain HI4320) GN=rpsQ PE=3 SV=1 6 79 1.0E-06
sp|B1JDX5|RS17_PSEPW 30S ribosomal protein S17 OS=Pseudomonas putida (strain W619) GN=rpsQ PE=3 SV=1 13 79 2.0E-06
sp|B0KK76|RS17_PSEPG 30S ribosomal protein S17 OS=Pseudomonas putida (strain GB-1) GN=rpsQ PE=3 SV=1 13 79 2.0E-06
sp|Q1IFV7|RS17_PSEE4 30S ribosomal protein S17 OS=Pseudomonas entomophila (strain L48) GN=rpsQ PE=3 SV=1 13 79 2.0E-06
sp|Q11HR1|RS17_CHESB 30S ribosomal protein S17 OS=Chelativorans sp. (strain BNC1) GN=rpsQ PE=3 SV=1 1 74 2.0E-06
sp|Q1XDI3|RR17_PYRYE 30S ribosomal protein S17, chloroplastic OS=Pyropia yezoensis GN=rps17 PE=3 SV=1 13 82 2.0E-06
sp|Q5P323|RS17_AROAE 30S ribosomal protein S17 OS=Aromatoleum aromaticum (strain EbN1) GN=rpsQ PE=3 SV=1 13 79 2.0E-06
sp|O46903|RR17_GUITH 30S ribosomal protein S17, chloroplastic OS=Guillardia theta GN=rps17 PE=3 SV=1 8 77 2.0E-06
sp|A5WCJ9|RS17_PSYWF 30S ribosomal protein S17 OS=Psychrobacter sp. (strain PRwf-1) GN=rpsQ PE=3 SV=1 8 80 2.0E-06
sp|Q110B6|RS17_TRIEI 30S ribosomal protein S17 OS=Trichodesmium erythraeum (strain IMS101) GN=rpsQ PE=3 SV=1 8 80 2.0E-06
sp|C3LRP9|RS17_VIBCM 30S ribosomal protein S17 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rpsQ PE=3 SV=1 13 79 2.0E-06
sp|Q9KNZ3|RS17_VIBCH 30S ribosomal protein S17 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rpsQ PE=3 SV=1 13 79 2.0E-06
sp|A5F557|RS17_VIBC3 30S ribosomal protein S17 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rpsQ PE=3 SV=1 13 79 2.0E-06
sp|Q88QM6|RS17_PSEPK 30S ribosomal protein S17 OS=Pseudomonas putida (strain KT2440) GN=rpsQ PE=3 SV=1 13 79 2.0E-06
sp|A5VXQ6|RS17_PSEP1 30S ribosomal protein S17 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rpsQ PE=3 SV=1 13 79 2.0E-06
sp|Q8EUC2|RS17_MYCPE 30S ribosomal protein S17 OS=Mycoplasma penetrans (strain HF-2) GN=rpsQ PE=3 SV=1 5 79 2.0E-06
sp|Q03246|RT17_YEAST 37S ribosomal protein S17, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPS17 PE=1 SV=1 8 80 2.0E-06
sp|A7IFZ0|RS17_XANP2 30S ribosomal protein S17 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rpsQ PE=3 SV=1 1 74 2.0E-06
sp|B7VLE8|RS17_VIBTL 30S ribosomal protein S17 OS=Vibrio tasmaniensis (strain LGP32) GN=rpsQ PE=3 SV=1 5 79 2.0E-06
sp|Q2S921|RS17_HAHCH 30S ribosomal protein S17 OS=Hahella chejuensis (strain KCTC 2396) GN=rpsQ PE=3 SV=1 13 79 2.0E-06
sp|A9IW16|RS17_BART1 30S ribosomal protein S17 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rpsQ PE=3 SV=1 1 70 2.0E-06
sp|C3K2W7|RS17_PSEFS 30S ribosomal protein S17 OS=Pseudomonas fluorescens (strain SBW25) GN=rpsQ PE=3 SV=1 13 79 2.0E-06
sp|Q3K5Z7|RS17_PSEPF 30S ribosomal protein S17 OS=Pseudomonas fluorescens (strain Pf0-1) GN=rpsQ PE=3 SV=1 13 79 2.0E-06
sp|Q4K542|RS17_PSEF5 30S ribosomal protein S17 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rpsQ PE=3 SV=1 13 79 2.0E-06
sp|Q6MJ23|RS17_BDEBA 30S ribosomal protein S17 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rpsQ PE=3 SV=1 13 83 2.0E-06
sp|Q0BYC3|RS17_HYPNA 30S ribosomal protein S17 OS=Hyphomonas neptunium (strain ATCC 15444) GN=rpsQ PE=3 SV=1 1 74 3.0E-06
sp|Q38US1|RS17_LACSS 30S ribosomal protein S17 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rpsQ PE=3 SV=1 5 79 3.0E-06
sp|A1KB18|RS17_AZOSB 30S ribosomal protein S17 OS=Azoarcus sp. (strain BH72) GN=rpsQ PE=3 SV=1 13 79 3.0E-06
sp|B4R8M6|RS17_PHEZH 30S ribosomal protein S17 OS=Phenylobacterium zucineum (strain HLK1) GN=rpsQ PE=3 SV=1 1 74 3.0E-06
sp|B2TII4|RS17_CLOBB 30S ribosomal protein S17 OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=rpsQ PE=3 SV=1 13 78 3.0E-06
sp|Q7MPH9|RS17_VIBVY 30S ribosomal protein S17 OS=Vibrio vulnificus (strain YJ016) GN=rpsQ PE=3 SV=1 13 74 3.0E-06
sp|Q8DE48|RS17_VIBVU 30S ribosomal protein S17 OS=Vibrio vulnificus (strain CMCP6) GN=rpsQ PE=3 SV=1 13 74 3.0E-06
sp|B2UYB9|RS17_CLOBA 30S ribosomal protein S17 OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=rpsQ PE=3 SV=1 13 78 3.0E-06
sp|Q82DN6|RS17_STRAW 30S ribosomal protein S17 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=rpsQ PE=3 SV=1 7 79 3.0E-06
sp|Q47J94|RS17_DECAR 30S ribosomal protein S17 OS=Dechloromonas aromatica (strain RCB) GN=rpsQ PE=3 SV=1 13 79 3.0E-06
sp|Q7VGD5|RS17_HELHP 30S ribosomal protein S17 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=rpsQ PE=3 SV=1 5 78 3.0E-06
sp|Q8XV21|RS17_RALSO 30S ribosomal protein S17 OS=Ralstonia solanacearum (strain GMI1000) GN=rpsQ PE=3 SV=1 13 80 3.0E-06
sp|B2UEL0|RS17_RALPJ 30S ribosomal protein S17 OS=Ralstonia pickettii (strain 12J) GN=rpsQ PE=3 SV=1 13 80 3.0E-06
sp|Q0AII7|RS17_NITEC 30S ribosomal protein S17 OS=Nitrosomonas eutropha (strain C91) GN=rpsQ PE=3 SV=1 18 79 3.0E-06
sp|Q7MYG0|RS17_PHOLL 30S ribosomal protein S17 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rpsQ PE=3 SV=1 6 82 3.0E-06
sp|Q7V9X1|RS17_PROMA 30S ribosomal protein S17 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rpsQ PE=3 SV=1 13 86 3.0E-06
sp|B4SKX2|RS17_STRM5 30S ribosomal protein S17 OS=Stenotrophomonas maltophilia (strain R551-3) GN=rpsQ PE=3 SV=1 13 78 4.0E-06
sp|Q1ISB3|RS17_KORVE 30S ribosomal protein S17 OS=Koribacter versatilis (strain Ellin345) GN=rpsQ PE=3 SV=1 6 79 4.0E-06
sp|A5IYX7|RS17_MYCAP 30S ribosomal protein S17 OS=Mycoplasma agalactiae (strain PG2) GN=rpsQ PE=3 SV=1 6 74 4.0E-06
sp|Q8R7W3|RS17_CALS4 30S ribosomal protein S17 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpsQ PE=3 SV=1 13 79 4.0E-06
sp|B2FQJ3|RS17_STRMK 30S ribosomal protein S17 OS=Stenotrophomonas maltophilia (strain K279a) GN=rpsQ PE=3 SV=1 13 78 5.0E-06
sp|Q6AD04|RS17_LEIXX 30S ribosomal protein S17 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=rpsQ PE=3 SV=1 13 79 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0003735 structural constituent of ribosome Yes
GO:0009059 macromolecule biosynthetic process No
GO:0009058 biosynthetic process No
GO:0043226 organelle No
GO:0019538 protein metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044238 primary metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0008152 metabolic process No
GO:0043228 non-membrane-bounded organelle No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0043043 peptide biosynthetic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006518 peptide metabolic process No
GO:0043604 amide biosynthetic process No
GO:0110165 cellular anatomical entity No
GO:0043603 cellular amide metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0005198 structural molecule activity No
GO:1901566 organonitrogen compound biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|009710
MPPMILQGIVTKSGFMRKTATVTVTRWVVHKITGKRIQRSRKFLVHDEQNKLRQDDLITIQNCPPVSAKKRFTLK
HILKSPFAERELSRARFAEGNATPSTSASSGAQAA*
Coding >Agabi119p4|009710
ATGCCGCCCATGATCCTCCAAGGAATCGTCACAAAATCAGGCTTTATGAGAAAAACAGCTACAGTGACAGTAACG
CGATGGGTTGTTCACAAAATTACTGGAAAGCGTATACAACGCAGTAGAAAGTTTTTGGTCCACGACGAACAAAAT
AAACTGCGGCAAGACGACTTGATAACTATTCAAAATTGTCCCCCGGTTTCTGCGAAAAAACGGTTCACCCTCAAA
CATATTCTTAAGAGCCCTTTCGCGGAGCGTGAACTGTCTCGAGCACGTTTTGCAGAAGGAAATGCAACTCCTAGT
ACTTCGGCGTCAAGCGGGGCTCAAGCAGCATGA
Transcript >Agabi119p4|009710
ATGCCGCCCATGATCCTCCAAGGAATCGTCACAAAATCAGGCTTTATGAGAAAAACAGCTACAGTGACAGTAACG
CGATGGGTTGTTCACAAAATTACTGGAAAGCGTATACAACGCAGTAGAAAGTTTTTGGTCCACGACGAACAAAAT
AAACTGCGGCAAGACGACTTGATAACTATTCAAAATTGTCCCCCGGTTTCTGCGAAAAAACGGTTCACCCTCAAA
CATATTCTTAAGAGCCCTTTCGCGGAGCGTGAACTGTCTCGAGCACGTTTTGCAGAAGGAAATGCAACTCCTAGT
ACTTCGGCGTCAAGCGGGGCTCAAGCAGCATGA
Gene >Agabi119p4|009710
ATGCCGCCCATGATCCTCCAAGGAATCGTCACAAAATCAGGCTTTATGAGAAAAACAGCTACAGTGACAGTAACG
CGATGGGTTGTTCACAAAATTACTGGAAAGGTGCGTCGCAGAGTTATTGCTTGGACCAAGAATCTAAAACTCTGA
ACAGCGTATACAACGCAGTAGAAAGTTTTTGGTCCACGACGAACAAAATAGTATGTCGTCATACTGAGTGTCCGT
TATTTCTAAAAATTTGACAACTTGACAGAACTGCGGCAAGACGACTTGATAACTATTCAAAATTGTCCCCCGGTT
TCTGCGAAAAAACGGTTCACCCTCAAACATATTCTTAAGAGCCCTTTCGCGGAGCGTGAACTGTCTCGAGCACGT
TTTGCAGAAGGAAATGCAACTCCTAGTACTTCGGCGTCAAGCGGGGCTCAAGCAGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail