Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|009610
Gene name
Locationscaffold_01a:2257078..2260372
Strand-
Gene length (bp)3294
Transcript length (bp)2895
Coding sequence length (bp)2895
Protein length (aa) 965

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13886 DUF4203 Domain of unknown function (DUF4203) 2.0E-54 114 325

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 112 131 19
2 138 160 22
3 170 192 22
4 199 221 22
5 225 244 19
6 251 273 22
7 306 328 22
8 911 933 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|009610
MRILLPLLALCGLAAAQSSTTGAQQSSQQPSQQSTTFPVSVALTTASTTITTTTRSNGVNTQIVTVLPTIFNVTR
TLTPTSTSATVSAAADSTSSSPSPAPIVLDTRIDPAFGVLGAILILTGLPSTFWGHKNRWTSFFLIGFYTLSLVC
AVLIIRYGVVPAINPPSNTLRGMFVLASVIAGVAGGGIAIFFWKAARYGIGAWGGLALGFWIECFHNGGLIKPVG
YRWILYIALAVLGFTLSTIPKIHYHVLLISTAIVGSSAFILGVDCYTTAGLKEFYMWNLGFQSLFPKFTENQIQF
PVSQTMQIELGLIGAIALMGTAVQLRILRVLKKKLMEIAEESRKRDEEAELHAASQFTTITQEKEAWMKEHPTLG
KQPRQDSMFSSLPLLKDQDGSSSPTTLTDEGRQRHVSGLSDFKVAPVPEDDFRRSRMSQTPGVLPSLDLGLGIQD
DVPSSFIAEAKEKPKLKDMSLQELQAIKKKEELLVEIQNIRKSIEVLKSEPGPSSASQSRRPSMTSRRTLSIDAS
TALLPAAHPHTRPPREADPRARAHSMEFSSLVHAHSPPVGALSESPSRPTSVPVKDPDWDAYIHERKLLQPPSGV
TPPISTSLGHRGSMSAAVQEALESRKRRESLLVTSSGSGTPIGSSGGEEMDDVPLSKIVSDKRHSGLGGVTGFGN
LGYAPAPKDKDPAVTILPPRKSPAGNVQAPAPQRVSSKAPAVKTFEELNDRHREKMRNLQEPLTKAEKESADVRN
AKERWEKAKRVEKESMLRKQAEKVAALEKKEQGHHRGRSGGQSGRARDIDGAGDAAGRNRHSRSLSADRLGFAGA
GNSSKRLSVLKVEDWQEYQATNSSGARDSSTGEFGVKKRDSSVPFPPHSRSRGPAGVFLLEEWDLDILPKYFWPF
HAGGRTQCSPLLCVLFFLPPLFFLIAMLPLSICAPIPMYDYSYCLSHSKPSRFYTTFVLFWHLT*
Coding >Agabi119p4|009610
ATGAGGATCTTGCTCCCCCTCCTCGCCCTCTGTGGTCTCGCTGCCGCTCAGTCCTCGACGACTGGCGCCCAGCAA
TCCTCCCAACAGCCCTCCCAGCAGTCCACCACCTTCCCCGTCTCCGTCGCACTCACTACTGCCTCAACCACCATC
ACCACTACCACTCGTTCAAATGGTGTCAACACTCAGATCGTGACTGTCCTACCAACCATCTTCAACGTGACCCGC
ACCCTCACGCCCACCTCAACGTCCGCCACAGTTTCGGCAGCTGCCGATTCAACCTCCAGCTCTCCGTCGCCTGCC
CCAATCGTCCTCGATACCCGCATTGACCCGGCTTTTGGCGTGCTCGGAGCTATTCTCATCCTTACCGGTCTCCCT
TCAACTTTCTGGGGTCACAAAAATCGTTGGACATCGTTTTTTCTCATTGGCTTCTACACACTTTCCCTTGTCTGT
GCCGTCCTCATTATCCGCTATGGTGTTGTACCAGCTATCAATCCCCCATCAAACACCCTTCGCGGCATGTTTGTC
CTTGCAAGCGTCATAGCCGGAGTTGCCGGGGGCGGCATTGCCATTTTTTTCTGGAAAGCTGCAAGGTATGGTATC
GGTGCCTGGGGAGGTCTTGCCCTCGGCTTCTGGATCGAATGTTTCCACAACGGTGGTCTCATTAAACCTGTTGGT
TACCGATGGATTTTGTACATCGCCTTAGCGGTCTTAGGTTTTACGTTGAGCACCATCCCAAAGATCCATTATCAT
GTCCTTCTCATTTCCACGGCAATCGTTGGCTCCTCTGCTTTTATACTGGGGGTGGACTGCTACACCACCGCTGGC
CTTAAGGAGTTCTATATGTGGAACTTGGGATTTCAATCTCTCTTTCCAAAATTCACCGAGAACCAGATACAGTTT
CCGGTATCCCAGACCATGCAGATTGAACTTGGCCTCATTGGTGCTATTGCCCTCATGGGAACCGCTGTCCAACTT
CGTATTCTAAGGGTTCTGAAGAAAAAACTCATGGAAATTGCTGAGGAAAGCCGGAAACGGGATGAAGAGGCCGAG
CTACACGCCGCCAGTCAGTTCACAACTATCACGCAAGAGAAGGAGGCCTGGATGAAGGAGCACCCCACGTTAGGC
AAACAACCTAGACAAGACAGCATGTTTTCTTCCCTGCCTTTGTTGAAAGATCAAGATGGCTCTTCCTCTCCCACA
ACTCTCACCGATGAAGGTCGGCAACGCCACGTGTCAGGGCTATCTGATTTCAAAGTTGCACCGGTCCCAGAAGAT
GATTTCCGTCGCTCACGCATGTCTCAAACGCCGGGGGTATTGCCTTCTCTGGACCTTGGGCTTGGTATTCAGGAT
GATGTTCCCTCCAGTTTTATCGCCGAGGCGAAAGAGAAACCGAAGTTGAAGGATATGAGCCTGCAGGAACTTCAA
GCCATAAAGAAAAAAGAAGAGTTACTCGTTGAAATTCAAAATATTCGCAAGTCAATTGAAGTCTTAAAATCGGAA
CCAGGACCATCCTCAGCAAGTCAATCAAGAAGGCCTTCAATGACCTCAAGACGCACTTTGAGTATTGATGCATCC
ACAGCTCTTTTGCCAGCTGCTCATCCACACACCCGTCCACCTAGGGAGGCGGACCCTCGTGCTCGCGCACACTCG
ATGGAATTTTCGTCGCTTGTTCATGCACATAGTCCACCGGTAGGAGCCCTGAGTGAATCTCCATCAAGACCGACC
AGTGTACCCGTGAAGGACCCCGACTGGGATGCATATATTCACGAACGCAAGTTGTTACAACCTCCGTCTGGTGTC
ACTCCTCCTATTTCGACATCACTAGGTCATCGCGGTTCCATGTCCGCGGCTGTGCAAGAAGCTTTGGAGAGCAGG
AAAAGGAGGGAGAGCTTGTTGGTCACCAGCAGCGGGAGTGGAACGCCAATCGGGAGTTCAGGTGGAGAGGAAATG
GACGATGTACCTCTGTCGAAAATCGTCTCCGATAAGAGACATTCTGGATTGGGAGGCGTCACTGGCTTTGGCAAC
TTGGGATATGCCCCGGCGCCGAAGGATAAGGATCCCGCCGTCACGATCTTGCCTCCCCGAAAATCACCTGCTGGA
AACGTACAGGCGCCTGCGCCCCAGCGTGTATCATCTAAAGCTCCTGCTGTAAAGACGTTCGAGGAGCTAAATGAC
AGACATCGGGAGAAAATGAGAAATCTACAAGAGCCTCTGACAAAAGCAGAGAAGGAGAGCGCGGATGTGAGGAAC
GCAAAAGAAAGATGGGAGAAGGCGAAGAGGGTTGAGAAGGAATCGATGCTACGAAAGCAGGCAGAGAAAGTTGCT
GCGCTAGAGAAGAAGGAGCAAGGGCACCATCGCGGTCGCAGTGGCGGTCAGTCGGGGAGGGCAAGGGATATTGAT
GGTGCTGGCGATGCGGCTGGTCGGAACAGGCATTCGAGATCCTTGAGCGCAGATAGGCTTGGTTTCGCTGGTGCA
GGTAACTCGTCCAAAAGGTTGTCGGTACTGAAGGTCGAGGACTGGCAGGAATATCAGGCCACTAACAGTAGTGGT
GCCAGGGATTCTAGTACAGGCGAATTTGGAGTCAAAAAGAGGGATTCGTCTGTACCGTTCCCTCCCCACTCGCGG
TCTAGGGGGCCAGCTGGCGTATTTCTGCTTGAAGAGTGGGATTTGGATATCCTCCCTAAATATTTCTGGCCATTC
CATGCAGGTGGGAGAACGCAGTGCAGCCCTTTGCTTTGCGTACTATTTTTTTTACCCCCTCTATTTTTCCTCATC
GCTATGCTTCCTCTATCCATATGTGCCCCCATACCCATGTACGACTACTCTTATTGCCTTTCGCACTCCAAGCCA
TCACGCTTCTACACCACCTTCGTTCTATTTTGGCATTTGACATAA
Transcript >Agabi119p4|009610
ATGAGGATCTTGCTCCCCCTCCTCGCCCTCTGTGGTCTCGCTGCCGCTCAGTCCTCGACGACTGGCGCCCAGCAA
TCCTCCCAACAGCCCTCCCAGCAGTCCACCACCTTCCCCGTCTCCGTCGCACTCACTACTGCCTCAACCACCATC
ACCACTACCACTCGTTCAAATGGTGTCAACACTCAGATCGTGACTGTCCTACCAACCATCTTCAACGTGACCCGC
ACCCTCACGCCCACCTCAACGTCCGCCACAGTTTCGGCAGCTGCCGATTCAACCTCCAGCTCTCCGTCGCCTGCC
CCAATCGTCCTCGATACCCGCATTGACCCGGCTTTTGGCGTGCTCGGAGCTATTCTCATCCTTACCGGTCTCCCT
TCAACTTTCTGGGGTCACAAAAATCGTTGGACATCGTTTTTTCTCATTGGCTTCTACACACTTTCCCTTGTCTGT
GCCGTCCTCATTATCCGCTATGGTGTTGTACCAGCTATCAATCCCCCATCAAACACCCTTCGCGGCATGTTTGTC
CTTGCAAGCGTCATAGCCGGAGTTGCCGGGGGCGGCATTGCCATTTTTTTCTGGAAAGCTGCAAGGTATGGTATC
GGTGCCTGGGGAGGTCTTGCCCTCGGCTTCTGGATCGAATGTTTCCACAACGGTGGTCTCATTAAACCTGTTGGT
TACCGATGGATTTTGTACATCGCCTTAGCGGTCTTAGGTTTTACGTTGAGCACCATCCCAAAGATCCATTATCAT
GTCCTTCTCATTTCCACGGCAATCGTTGGCTCCTCTGCTTTTATACTGGGGGTGGACTGCTACACCACCGCTGGC
CTTAAGGAGTTCTATATGTGGAACTTGGGATTTCAATCTCTCTTTCCAAAATTCACCGAGAACCAGATACAGTTT
CCGGTATCCCAGACCATGCAGATTGAACTTGGCCTCATTGGTGCTATTGCCCTCATGGGAACCGCTGTCCAACTT
CGTATTCTAAGGGTTCTGAAGAAAAAACTCATGGAAATTGCTGAGGAAAGCCGGAAACGGGATGAAGAGGCCGAG
CTACACGCCGCCAGTCAGTTCACAACTATCACGCAAGAGAAGGAGGCCTGGATGAAGGAGCACCCCACGTTAGGC
AAACAACCTAGACAAGACAGCATGTTTTCTTCCCTGCCTTTGTTGAAAGATCAAGATGGCTCTTCCTCTCCCACA
ACTCTCACCGATGAAGGTCGGCAACGCCACGTGTCAGGGCTATCTGATTTCAAAGTTGCACCGGTCCCAGAAGAT
GATTTCCGTCGCTCACGCATGTCTCAAACGCCGGGGGTATTGCCTTCTCTGGACCTTGGGCTTGGTATTCAGGAT
GATGTTCCCTCCAGTTTTATCGCCGAGGCGAAAGAGAAACCGAAGTTGAAGGATATGAGCCTGCAGGAACTTCAA
GCCATAAAGAAAAAAGAAGAGTTACTCGTTGAAATTCAAAATATTCGCAAGTCAATTGAAGTCTTAAAATCGGAA
CCAGGACCATCCTCAGCAAGTCAATCAAGAAGGCCTTCAATGACCTCAAGACGCACTTTGAGTATTGATGCATCC
ACAGCTCTTTTGCCAGCTGCTCATCCACACACCCGTCCACCTAGGGAGGCGGACCCTCGTGCTCGCGCACACTCG
ATGGAATTTTCGTCGCTTGTTCATGCACATAGTCCACCGGTAGGAGCCCTGAGTGAATCTCCATCAAGACCGACC
AGTGTACCCGTGAAGGACCCCGACTGGGATGCATATATTCACGAACGCAAGTTGTTACAACCTCCGTCTGGTGTC
ACTCCTCCTATTTCGACATCACTAGGTCATCGCGGTTCCATGTCCGCGGCTGTGCAAGAAGCTTTGGAGAGCAGG
AAAAGGAGGGAGAGCTTGTTGGTCACCAGCAGCGGGAGTGGAACGCCAATCGGGAGTTCAGGTGGAGAGGAAATG
GACGATGTACCTCTGTCGAAAATCGTCTCCGATAAGAGACATTCTGGATTGGGAGGCGTCACTGGCTTTGGCAAC
TTGGGATATGCCCCGGCGCCGAAGGATAAGGATCCCGCCGTCACGATCTTGCCTCCCCGAAAATCACCTGCTGGA
AACGTACAGGCGCCTGCGCCCCAGCGTGTATCATCTAAAGCTCCTGCTGTAAAGACGTTCGAGGAGCTAAATGAC
AGACATCGGGAGAAAATGAGAAATCTACAAGAGCCTCTGACAAAAGCAGAGAAGGAGAGCGCGGATGTGAGGAAC
GCAAAAGAAAGATGGGAGAAGGCGAAGAGGGTTGAGAAGGAATCGATGCTACGAAAGCAGGCAGAGAAAGTTGCT
GCGCTAGAGAAGAAGGAGCAAGGGCACCATCGCGGTCGCAGTGGCGGTCAGTCGGGGAGGGCAAGGGATATTGAT
GGTGCTGGCGATGCGGCTGGTCGGAACAGGCATTCGAGATCCTTGAGCGCAGATAGGCTTGGTTTCGCTGGTGCA
GGTAACTCGTCCAAAAGGTTGTCGGTACTGAAGGTCGAGGACTGGCAGGAATATCAGGCCACTAACAGTAGTGGT
GCCAGGGATTCTAGTACAGGCGAATTTGGAGTCAAAAAGAGGGATTCGTCTGTACCGTTCCCTCCCCACTCGCGG
TCTAGGGGGCCAGCTGGCGTATTTCTGCTTGAAGAGTGGGATTTGGATATCCTCCCTAAATATTTCTGGCCATTC
CATGCAGGTGGGAGAACGCAGTGCAGCCCTTTGCTTTGCGTACTATTTTTTTTACCCCCTCTATTTTTCCTCATC
GCTATGCTTCCTCTATCCATATGTGCCCCCATACCCATGTACGACTACTCTTATTGCCTTTCGCACTCCAAGCCA
TCACGCTTCTACACCACCTTCGTTCTATTTTGGCATTTGACATAA
Gene >Agabi119p4|009610
ATGAGGATCTTGCTCCCCCTCCTCGCCCTCTGTGGTCTCGCTGCCGCTCAGTCCTCGACGACTGGCGCCCAGCAA
TCCTCCCAACAGCCCTCCCAGCAGTCCACCACCTTCCCCGTCTCCGTCGCACTCACTACTGCCTCAACCACCATC
ACCACTACCACTCGTTCAAATGGTGTCAACACTCAGATCGTGACTGTCCTACCAACCATCTTCAACGTGACCCGC
ACCCTCACGCCCACCTCAACGTCCGCCACAGTTTCGGCAGCTGCCGATTCAACCTCCAGCTCTCCGTCGCCTGCC
CCAATCGTCCTCGTGCGTACCGCTTGATCCATACGTATTGTCCCCATTCATTTTTTTCAGGATACCCGCATTGAC
CCGGCTTTTGGCGTGCTCGGAGCTATTCTCATCCTTACCGGTCTCCCTTCAACTTTCTGGGGTCACAAAAATCGT
TGGTAGGCAACTCGATCAATTATGAATGAACTTCATTTGACAAGCGACTCGACAGGACATCGTTTTTTCTCATTG
GCTTCTACACACTTTCCCTTGTCTGTGCCGTCCTCATTATCCGCTATGGTGTTGTACCAGCTATCAATCCCCCAT
CAAACACCCTTCGCGGCATGTTTGTCCTTGCAAGCGTCATAGCCGGAGTTGCCGGGGGCGGCATTGCCATTTTTT
TCTGGAAAGCTGCAAGGTATGGTATCGGTGCCTGGGGAGGTCTTGCCCTCGGCTTCTGGATCGAATGTTTCCACA
ACGGTGGTCTCATTAAACCTGTTGGTTACCGATGGATTTTGTACATCGGCAAGTCATTTCATTTCTGACCACTTA
CCCAACAACATCCAGCCCTAATTCATTCATCAACCAGCCTTAGCGGTCTTAGGTTTTACGTTGAGCACCATCCCA
AAGGTGAGCTTATTCTTCTCCTCACTTCAAGCCGCCTCCCCGTGACCGGACAATGAATTAGATCCATTATCATGT
CCTTCTCATTTCCACGGCAATCGTTGGCTCCTCTGCTTTTATACTGGGGGTGGACTGCTACACCACCGCTGGCCT
TAAGGAGGTGAGATTACTTATTGAACCTGTTGCAATTCGGGATGTTCATAATTTGTATAGTTCTATATGTGGAAC
TTGGGATTTCAATCTCTCTTTCCAAAATTCACCGAGAACCAGATACAGTTTCCGGTATCCCAGACCATGCAGATT
GAACTTGGCCTCATTGGTGCTATTGCCCTCATGGGAACCGCTGTCCAACTTCGTATTCTAAGGGTTCTGAAGAAA
AAACTCATGGAAATTGCTGAGGAAAGCCGGAAACGGGATGAAGAGGCCGAGCTACACGCCGCCAGTCAGTTCACA
ACTATCACGCAAGAGAAGGAGGCCTGGATGAAGGAGCACCCCACGTTAGGCAAACAACCTAGACAAGACAGCATG
TTTTCTTCCCTGCCTTTGTTGAAAGATCAAGATGGCTCTTCCTCTCCCACAACTCTCACCGATGAAGGTCGGCAA
CGCCACGTGTCAGGGCTATCTGATTTCAAAGTTGCACCGGTCCCAGAAGATGATTTCCGTCGCTCACGCATGTCT
CAAACGCCGGGGGTATTGCCTTCTCTGGACCTTGGGCTTGGTATTCAGGATGATGTTCCCTCCAGTTTTATCGCC
GAGGCGAAAGAGAAACCGAAGTTGAAGGATATGAGCCTGCAGGAACTTCAAGCCATAAAGAAAAAAGAAGAGTTA
CTCGTTGAAATTCAAAATATTCGCAAGTCAATTGAAGTCTTAAAATCGGAACCAGGACCATCCTCAGCAAGTCAA
TCAAGAAGGCCTTCAATGACCTCAAGACGCACTTTGAGTATTGATGCATCCACAGCTCTTTTGCCAGCTGCTCAT
CCACACACCCGTCCACCTAGGGAGGCGGACCCTCGTGCTCGCGCACACTCGATGGAATTTTCGTCGCTTGTTCAT
GCACATAGTCCACCGGTAGGAGCCCTGAGTGAATCTCCATCAAGACCGACCAGTGTACCCGTGAAGGACCCCGAC
TGGGATGCATATATTCACGAACGCAAGTTGTTACAACCTCCGTCTGGTGTCACTCCTCCTATTTCGACATCACTA
GGTCATCGCGGTTCCATGTCCGCGGCTGTGCAAGAAGCTTTGGAGAGCAGGAAAAGGAGGGAGAGCTTGTTGGTC
ACCAGCAGCGGGAGTGGAACGCCAATCGGGAGTTCAGGTGGAGAGGAAATGGACGATGTACCTCTGTCGAAAATC
GTCTCCGATAAGAGACATTCTGGATTGGGAGGCGTCACTGGCTTTGGCAACTTGGGATATGCCCCGGCGCCGAAG
GATAAGGATCCCGCCGTCACGATCTTGCCTCCCCGAAAATCACCTGCTGGAAACGTACAGGCGCCTGCGCCCCAG
CGTGTATCATCTAAAGCTCCTGCTGTAAAGACGTTCGAGGAGCTAAATGACAGACATCGGGAGAAAATGAGAAAT
CTACAAGAGCCTCTGACAAAAGCAGAGAAGGAGAGCGCGGATGTGAGGAACGCAAAAGAAAGATGGGAGAAGGCG
AAGAGGGTTGAGAAGGAATCGATGCTACGAAAGCAGGCAGAGAAAGTTGCTGCGCTAGAGAAGAAGGAGCAAGGG
CACCATCGCGGTCGCAGTGGCGGTCAGTCGGGGAGGGCAAGGGATATTGATGGTGCTGGCGATGCGGCTGGTCGG
AACAGGCATTCGAGATCCTTGAGCGCAGATAGGCTTGGTTTCGCTGGTGCAGGTAACTCGTCCAAAAGGTTGTCG
GTACTGAAGGTCGAGGACTGGCAGGAATATCAGGCCACTAACAGTAGTGGTGCCAGGGATTCTAGTACAGGCGAA
TTTGGAGTCAAAAAGAGGGATTCGTCTGTACCGTTCCCTCCCCACTCGCGGTCTAGGGGGCCAGCTGGTAGACGG
AGTCAGGAAGTGCCGAAGAGGGAAGGAGATTGGAGAAAAAGCAAAGATTATTTGACCTAAGGCGTATTTCTGCTT
GAAGAGTGGGATTTGGGTATGTTGACCAGCTAGCTATTCTTGACGCCGATTTTATCGACTTTCCTATCAGATATC
CTCCCTAAATATTTCTGGCCATTCCATGCAGGTGGGAGAACGCAGTGCAGCCCTTTGCTTTGCGTACTATTTTTT
TTACCCCCTCTATTTTTCCTCATCGCTATGCTTCCTCTATCCATATGTGCCCCCATACCCATGTACGACTACTCT
TATTGCCTTTCGCACTCCAAGCCATCACGCTTCTACACCACCTTCGTTCTATTTTGGCATTTGACATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail