Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|009260
Gene name
Locationscaffold_01a:2171307..2173173
Strand-
Gene length (bp)1866
Transcript length (bp)1563
Coding sequence length (bp)1563
Protein length (aa) 521

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07156 Prenylcys_lyase Prenylcysteine lyase 4.0E-62 158 489
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.7E-09 53 124
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 1.1E-06 73 326

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P57681|PCYOX_ARATH Farnesylcysteine lyase OS=Arabidopsis thaliana GN=FLCY PE=1 SV=1 40 487 2.0E-45
sp|Q9CQF9|PCYOX_MOUSE Prenylcysteine oxidase OS=Mus musculus GN=Pcyox1 PE=1 SV=1 45 481 4.0E-27
sp|Q95KC9|PCYOX_MACFA Prenylcysteine oxidase OS=Macaca fascicularis GN=PCYOX1 PE=2 SV=1 45 481 2.0E-25
sp|Q99ML5|PCYOX_RAT Prenylcysteine oxidase OS=Rattus norvegicus GN=Pcyox1 PE=1 SV=1 45 481 3.0E-23
sp|Q9UHG3|PCYOX_HUMAN Prenylcysteine oxidase 1 OS=Homo sapiens GN=PCYOX1 PE=1 SV=3 61 481 3.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P57681|PCYOX_ARATH Farnesylcysteine lyase OS=Arabidopsis thaliana GN=FLCY PE=1 SV=1 40 487 2.0E-45
sp|Q9CQF9|PCYOX_MOUSE Prenylcysteine oxidase OS=Mus musculus GN=Pcyox1 PE=1 SV=1 45 481 4.0E-27
sp|Q95KC9|PCYOX_MACFA Prenylcysteine oxidase OS=Macaca fascicularis GN=PCYOX1 PE=2 SV=1 45 481 2.0E-25
sp|Q99ML5|PCYOX_RAT Prenylcysteine oxidase OS=Rattus norvegicus GN=Pcyox1 PE=1 SV=1 45 481 3.0E-23
sp|Q9UHG3|PCYOX_HUMAN Prenylcysteine oxidase 1 OS=Homo sapiens GN=PCYOX1 PE=1 SV=3 61 481 3.0E-20
sp|Q5R748|PCYOX_PONAB Prenylcysteine oxidase OS=Pongo abelii GN=PCYOX1 PE=2 SV=1 61 481 7.0E-20
sp|Q0P5H1|PCYXL_BOVIN Prenylcysteine oxidase-like OS=Bos taurus GN=PCYOX1L PE=2 SV=1 50 488 3.0E-18
sp|Q8NBM8|PCYXL_HUMAN Prenylcysteine oxidase-like OS=Homo sapiens GN=PCYOX1L PE=1 SV=2 50 485 5.0E-17
sp|Q8C7K6|PCYXL_MOUSE Prenylcysteine oxidase-like OS=Mus musculus GN=Pcyox1l PE=1 SV=1 43 485 9.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0016670 oxidoreductase activity, acting on a sulfur group of donors, oxygen as acceptor Yes
GO:0016491 oxidoreductase activity Yes
GO:0030328 prenylcysteine catabolic process Yes
GO:0006575 cellular modified amino acid metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No
GO:0042219 cellular modified amino acid catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0009056 catabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:1901575 organic substance catabolic process No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0030329 prenylcysteine metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|009260
MRYAALLLLATSVYAFEIPFFVPDFLKNHVLPPSTPIVEVKDDPPPTVPRIAIVGAGAGGSSAAFWISKAKSRFG
LDVEVDVYDRNNYIGGRSTVVHPYNDTTLPELELGASIFVRANKNLWRASEEFNLTRRDFTEENYVVGLWDGQDV
RFTFEGGWWGTLKVLWRYGMTSPKRVQGIVAEMLKTYVGLYSKDTPKWNNITRLSEKYGWTELTASSTMEYLVRK
NVSPRYISELVEAATRTNYGQNTDYIHALEGMCSLATDGAAGISGGNYRIFEQFLQRSDAFVHLNANVNSILPST
DSKNWTVATSKGTQDYAAVILAAPFHFTDITVPHSISEQISNHPYVHLHVTLLTTTSEYPNPAYFNLPSSSKPAR
MMLTTYEGVRHGGLEPEFNSLSYHGLVRPGEWAVKIFSKSRISDQLLDSIFNGQVQWVYRKEWDSYPKLPPMESY
PPVKLGQGFYYVNSFEPFISTMETETLSSRNIVDLLLDDLFNASICGPQITELTNITTTDKNDYVYGWDC*
Coding >Agabi119p4|009260
ATGAGGTATGCGGCATTGTTATTGCTTGCTACCAGCGTATACGCCTTCGAGATACCCTTCTTTGTTCCTGACTTC
CTAAAGAATCACGTTTTACCCCCGTCTACGCCCATAGTTGAAGTCAAAGACGACCCTCCCCCCACGGTTCCTAGG
ATAGCGATTGTTGGCGCCGGTGCCGGAGGCAGCTCAGCGGCGTTTTGGATATCCAAAGCCAAATCCCGCTTTGGC
CTAGATGTCGAAGTTGATGTTTACGACCGAAACAACTACATCGGTGGACGGTCCACTGTCGTCCATCCTTATAAT
GATACAACTCTCCCAGAGTTAGAATTGGGGGCGTCTATATTTGTTCGAGCAAACAAGAACCTCTGGCGAGCATCA
GAAGAGTTCAATCTGACCCGCCGGGATTTCACAGAGGAGAACTATGTGGTTGGCTTGTGGGATGGTCAGGATGTT
AGATTTACGTTTGAAGGAGGCTGGTGGGGAACTCTCAAAGTACTTTGGCGTTATGGGATGACATCTCCTAAGCGG
GTTCAGGGCATCGTTGCCGAGATGCTCAAGACATACGTCGGTTTGTACTCAAAGGATACGCCCAAGTGGAATAAC
ATCACCCGTCTATCTGAAAAGTATGGTTGGACGGAGTTAACTGCAAGTTCCACAATGGAGTACCTTGTTCGAAAG
AATGTTTCTCCGCGCTATATTTCTGAACTTGTTGAGGCGGCAACCAGAACCAATTATGGTCAGAATACTGACTAT
ATACATGCATTGGAAGGCATGTGCTCACTTGCCACAGACGGTGCTGCAGGAATCTCAGGAGGGAACTATCGGATC
TTTGAGCAATTCCTCCAACGCTCTGACGCATTTGTTCACTTGAATGCCAACGTCAACAGTATCCTTCCCAGCACA
GATTCAAAAAATTGGACAGTTGCTACTTCCAAAGGAACCCAAGACTATGCTGCCGTTATTTTGGCGGCGCCTTTC
CATTTCACTGACATTACTGTACCTCATTCAATATCTGAGCAGATTTCCAACCATCCTTACGTGCATCTCCATGTC
ACTCTGTTGACGACCACTTCAGAATATCCTAACCCGGCATATTTTAACTTACCTTCGTCTTCTAAACCTGCGCGT
ATGATGCTCACAACTTACGAGGGTGTGCGTCACGGCGGATTAGAACCCGAGTTTAATTCCCTTTCATATCATGGG
CTTGTACGCCCCGGCGAGTGGGCGGTCAAAATTTTCTCTAAAAGTCGTATCAGTGATCAGTTGCTTGATAGTATT
TTCAATGGTCAGGTGCAGTGGGTTTACAGGAAGGAGTGGGATTCCTATCCTAAATTGCCACCAATGGAATCTTAT
CCTCCTGTCAAACTCGGACAGGGTTTCTATTATGTCAACTCTTTCGAGCCATTCATCTCAACAATGGAGACGGAA
ACTTTGTCTTCACGCAACATTGTGGATCTGCTCCTCGATGATCTATTCAACGCCAGTATCTGTGGACCTCAGATT
ACAGAACTTACAAACATTACCACCACAGATAAGAATGACTATGTATATGGTTGGGACTGTTGA
Transcript >Agabi119p4|009260
ATGAGGTATGCGGCATTGTTATTGCTTGCTACCAGCGTATACGCCTTCGAGATACCCTTCTTTGTTCCTGACTTC
CTAAAGAATCACGTTTTACCCCCGTCTACGCCCATAGTTGAAGTCAAAGACGACCCTCCCCCCACGGTTCCTAGG
ATAGCGATTGTTGGCGCCGGTGCCGGAGGCAGCTCAGCGGCGTTTTGGATATCCAAAGCCAAATCCCGCTTTGGC
CTAGATGTCGAAGTTGATGTTTACGACCGAAACAACTACATCGGTGGACGGTCCACTGTCGTCCATCCTTATAAT
GATACAACTCTCCCAGAGTTAGAATTGGGGGCGTCTATATTTGTTCGAGCAAACAAGAACCTCTGGCGAGCATCA
GAAGAGTTCAATCTGACCCGCCGGGATTTCACAGAGGAGAACTATGTGGTTGGCTTGTGGGATGGTCAGGATGTT
AGATTTACGTTTGAAGGAGGCTGGTGGGGAACTCTCAAAGTACTTTGGCGTTATGGGATGACATCTCCTAAGCGG
GTTCAGGGCATCGTTGCCGAGATGCTCAAGACATACGTCGGTTTGTACTCAAAGGATACGCCCAAGTGGAATAAC
ATCACCCGTCTATCTGAAAAGTATGGTTGGACGGAGTTAACTGCAAGTTCCACAATGGAGTACCTTGTTCGAAAG
AATGTTTCTCCGCGCTATATTTCTGAACTTGTTGAGGCGGCAACCAGAACCAATTATGGTCAGAATACTGACTAT
ATACATGCATTGGAAGGCATGTGCTCACTTGCCACAGACGGTGCTGCAGGAATCTCAGGAGGGAACTATCGGATC
TTTGAGCAATTCCTCCAACGCTCTGACGCATTTGTTCACTTGAATGCCAACGTCAACAGTATCCTTCCCAGCACA
GATTCAAAAAATTGGACAGTTGCTACTTCCAAAGGAACCCAAGACTATGCTGCCGTTATTTTGGCGGCGCCTTTC
CATTTCACTGACATTACTGTACCTCATTCAATATCTGAGCAGATTTCCAACCATCCTTACGTGCATCTCCATGTC
ACTCTGTTGACGACCACTTCAGAATATCCTAACCCGGCATATTTTAACTTACCTTCGTCTTCTAAACCTGCGCGT
ATGATGCTCACAACTTACGAGGGTGTGCGTCACGGCGGATTAGAACCCGAGTTTAATTCCCTTTCATATCATGGG
CTTGTACGCCCCGGCGAGTGGGCGGTCAAAATTTTCTCTAAAAGTCGTATCAGTGATCAGTTGCTTGATAGTATT
TTCAATGGTCAGGTGCAGTGGGTTTACAGGAAGGAGTGGGATTCCTATCCTAAATTGCCACCAATGGAATCTTAT
CCTCCTGTCAAACTCGGACAGGGTTTCTATTATGTCAACTCTTTCGAGCCATTCATCTCAACAATGGAGACGGAA
ACTTTGTCTTCACGCAACATTGTGGATCTGCTCCTCGATGATCTATTCAACGCCAGTATCTGTGGACCTCAGATT
ACAGAACTTACAAACATTACCACCACAGATAAGAATGACTATGTATATGGTTGGGACTGTTGA
Gene >Agabi119p4|009260
ATGAGGTATGCGGCATTGTTATTGCTTGCTACCAGCGTATACGCCTTCGAGATACCCTTCTTTGTTCCTGACTTC
CTAAAGAATCACGTTTTACCCCCGTCTACGCCCATAGTTGAAGTCAAAGACGACCCTCCCCCCACGGTTCCTAGG
ATAGCGATTGTTGGCGCCGGTGCCGGAGGCAGCTCAGCGGCGTTTTGGATATCCAAAGCCAAATCCCGCTTTGGC
CTAGATGTCGAAGTTGATGTTTACGACCGAAACAACTACATCGGTGGACGTAGGTCATTCAACGGGTCACTGCAG
CATTTTCACAAACTTTCTTTCCAGGGTCCACTGTCGTCCATCCTTATAATGATACAACTCTCCCAGAGTTAGAAT
TGGGGGCGTCTATATTTGTTCGAGCAAACAAGAACCTCTGGCGAGCATCAGAAGAGTTCAATCTGACCCGCCGGG
ATTTCACAGAGGAGAACTATGTGGTTGGCTTGTGGGATGGTCAGGATGTTAGATTTACGGTAAGGTTCTTTTGTC
CATGATGCAAACATGCTTCATCTTGGTACAGTTTGAAGGAGGCTGGTGGGGAACTCTCAAAGTACTTTGGCGTTA
TGGGATGACATCTCCTAAGCGGGTTCAGGGCATGTATGTCATCCTCAACTTCATTTCCCAGATAATTTCATGGTA
ATAACGAGTGTTTAGCGTTGCCGAGATGCTCAAGACATACGTCGGTTTGTACTCAAAGGATACGCCCAAGTGGAA
TAACATCACCCGTCTATCTGAAAAGTATGGTTGGACGGAGTTAACTGCAAGTTCCACAATGGAGTACCTTGTTCG
AAAGAATGTTTCTCCGCGCTATATTTCTGAACTTGTTGAGGCGGCAACCAGAACCAATTATGGTCAGGTCTGTCA
AATTATTATCTCGCGATTCAACGGTTAGCTGAGAGCAGCCCAGAATACTGACTATATACATGCATTGGAAGGCAT
GTGCTCACTTGCCACAGACGGTGCTGCAGGAATCTCAGGAGGGAACTATCGGATCTTTGAGCAATTCCTCCAACG
CTCTGACGCATTTGTTCACTTGAATGCCAACGTCAACAGTATCCTTCCCAGCACAGATTCAAAAAATTGGACAGT
TGCTACTTCCAAAGGAACCCAAGACTATGCTGCCGTTATTTTGGCGGCGCCTTTCCATTTCACTGACATTACTGT
ACCTCATTCAATATCTGAGCAGATTTCCAACCATCCTTACGTGCATCTCCATGTCACTCTGTTGACGACCACTTC
AGAATATCCTAACCCGGCATATTTTAACTTACCTTCGTCTTCTAAACCTGCGCGTATGATGCTCACAACTTACGA
GGGTGTGCGTCACGGCGGATTAGAACCCGAGTTTAATTCCCTTTCATATCATGGGCTTGTACGCCCCGGCGAGTG
GGCGGTCAAAATTTTCTCTAAAAGTCGTATCAGTGATCAGTTGCTTGATAGTATTTTCAATGGTCAGGTGCAGTG
GGTTTACAGGAAGGAGGTGCGAGTCTTTTCGCCCAGATCAGATTGAGACTGAACATTTATCAGTGGGATTCCTAT
CCTAAATTGCCACCAATGGAATCTTATCCTCCTGTCAAACTCGGACAGGGTTTCTATTATGTCAACTCTTTCGAG
CCGTGCGTTACTCTACTCCCGATGTTTGCCTTGCCTTGACTCAGCCCTCGAAGATTCATCTCAACAATGGAGACG
GAAACTTTGTCTTCACGCAACATTGTGGATCTGCTCCTCGATGATCTATTCAACGCCAGTATCTGTGGACCTCAG
ATTACAGAACTTACAAACATTACCACCACAGATAAGAATGACTATGTATATGGTTGGGACTGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail