Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|009220
Gene name
Locationscaffold_01a:2165568..2166342
Strand-
Gene length (bp)774
Transcript length (bp)672
Coding sequence length (bp)672
Protein length (aa) 224

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13460 NAD_binding_10 NAD(P)H-binding 8.0E-27 7 207
PF05368 NmrA NmrA-like family 2.9E-06 4 110
PF01370 Epimerase NAD dependent epimerase/dehydratase family 3.3E-06 4 122
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 2.1E-06 4 120

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0006694 steroid biosynthetic process Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0003854 3-beta-hydroxy-delta5-steroid dehydrogenase activity Yes
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0003674 molecular_function No
GO:0008202 steroid metabolic process No
GO:0008152 metabolic process No
GO:0008610 lipid biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0016229 steroid dehydrogenase activity No
GO:0044238 primary metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0016491 oxidoreductase activity No
GO:0009058 biosynthetic process No
GO:0006629 lipid metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0003824 catalytic activity No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|009220
MRFLVLGATGPCGILLVRGLLLKYPSDPVIIYARSPHKLPPDINSTTHPTLTIIKGDLTDQDSIDRALEGVDVVL
SALGPVFGQPSDTPLAKGYQLLIELMGKRGIKRLIVLGATSIVDPADKYSFAYSCMINVVKAGAKSAYKDFVAIG
NTIRRQGYDLDWTIVRVPILTNSDGDNQTIVAGYVGDGKVGLSLPRKAFATFVIGEIEKREPGRFMDPRYILI*
Coding >Agabi119p4|009220
ATGCGCTTTCTTGTCCTGGGCGCTACAGGGCCATGTGGTATTCTCCTGGTTCGAGGGCTACTACTCAAATATCCT
TCTGATCCTGTCATAATCTACGCACGAAGTCCCCACAAATTACCACCCGATATCAACAGCACAACCCATCCAACT
CTCACCATTATCAAAGGTGATCTCACCGATCAAGACTCTATCGACAGGGCTCTAGAGGGCGTCGATGTTGTCCTT
TCAGCCCTCGGTCCTGTTTTTGGGCAGCCAAGTGATACCCCACTAGCTAAGGGCTATCAGCTCTTGATTGAACTC
ATGGGGAAACGCGGCATCAAGCGCCTCATCGTCCTTGGAGCAACATCTATCGTTGACCCAGCGGACAAATATAGT
TTTGCGTATTCCTGCATGATAAATGTCGTCAAGGCGGGGGCAAAATCGGCGTATAAAGACTTTGTTGCTATTGGA
AACACCATTCGCCGGCAAGGCTATGATTTGGACTGGACGATCGTTCGGGTCCCTATCTTGACAAACTCGGATGGC
GATAACCAAACTATAGTAGCGGGCTATGTAGGCGACGGTAAGGTTGGTCTGAGCCTCCCTCGTAAAGCCTTCGCA
ACATTCGTCATTGGAGAGATCGAAAAGAGAGAACCTGGGCGTTTCATGGATCCCCGTTATATATTAATATGA
Transcript >Agabi119p4|009220
ATGCGCTTTCTTGTCCTGGGCGCTACAGGGCCATGTGGTATTCTCCTGGTTCGAGGGCTACTACTCAAATATCCT
TCTGATCCTGTCATAATCTACGCACGAAGTCCCCACAAATTACCACCCGATATCAACAGCACAACCCATCCAACT
CTCACCATTATCAAAGGTGATCTCACCGATCAAGACTCTATCGACAGGGCTCTAGAGGGCGTCGATGTTGTCCTT
TCAGCCCTCGGTCCTGTTTTTGGGCAGCCAAGTGATACCCCACTAGCTAAGGGCTATCAGCTCTTGATTGAACTC
ATGGGGAAACGCGGCATCAAGCGCCTCATCGTCCTTGGAGCAACATCTATCGTTGACCCAGCGGACAAATATAGT
TTTGCGTATTCCTGCATGATAAATGTCGTCAAGGCGGGGGCAAAATCGGCGTATAAAGACTTTGTTGCTATTGGA
AACACCATTCGCCGGCAAGGCTATGATTTGGACTGGACGATCGTTCGGGTCCCTATCTTGACAAACTCGGATGGC
GATAACCAAACTATAGTAGCGGGCTATGTAGGCGACGGTAAGGTTGGTCTGAGCCTCCCTCGTAAAGCCTTCGCA
ACATTCGTCATTGGAGAGATCGAAAAGAGAGAACCTGGGCGTTTCATGGATCCCCGTTATATATTAATATGA
Gene >Agabi119p4|009220
ATGCGCTTTCTTGTCCTGGGCGCTACAGGGCCATGTGGTATTCTCCTGGTTCGAGGGCTACTACTCAAATATCCT
TCTGATCCTGTCATAATCTACGCACGAAGTCCCCACAAATTACCACCCGATATCAACAGCACAACCCATCCAACT
CTCACCATTATCAAAGGTGATCTCACCGATCAAGACTCTATCGACAGGGCTCTAGAGGGCGTCGATGTTGTCCTT
TCAGCCCTCGGTCCTGTTTTTGGGCAGCCAAGTGATACCCCACTAGCTAAGGGCTATCAGCTCTTGATTGAACTC
ATGGGGAAACGCGGCATCAAGCGCCTCATCGTCCTTGGAGCAACATCTATCGTTGACCCAGCGGACAAATATAGT
TTTGCGTATTCCTGCATGATAAATGTCGTCAAGGCGGGGGCAAAATCGGCGTATAAAGACTTTGTTGCTATTGGA
AACACCATTCGCCGGCAAGGCTATGATTTGGACTGGACGATCGTTCGGGTCCCTATCTTGACAAACTCGGATGGC
GATAACCAAACTATAGTAGCGGGCTATGTAGGCGACGGTAAGGTTGGTCTGAGCCTCCCTCGTAAAGCCTTCGCA
ACATTCGTCATTGGAGAGATCGAAAAGAGAGAGTGGGTTAGAAAGGCGCCGCTCATAACTGCATAAACTGGAAGA
CCTGGGCGTTTCAGTGAGTAACAATTAATGACTCTGCAGTGCACAGGATGTTGTCATAACCCATATCTATTAGTG
GATCCCCGTTATATATTAATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail