Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|009140
Gene name
Locationscaffold_01a:2146594..2148274
Strand+
Gene length (bp)1680
Transcript length (bp)1284
Coding sequence length (bp)1284
Protein length (aa) 428

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16 9.4E-07 177 249

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USW3|YHZ7_SCHPO Probable glycosidase C21B10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21B10.07 PE=3 SV=1 95 424 5.0E-73
sp|A1C7B5|EGLX_ASPCL Probable endo-1,3(4)-beta-glucanase ACLA_073210 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_073210 PE=3 SV=1 121 425 1.0E-67
sp|A2QBQ3|EGLX_ASPNC Probable endo-1,3(4)-beta-glucanase An02g00850 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An02g00850 PE=3 SV=1 119 424 1.0E-64
sp|D4AJR9|EGLX_ARTBC Endo-1,3(4)-beta-glucanase ARB_04519 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04519 PE=3 SV=1 123 424 1.0E-63
sp|Q4X084|EGLX_ASPFU Probable endo-1,3(4)-beta-glucanase AFUA_2G14360 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G14360 PE=3 SV=1 121 424 3.0E-63
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USW3|YHZ7_SCHPO Probable glycosidase C21B10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21B10.07 PE=3 SV=1 95 424 5.0E-73
sp|A1C7B5|EGLX_ASPCL Probable endo-1,3(4)-beta-glucanase ACLA_073210 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_073210 PE=3 SV=1 121 425 1.0E-67
sp|A2QBQ3|EGLX_ASPNC Probable endo-1,3(4)-beta-glucanase An02g00850 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An02g00850 PE=3 SV=1 119 424 1.0E-64
sp|D4AJR9|EGLX_ARTBC Endo-1,3(4)-beta-glucanase ARB_04519 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04519 PE=3 SV=1 123 424 1.0E-63
sp|Q4X084|EGLX_ASPFU Probable endo-1,3(4)-beta-glucanase AFUA_2G14360 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G14360 PE=3 SV=1 121 424 3.0E-63
sp|B0XTU6|EGLX_ASPFC Probable endo-1,3(4)-beta-glucanase AFUB_029980 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_029980 PE=3 SV=1 121 424 3.0E-63
sp|Q2UIE6|EGLX_ASPOR Probable endo-1,3(4)-beta-glucanase AO090023000083 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090023000083 PE=3 SV=1 117 424 4.0E-63
sp|B8N7S7|EGLX_ASPFN Probable endo-1,3(4)-beta-glucanase AFLA_105200 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_105200 PE=3 SV=1 117 424 6.0E-62
sp|Q5BAP5|EGLX_EMENI Endo-1,3(4)-beta-glucanase xgeA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xgeA PE=3 SV=1 119 425 1.0E-61
sp|A1DHY9|EGLX_NEOFI Probable endo-1,3(4)-beta-glucanase NFIA_089530 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_089530 PE=3 SV=1 121 424 3.0E-61
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|009140
MRLQKCVPLSLLLFIADYISPAETKFVPSTIQRVHQFATRQTHSLAKDLRLAFGGVLAPRDNSSPPPAQHVVYCK
TKQAPFISGPIGGNNTTSAVGGGMSSSKTSTSRQASPTGAVSNSPWKLQQSYSGDSFFQGWDFFIGDDPTNGIVN
YVDEITARSTGLLEVNNQGNAIMRVETTPKVDNLRNSVRITTKFQFNGGLVIMDAVHMPTGCGSWPAFWTNGPNW
PEGGEIDIVEGVHDYTNNQATIHTEVGCTLPSTDRGVLAISGNVIGLSNCAAAETGNQGCGVRASSGKSFGASFN
NNGGGVYAMKWDTSGIAIYFFPRGSEPADITAEKPEPDSWGAAMARWPAASCDPFKFFRDHHAIFDTTLCGDWAA
GVWSSAGIPGQEQSCAQKTGFTTCEEFVRASGSTLKEAYWEVKDVKIYQLQN*
Coding >Agabi119p4|009140
ATGCGACTTCAGAAATGCGTCCCGTTATCCCTTCTGCTCTTCATCGCCGACTACATCTCACCAGCAGAAACCAAA
TTCGTCCCAAGCACAATACAGAGAGTGCATCAGTTCGCCACGAGACAGACACACAGCCTTGCCAAGGATCTTCGA
CTCGCATTCGGAGGCGTCCTAGCGCCAAGGGACAACTCCTCTCCCCCTCCTGCACAACACGTTGTCTATTGCAAA
ACGAAACAGGCACCTTTTATTTCAGGTCCGATTGGCGGAAATAACACGACGAGCGCGGTTGGCGGAGGGATGAGC
TCATCGAAAACTTCGACCAGTAGACAAGCTAGTCCTACCGGCGCTGTGTCTAATTCACCATGGAAGCTCCAGCAG
TCTTATAGCGGAGATAGCTTCTTTCAAGGATGGGATTTCTTCATCGGTGACGACCCTACCAATGGCATTGTGAAC
TATGTTGATGAAATCACTGCCCGGTCCACGGGGCTTTTGGAAGTGAATAATCAAGGGAATGCCATCATGCGGGTG
GAGACCACGCCCAAAGTAGATAACCTGCGCAACAGCGTGCGTATCACGACCAAGTTTCAATTTAATGGAGGTCTG
GTAATCATGGACGCCGTTCATATGCCCACCGGATGTGGCTCATGGCCTGCGTTTTGGACAAATGGCCCCAACTGG
CCTGAAGGAGGAGAGATCGACATCGTTGAAGGCGTTCACGATTATACCAATAACCAAGCAACAATACATACCGAG
GTTGGGTGCACACTTCCAAGTACCGATCGGGGCGTTCTCGCCATCTCAGGTAATGTTATTGGGCTGTCAAATTGC
GCTGCCGCGGAAACCGGAAATCAAGGCTGCGGCGTAAGAGCCAGTTCGGGTAAATCGTTTGGCGCTTCATTTAAC
AACAACGGTGGTGGGGTGTATGCGATGAAGTGGGACACTAGCGGTATTGCCATATACTTCTTTCCTCGAGGATCT
GAACCTGCCGATATCACTGCCGAGAAACCCGAGCCCGATTCGTGGGGTGCCGCAATGGCAAGGTGGCCTGCCGCT
TCCTGTGACCCTTTTAAGTTCTTTAGAGATCACCACGCCATCTTTGATACAACACTATGTGGCGACTGGGCTGCA
GGTGTATGGTCATCCGCTGGAATTCCTGGACAGGAACAGAGCTGTGCTCAGAAAACTGGTTTTACTACTTGCGAA
GAATTTGTACGAGCAAGTGGATCTACACTCAAGGAAGCTTATTGGGAAGTAAAGGACGTGAAGATCTACCAGCTA
CAGAATTAA
Transcript >Agabi119p4|009140
ATGCGACTTCAGAAATGCGTCCCGTTATCCCTTCTGCTCTTCATCGCCGACTACATCTCACCAGCAGAAACCAAA
TTCGTCCCAAGCACAATACAGAGAGTGCATCAGTTCGCCACGAGACAGACACACAGCCTTGCCAAGGATCTTCGA
CTCGCATTCGGAGGCGTCCTAGCGCCAAGGGACAACTCCTCTCCCCCTCCTGCACAACACGTTGTCTATTGCAAA
ACGAAACAGGCACCTTTTATTTCAGGTCCGATTGGCGGAAATAACACGACGAGCGCGGTTGGCGGAGGGATGAGC
TCATCGAAAACTTCGACCAGTAGACAAGCTAGTCCTACCGGCGCTGTGTCTAATTCACCATGGAAGCTCCAGCAG
TCTTATAGCGGAGATAGCTTCTTTCAAGGATGGGATTTCTTCATCGGTGACGACCCTACCAATGGCATTGTGAAC
TATGTTGATGAAATCACTGCCCGGTCCACGGGGCTTTTGGAAGTGAATAATCAAGGGAATGCCATCATGCGGGTG
GAGACCACGCCCAAAGTAGATAACCTGCGCAACAGCGTGCGTATCACGACCAAGTTTCAATTTAATGGAGGTCTG
GTAATCATGGACGCCGTTCATATGCCCACCGGATGTGGCTCATGGCCTGCGTTTTGGACAAATGGCCCCAACTGG
CCTGAAGGAGGAGAGATCGACATCGTTGAAGGCGTTCACGATTATACCAATAACCAAGCAACAATACATACCGAG
GTTGGGTGCACACTTCCAAGTACCGATCGGGGCGTTCTCGCCATCTCAGGTAATGTTATTGGGCTGTCAAATTGC
GCTGCCGCGGAAACCGGAAATCAAGGCTGCGGCGTAAGAGCCAGTTCGGGTAAATCGTTTGGCGCTTCATTTAAC
AACAACGGTGGTGGGGTGTATGCGATGAAGTGGGACACTAGCGGTATTGCCATATACTTCTTTCCTCGAGGATCT
GAACCTGCCGATATCACTGCCGAGAAACCCGAGCCCGATTCGTGGGGTGCCGCAATGGCAAGGTGGCCTGCCGCT
TCCTGTGACCCTTTTAAGTTCTTTAGAGATCACCACGCCATCTTTGATACAACACTATGTGGCGACTGGGCTGCA
GGTGTATGGTCATCCGCTGGAATTCCTGGACAGGAACAGAGCTGTGCTCAGAAAACTGGTTTTACTACTTGCGAA
GAATTTGTACGAGCAAGTGGATCTACACTCAAGGAAGCTTATTGGGAAGTAAAGGACGTGAAGATCTACCAGCTA
CAGAATTAA
Gene >Agabi119p4|009140
ATGCGACTTCAGAAATGCGTCCCGTTATCCCTTCTGCTCTTCATCGCCGACTACATCTCACCAGCAGAAACCAAA
TTCGTCCCAAGCACAATACAGAGAGTGCATCAGTTCGCCACGAGACAGACACACAGCCTTGCCAAGGATCTTCGA
CTCGCATTCGGAGGCGTCCTAGCGCCAAGGGACAACTCCTCTCCCCCTCCTGCACAACACGTTGTCTATTGCAAA
ACGAAACAGGCACCTTTTATTTCAGGTCCGATTGGCGGAAATAACACGACGAGCGCGGTTGGCGGAGGGATGAGC
TCATCGAAAACTTCGACCAGTAGACAAGCTAGTCCTACCGGCGCTGTGTCTAATTCACCATGGAAGCTCCAGCAG
TCTTATGTGAGTTTTTTTATAACACCCACTTTATGCAGGGTGGCGGAGAACTTAATCTATCATTGCAGAGCGGAG
ATAGCTTCTTTCAAGGATGGGATTTCTTCATCGGTGACGACCCTACCAATGGTATGTTCTCAAATTTTACTTGTT
TAGTCGTGGCCACCGATGGTAAACTATTTGTGTAGGCATTGTGAACTATGTTGATGAAATCACTGCCGTGAGTTT
TTGCCGCCGTGTACTTCTTCCAAGCCTTGCTCACTGAAGTGATATTCAGCGGTCCACGGGGCTTTTGGAAGTGAA
TAATCAAGGGAATGCCATCATGCGGGTGGAGACCACGCCCAAAGTAGATAACCTGCGCAACAGCGTGCGTATCAC
GACCAAGTTTCAATTTAATGGAGGTCTGGTAATCATGGACGCCGTTCATATGCCCACCGGATGTGGCTCATGGCC
GTAAGCTTCACTCGAGTTTCCCTCGTGCAGTTTCCACGAGACTGACGGCTGTCATAGTGCGTTTTGGACAAATGG
CCCCAACTGGCCTGAAGGAGGAGAGATCGACATCGTTGAAGGCGTTCACGATTATACCAATAACCAAGCAACAAT
ACATACCGAGGTTGGGTGCACACTTCCAAGTACCGATCGGGGCGTTCTCGCCATCTCAGGTAATGTTATTGGGCT
GTCAAATTGCGCTGCCGCGGAAACCGGAAATCAAGGCTGCGGCGTAAGAGCCAGTTCGGGTAAATCGTTTGGCGC
TTCATTTAACAACAACGGTGGTGGGGTGTATGCGAGTTCGTGTTAACGTTTATTTGATGTTAACTTCCATTAACA
ATGAATTCAGTGAAGTGGGACACTAGCGGTATTGCCATATACTTCTTTCCTCGAGGATCTGAACCTGCCGATATC
ACTGCCGAGAAACCCGAGCCCGATTCGTGGGGTGCCGCAATGGCAAGGTGGCCTGCCGCTTCCTGTGACCCTTTT
AAGTTCTTTAGAGATCACCACGCCATCTTTGATACAACACTATGGTGTGTCGTATGTTTACAATTTTCCACAGAA
TGGAAGCTAATTATTGTATATCCAGTGGCGACTGGGCTGCAGGTGTATGGTCATCCGCTGGAATTCCTGGACAGG
AACAGAGCTGTGCTCAGAAAACTGGTTTTACTACTTGCGAAGAATTTGTACGAGCAAGTGGATCTACACTCAAGG
AAGCTTGTATGTACCCAAACTGTTTTGGTTGTCAATGATCACTAACAAATGGTCCGTGTAGATTGGGAAGTAAAG
GACGTGAAGATCTACCAGCTACAGAATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail