Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|009080
Gene name
Locationscaffold_01a:2122995..2132404
Strand-
Gene length (bp)9409
Transcript length (bp)6327
Coding sequence length (bp)6327
Protein length (aa) 2109

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 9.8E-23 1680 1798
PF00072 Response_reg Response regulator receiver domain 3.6E-19 1978 2095
PF00512 HisKA His Kinase A (phospho-acceptor) domain 1.2E-14 1569 1632
PF13191 AAA_16 AAA ATPase domain 1.2E-10 324 488
PF01590 GAF GAF domain 2.3E-09 1389 1525
PF13185 GAF_2 GAF domain 6.4E-10 1389 1525
PF00069 Pkinase Protein kinase domain 3.1E-08 27 195
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 2.6E-06 21 188

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14002|MAK2_SCHPO Peroxide stress-activated histidine kinase mak2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak2 PE=3 SV=1 1552 2092 2.0E-92
sp|Q5A599|NIK1_CANAL Histidine protein kinase NIK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NIK1 PE=1 SV=2 1543 2088 1.0E-64
sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 1558 2099 2.0E-61
sp|P48027|GACS_PSESY Sensor protein GacS OS=Pseudomonas syringae pv. syringae GN=gacS PE=3 SV=1 1538 2092 3.0E-59
sp|O74539|MAK3_SCHPO Peroxide stress-activated histidine kinase mak3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak3 PE=1 SV=1 1552 2096 7.0E-57
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14002|MAK2_SCHPO Peroxide stress-activated histidine kinase mak2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak2 PE=3 SV=1 1552 2092 2.0E-92
sp|Q5A599|NIK1_CANAL Histidine protein kinase NIK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NIK1 PE=1 SV=2 1543 2088 1.0E-64
sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 1558 2099 2.0E-61
sp|P48027|GACS_PSESY Sensor protein GacS OS=Pseudomonas syringae pv. syringae GN=gacS PE=3 SV=1 1538 2092 3.0E-59
sp|O74539|MAK3_SCHPO Peroxide stress-activated histidine kinase mak3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak3 PE=1 SV=1 1552 2096 7.0E-57
sp|P59342|BARA_SHIFL Signal transduction histidine-protein kinase BarA OS=Shigella flexneri GN=barA PE=3 SV=1 1522 2102 1.0E-55
sp|P0AEC5|BARA_ECOLI Signal transduction histidine-protein kinase BarA OS=Escherichia coli (strain K12) GN=barA PE=1 SV=1 1522 2102 7.0E-55
sp|P0AEC6|BARA_ECOL6 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=barA PE=1 SV=1 1522 2102 7.0E-55
sp|P0AEC7|BARA_ECO57 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O157:H7 GN=barA PE=3 SV=1 1522 2102 7.0E-55
sp|Q5AHA0|CHK1_CANAL Histidine protein kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHK1 PE=2 SV=1 1441 2104 2.0E-53
sp|Q9C5U0|AHK4_ARATH Histidine kinase 4 OS=Arabidopsis thaliana GN=AHK4 PE=1 SV=1 1545 2093 4.0E-52
sp|A1A697|OHK5_ORYSJ Probable histidine kinase 5 OS=Oryza sativa subsp. japonica GN=HK5 PE=2 SV=1 1544 2099 7.0E-50
sp|Q54U87|DHKA_DICDI Hybrid signal transduction histidine kinase A OS=Dictyostelium discoideum GN=dhkA PE=1 SV=1 1542 1822 2.0E-49
sp|P0DMC5|RCSC_ECOLI Sensor histidine kinase RcsC OS=Escherichia coli (strain K12) GN=rcsC PE=1 SV=1 1550 2100 6.0E-49
sp|Q9C5U1|AHK3_ARATH Histidine kinase 3 OS=Arabidopsis thaliana GN=AHK3 PE=1 SV=1 1556 2108 1.0E-48
sp|Q9C5U2|AHK2_ARATH Histidine kinase 2 OS=Arabidopsis thaliana GN=AHK2 PE=1 SV=1 1540 2099 2.0E-47
sp|A1A696|OHK3_ORYSJ Probable histidine kinase 3 OS=Oryza sativa subsp. japonica GN=HK3 PE=2 SV=1 1545 2107 7.0E-46
sp|A2WYI4|OHK3_ORYSI Probable histidine kinase 3 OS=Oryza sativa subsp. indica GN=HK3 PE=2 SV=1 1545 2107 8.0E-46
sp|Q3S4A7|AHK5_ARATH Histidine kinase 5 OS=Arabidopsis thaliana GN=AHK5 PE=1 SV=1 1523 2099 1.0E-44
sp|P0C0F6|RPFC_XANCP Sensory/regulatory protein RpfC OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpfC PE=1 SV=2 1557 1955 1.0E-43
sp|P0C0F7|RPFC_XANC8 Sensory/regulatory protein RpfC OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpfC PE=3 SV=2 1557 1955 1.0E-43
sp|O74539|MAK3_SCHPO Peroxide stress-activated histidine kinase mak3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak3 PE=1 SV=1 23 801 2.0E-42
sp|O49230|ETR1_BRAOL Ethylene receptor 1 OS=Brassica oleracea GN=ETR1 PE=2 SV=1 1509 1809 2.0E-41
sp|Q9KLK7|LUXQ_VIBCH Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=luxQ PE=1 SV=1 1540 1799 3.0E-41
sp|P0DMC6|RCSC_ECOLX Sensor histidine kinase RcsC OS=Escherichia coli GN=rcsC PE=1 SV=1 1550 1798 1.0E-40
sp|Q56128|RCSC_SALTI Sensor histidine kinase RcsC OS=Salmonella typhi GN=rcsC PE=3 SV=2 1550 1798 2.0E-40
sp|P58662|RCSC_SALTY Sensor histidine kinase RcsC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rcsC PE=3 SV=1 1550 1798 2.0E-40
sp|A1A699|OHK6_ORYSJ Probable histidine kinase 6 OS=Oryza sativa subsp. japonica GN=HK6 PE=1 SV=1 1553 2106 1.0E-39
sp|P49333|ETR1_ARATH Ethylene receptor 1 OS=Arabidopsis thaliana GN=ETR1 PE=1 SV=1 1509 1785 2.0E-39
sp|Q9XH58|ETR1_PELHO Ethylene receptor 1 OS=Pelargonium hortorum GN=ETR1 PE=2 SV=1 1509 1785 4.0E-39
sp|Q54YH4|DHKB_DICDI Hybrid signal transduction histidine kinase B OS=Dictyostelium discoideum GN=dhkB PE=1 SV=1 1549 1797 4.0E-39
sp|Q9XH57|ETR2_PELHO Ethylene receptor 2 OS=Pelargonium hortorum GN=ETR2 PE=2 SV=1 1509 1785 6.0E-39
sp|Q9P7Q7|MAK1_SCHPO Peroxide stress-activated histidine kinase mak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak1 PE=3 SV=1 1488 1800 1.0E-38
sp|Q41342|ETR1_SOLLC Ethylene receptor 1 OS=Solanum lycopersicum GN=ETR1 PE=1 SV=1 1509 1807 2.0E-38
sp|Q7MD16|LUXQ_VIBVY Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain YJ016) GN=luxQ PE=3 SV=1 1550 1807 2.0E-38
sp|Q8D5Z6|LUXQ_VIBVU Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain CMCP6) GN=luxQ PE=3 SV=1 1550 1807 2.0E-38
sp|Q9ZWL6|ETR1_PASED Ethylene receptor OS=Passiflora edulis GN=ETR1 PE=2 SV=1 1509 1785 1.0E-37
sp|Q9P896|TCSA_EMENI Two-component system protein A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tcsA PE=3 SV=2 1564 1794 1.0E-37
sp|Q9M7M1|ETR1_PRUPE Ethylene receptor OS=Prunus persica GN=ETR1 PE=2 SV=1 1509 1785 1.0E-37
sp|Q86CZ2|DHKK_DICDI Hybrid signal transduction histidine kinase K OS=Dictyostelium discoideum GN=dhkK PE=1 SV=1 1510 1799 2.0E-37
sp|Q551X9|DHKF_DICDI Hybrid signal transduction histidine kinase F OS=Dictyostelium discoideum GN=dhkF PE=3 SV=1 1548 1792 2.0E-37
sp|Q869S5|DOKA_DICDI Hybrid signal transduction protein dokA OS=Dictyostelium discoideum GN=dokA PE=1 SV=1 1552 1882 2.0E-36
sp|Q87GU5|LUXQ_VIBPA Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=luxQ PE=3 SV=1 1558 1799 3.0E-36
sp|P54302|LUXQ_VIBHA Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio harveyi GN=luxQ PE=1 SV=1 1558 1799 4.0E-36
sp|O81122|ETR1_MALDO Ethylene receptor OS=Malus domestica GN=ETR1 PE=2 SV=1 1509 1785 5.0E-36
sp|Q9HUI3|ARUS_PSEAE Sensor histidine kinase AruS OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aruS PE=3 SV=1 1556 1796 1.0E-35
sp|P37894|PLEC_CAUCR Non-motile and phage-resistance protein OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=pleC PE=1 SV=2 1562 1811 6.0E-35
sp|O82436|ETR1_CUCMN Ethylene receptor 1 OS=Cucumis melo var. cantalupensis GN=ETR1 PE=2 SV=1 1509 1810 1.0E-34
sp|O48929|ETR1_TOBAC Ethylene receptor OS=Nicotiana tabacum GN=ETR1 PE=2 SV=1 1509 1794 1.0E-34
sp|O49187|ETR2_SOLLC Ethylene receptor 2 OS=Solanum lycopersicum GN=ETR2 PE=2 SV=1 1544 1785 3.0E-34
sp|Q54RP6|DHKL_DICDI Hybrid signal transduction histidine kinase L OS=Dictyostelium discoideum GN=dhkL PE=3 SV=1 1515 1810 8.0E-34
sp|Q53RH0|ERS1_ORYSJ Probable ethylene response sensor 1 OS=Oryza sativa subsp. japonica GN=ERS1 PE=2 SV=1 1509 1785 2.0E-33
sp|A2XL32|ERS1_ORYSI Probable ethylene response sensor 1 OS=Oryza sativa subsp. indica GN=ERS1 PE=2 SV=1 1509 1785 2.0E-33
sp|Q52969|Y1002_RHIME Uncharacterized sensor-like histidine kinase R01002 OS=Rhizobium meliloti (strain 1021) GN=R01002 PE=3 SV=2 1542 1811 1.0E-32
sp|P0AEC4|ARCB_SHIFL Aerobic respiration control sensor protein ArcB OS=Shigella flexneri GN=arcB PE=3 SV=1 1519 1812 5.0E-32
sp|P0AEC3|ARCB_ECOLI Aerobic respiration control sensor protein ArcB OS=Escherichia coli (strain K12) GN=arcB PE=1 SV=1 1519 1812 5.0E-32
sp|P58363|ARCB_ECO57 Aerobic respiration control sensor protein ArcB OS=Escherichia coli O157:H7 GN=arcB PE=3 SV=1 1519 1812 5.0E-32
sp|P30855|EVGS_ECOLI Sensor protein EvgS OS=Escherichia coli (strain K12) GN=evgS PE=1 SV=2 1545 1799 7.0E-32
sp|Q54Q69|DHKG_DICDI Hybrid signal transduction histidine kinase G OS=Dictyostelium discoideum GN=dhkG PE=3 SV=1 1447 1794 1.0E-31
sp|P58402|EVGS_ECO57 Sensor protein EvgS OS=Escherichia coli O157:H7 GN=evgS PE=3 SV=1 1545 1799 2.0E-30
sp|Q9SSY6|ETR1_CUCSA Ethylene receptor 1 OS=Cucumis sativus GN=ETR1 PE=2 SV=1 1509 1785 2.0E-30
sp|O14002|MAK2_SCHPO Peroxide stress-activated histidine kinase mak2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak2 PE=3 SV=1 20 602 3.0E-30
sp|Q0DKM0|ERS2_ORYSJ Probable ethylene response sensor 2 OS=Oryza sativa subsp. japonica GN=ERS2 PE=2 SV=1 1513 1800 3.0E-30
sp|B8AY75|ERS2_ORYSI Probable ethylene response sensor 2 OS=Oryza sativa subsp. indica GN=ERS2 PE=2 SV=1 1513 1800 3.0E-30
sp|Q38846|ERS1_ARATH Ethylene response sensor 1 OS=Arabidopsis thaliana GN=ERS1 PE=1 SV=1 1416 1785 4.0E-30
sp|P16575|BVGS_BORPE Virulence sensor protein BvgS OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=bvgS PE=1 SV=3 1558 1790 3.0E-29
sp|P40330|BVGS_BORPA Virulence sensor protein BvgS OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=bvgS PE=3 SV=2 1558 1790 5.0E-29
sp|P26762|BVGS_BORBR Virulence sensor protein BvgS OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=bvgS PE=3 SV=2 1558 1790 1.0E-28
sp|P58356|TORS_ECO57 Sensor protein TorS OS=Escherichia coli O157:H7 GN=torS PE=3 SV=1 1556 1850 2.0E-28
sp|P39453|TORS_ECOLI Sensor protein TorS OS=Escherichia coli (strain K12) GN=torS PE=1 SV=4 1556 1850 4.0E-28
sp|Q9SXL4|AHK1_ARATH Histidine kinase 1 OS=Arabidopsis thaliana GN=AHK1 PE=1 SV=2 1302 1790 2.0E-27
sp|Q95PI2|DHKC_DICDI Hybrid signal transduction histidine kinase C OS=Dictyostelium discoideum GN=dhkC PE=1 SV=1 1571 1799 8.0E-27
sp|P20169|DSPA_SYNY3 Drug sensory protein A OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dspA PE=3 SV=2 1505 1798 7.0E-26
sp|A1A698|OHK4_ORYSJ Probable histidine kinase 4 OS=Oryza sativa subsp. japonica GN=HK4 PE=2 SV=1 1553 1795 8.0E-26
sp|P23545|PHOR_BACSU Alkaline phosphatase synthesis sensor protein PhoR OS=Bacillus subtilis (strain 168) GN=phoR PE=1 SV=1 1564 1792 6.0E-25
sp|Q54SP4|DHKD_DICDI Hybrid signal transduction histidine kinase D OS=Dictyostelium discoideum GN=dhkD PE=2 SV=1 1569 1804 3.0E-24
sp|P44578|ARCB_HAEIN Aerobic respiration control sensor protein ArcB homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=arcB PE=3 SV=1 1505 1776 2.0E-22
sp|Q03228|DIVJ_CAUCR Histidine protein kinase DivJ OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=divJ PE=1 SV=2 1542 1798 2.0E-22
sp|P35164|RESE_BACSU Sensor histidine kinase ResE OS=Bacillus subtilis (strain 168) GN=resE PE=1 SV=1 1545 1799 3.0E-22
sp|P94414|YCLK_BACSU Sensor histidine kinase YclK OS=Bacillus subtilis (strain 168) GN=yclK PE=3 SV=1 1556 1798 3.0E-21
sp|Q1XD95|YCF26_PYRYE Uncharacterized sensor-like histidine kinase ycf26 OS=Pyropia yezoensis GN=ycf26 PE=3 SV=1 1557 1798 3.0E-21
sp|A5VRX4|PDHS_BRUO2 Cell-division control histidine kinase PdhS OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=pdhS PE=3 SV=1 1542 1790 2.0E-20
sp|B0CI82|PDHS_BRUSI Cell-division control histidine kinase PdhS OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=pdhS PE=3 SV=1 1542 1790 2.0E-20
sp|Q57BR6|PDHS_BRUAB Cell-division control histidine kinase PdhS OS=Brucella abortus biovar 1 (strain 9-941) GN=pdhS PE=1 SV=1 1542 1790 3.0E-20
sp|Q2YRB4|PDHS_BRUA2 Cell-division control histidine kinase PdhS OS=Brucella abortus (strain 2308) GN=pdhS PE=3 SV=1 1542 1790 3.0E-20
sp|B2S758|PDHS_BRUA1 Cell-division control histidine kinase PdhS OS=Brucella abortus (strain S19) GN=pdhS PE=3 SV=1 1542 1790 3.0E-20
sp|Q8FZ86|PDHS_BRUSU Cell-division control histidine kinase PdhS OS=Brucella suis biovar 1 (strain 1330) GN=pdhS PE=3 SV=1 1542 1790 3.0E-20
sp|Q8YIM6|PDHS_BRUME Cell-division control histidine kinase PdhS OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=pdhS PE=3 SV=2 1542 1790 3.0E-20
sp|A9M715|PDHS_BRUC2 Cell-division control histidine kinase PdhS OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=pdhS PE=3 SV=1 1542 1790 4.0E-20
sp|A6X5X4|PDHS_OCHA4 Cell-division control histidine kinase PdhS OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=pdhS PE=3 SV=1 1542 1774 4.0E-20
sp|Q45614|YYCG_BACSU Sensor histidine kinase YycG OS=Bacillus subtilis (strain 168) GN=yycG PE=1 SV=1 1564 1799 1.0E-19
sp|B7KFU0|SASA_CYAP7 Adaptive-response sensory-kinase SasA OS=Cyanothece sp. (strain PCC 7424) GN=sasA PE=3 SV=1 1550 1798 4.0E-19
sp|A2YFR6|OHK1_ORYSI Probable histidine kinase 1 OS=Oryza sativa subsp. indica GN=HK1 PE=3 SV=1 1486 1724 7.0E-19
sp|Q06904|SASA_SYNE7 Adaptive-response sensory-kinase SasA OS=Synechococcus elongatus (strain PCC 7942) GN=sasA PE=1 SV=2 1548 1802 8.0E-19
sp|A3BE68|OHK1_ORYSJ Probable histidine kinase 1 OS=Oryza sativa subsp. japonica GN=HK1 PE=2 SV=1 1486 1724 9.0E-19
sp|Q9RDT3|WALK_STAAU Sensor protein kinase WalK (Fragment) OS=Staphylococcus aureus GN=walK PE=1 SV=1 1564 1797 1.0E-18
sp|Q55630|SASA_SYNY3 Adaptive-response sensory-kinase SasA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sasA PE=3 SV=1 1550 1798 1.0E-18
sp|A5A2P0|WALK_STASR Sensor protein kinase WalK (Fragment) OS=Staphylococcus sciuri subsp. rodentium GN=walK PE=3 SV=1 1569 1804 2.0E-18
sp|Q55E44|DHKE_DICDI Hybrid signal transduction histidine kinase E OS=Dictyostelium discoideum GN=dhkE PE=3 SV=1 1544 1710 2.0E-18
sp|A6QD58|WALK_STAAE Sensor protein kinase WalK OS=Staphylococcus aureus (strain Newman) GN=walK PE=3 SV=1 1545 1797 1.0E-17
sp|Q7A215|WALK_STAAW Sensor protein kinase WalK OS=Staphylococcus aureus (strain MW2) GN=walK PE=3 SV=1 1545 1797 1.0E-17
sp|A8YYU2|WALK_STAAT Sensor protein kinase WalK OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=walK PE=3 SV=1 1545 1797 1.0E-17
sp|Q6GD71|WALK_STAAS Sensor protein kinase WalK OS=Staphylococcus aureus (strain MSSA476) GN=walK PE=3 SV=1 1545 1797 1.0E-17
sp|Q7A8E0|WALK_STAAN Sensor protein kinase WalK OS=Staphylococcus aureus (strain N315) GN=walK PE=1 SV=1 1545 1797 1.0E-17
sp|Q7A305|WALK_STAAM Sensor protein kinase WalK OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=walK PE=3 SV=1 1545 1797 1.0E-17
sp|Q5HJX6|WALK_STAAC Sensor protein kinase WalK OS=Staphylococcus aureus (strain COL) GN=walK PE=3 SV=1 1545 1797 1.0E-17
sp|Q2YUQ2|WALK_STAAB Sensor protein kinase WalK OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=walK PE=3 SV=1 1545 1797 1.0E-17
sp|A5INR0|WALK_STAA9 Sensor protein kinase WalK OS=Staphylococcus aureus (strain JH9) GN=walK PE=3 SV=1 1545 1797 1.0E-17
sp|Q2G2U4|WALK_STAA8 Sensor protein kinase WalK OS=Staphylococcus aureus (strain NCTC 8325) GN=walK PE=1 SV=1 1545 1797 1.0E-17
sp|Q2FKN7|WALK_STAA3 Sensor protein kinase WalK OS=Staphylococcus aureus (strain USA300) GN=walK PE=3 SV=1 1545 1797 1.0E-17
sp|A6TXG9|WALK_STAA2 Sensor protein kinase WalK OS=Staphylococcus aureus (strain JH1) GN=walK PE=3 SV=1 1545 1797 1.0E-17
sp|A7WWQ7|WALK_STAA1 Sensor protein kinase WalK OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=walK PE=3 SV=1 1545 1797 1.0E-17
sp|Q54SP4|DHKD_DICDI Hybrid signal transduction histidine kinase D OS=Dictyostelium discoideum GN=dhkD PE=2 SV=1 1565 1798 2.0E-17
sp|Q6GKS6|WALK_STAAR Sensor protein kinase WalK OS=Staphylococcus aureus (strain MRSA252) GN=walK PE=3 SV=1 1545 1797 4.0E-17
sp|Q54W36|DHKH_DICDI Hybrid signal transduction histidine kinase H OS=Dictyostelium discoideum GN=dhkH PE=3 SV=1 1536 1730 5.0E-17
sp|O34206|KINB_PSEAI Alginate biosynthesis sensor protein KinB OS=Pseudomonas aeruginosa GN=kinB PE=1 SV=1 1567 1798 5.0E-17
sp|Q54Q69|DHKG_DICDI Hybrid signal transduction histidine kinase G OS=Dictyostelium discoideum GN=dhkG PE=3 SV=1 103 198 7.0E-17
sp|A7N6S2|CQSS_VIBCB CAI-1 autoinducer sensor kinase/phosphatase CqsS OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=cqsS PE=1 SV=1 1481 2093 7.0E-17
sp|Q8CU87|WALK_STAES Sensor protein kinase WalK OS=Staphylococcus epidermidis (strain ATCC 12228) GN=walK PE=1 SV=1 1545 1797 8.0E-17
sp|Q5HK19|WALK_STAEQ Sensor protein kinase WalK OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=walK PE=1 SV=1 1545 1797 8.0E-17
sp|Q9P4U6|TCSB_EMENI Two-component system protein B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tcsB PE=1 SV=2 1548 1811 1.0E-16
sp|Q4A159|WALK_STAS1 Sensor protein kinase WalK OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=walK PE=3 SV=1 1545 1797 1.0E-16
sp|P51392|YCF26_PORPU Uncharacterized sensor-like histidine kinase ycf26 OS=Porphyra purpurea GN=ycf26 PE=3 SV=1 1557 1798 3.0E-16
sp|Q4LAJ8|WALK_STAHJ Sensor protein kinase WalK OS=Staphylococcus haemolyticus (strain JCSC1435) GN=walK PE=3 SV=1 1564 1797 3.0E-16
sp|Q2JWK9|SASA_SYNJA Adaptive-response sensory-kinase SasA OS=Synechococcus sp. (strain JA-3-3Ab) GN=sasA PE=3 SV=1 1556 1798 4.0E-16
sp|O34989|YVRG_BACSU Sensor histidine kinase YvrG OS=Bacillus subtilis (strain 168) GN=yvrG PE=3 SV=2 1553 1790 1.0E-15
sp|Q6GGK7|SRRB_STAAR Sensor protein SrrB OS=Staphylococcus aureus (strain MRSA252) GN=srrB PE=3 SV=2 1569 1800 1.0E-15
sp|B0JK50|SASA_MICAN Adaptive-response sensory-kinase SasA OS=Microcystis aeruginosa (strain NIES-843) GN=sasA PE=3 SV=1 1556 1798 1.0E-15
sp|Q2JKD9|SASA_SYNJB Adaptive-response sensory-kinase SasA OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=sasA PE=3 SV=1 1556 1798 1.0E-15
sp|Q7A5H7|SRRB_STAAN Sensor protein SrrB OS=Staphylococcus aureus (strain N315) GN=srrB PE=1 SV=2 1569 1800 1.0E-15
sp|Q99TZ9|SRRB_STAAM Sensor protein SrrB OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=srrB PE=3 SV=2 1569 1800 1.0E-15
sp|Q8NWF3|SRRB_STAAW Sensor protein SrrB OS=Staphylococcus aureus (strain MW2) GN=srrB PE=3 SV=2 1569 1800 2.0E-15
sp|Q6G973|SRRB_STAAS Sensor protein SrrB OS=Staphylococcus aureus (strain MSSA476) GN=srrB PE=3 SV=2 1569 1800 2.0E-15
sp|Q5HFT1|SRRB_STAAC Sensor protein SrrB OS=Staphylococcus aureus (strain COL) GN=srrB PE=2 SV=1 1569 1800 2.0E-15
sp|Q2FY80|SRRB_STAA8 Sensor protein SrrB OS=Staphylococcus aureus (strain NCTC 8325) GN=srrB PE=3 SV=1 1569 1800 2.0E-15
sp|Q9L523|SRRB_STAAU Sensor protein SrrB OS=Staphylococcus aureus GN=srrB PE=2 SV=1 1569 1800 2.0E-15
sp|P08400|PHOR_ECOLI Phosphate regulon sensor protein PhoR OS=Escherichia coli (strain K12) GN=phoR PE=1 SV=1 1534 1797 3.0E-15
sp|Q9RQQ9|DIVL_CAUCR Sensor protein DivL OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=divL PE=1 SV=2 1552 1797 5.0E-15
sp|Q93CB7|MTRB_MYCPA Sensor histidine kinase MtrB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mtrB PE=3 SV=1 1569 1798 6.0E-15
sp|A0QR01|SENX3_MYCS2 Signal-transduction histidine kinase senX3 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=senX3 PE=1 SV=1 1568 1800 1.0E-14
sp|P45608|PHOR_KLEPN Phosphate regulon sensor protein PhoR OS=Klebsiella pneumoniae GN=phoR PE=3 SV=1 1569 1797 1.0E-14
sp|Q8KIY1|TMOS_PSEME Sensor histidine kinase TmoS OS=Pseudomonas mendocina GN=tmoS PE=1 SV=1 1564 1811 1.0E-14
sp|A2BRQ6|SASA_PROMS Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus (strain AS9601) GN=sasA PE=3 SV=1 1550 1808 1.0E-14
sp|Q8X614|ZRAS_ECO57 Sensor protein ZraS OS=Escherichia coli O157:H7 GN=zraS PE=3 SV=1 1549 1798 1.0E-14
sp|Q49XM6|ARLS_STAS1 Signal transduction histidine-protein kinase ArlS OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=arlS PE=3 SV=1 1572 1792 2.0E-14
sp|P52101|GLRK_ECOLI Sensor histidine kinase GlrK OS=Escherichia coli (strain K12) GN=glrK PE=1 SV=3 1569 1797 2.0E-14
sp|P21865|KDPD_ECOLI Sensor protein KdpD OS=Escherichia coli (strain K12) GN=kdpD PE=1 SV=2 1531 1797 2.0E-14
sp|P14377|ZRAS_ECOLI Sensor protein ZraS OS=Escherichia coli (strain K12) GN=zraS PE=1 SV=2 1549 1798 2.0E-14
sp|P45609|PHOR_SHIDY Phosphate regulon sensor protein PhoR OS=Shigella dysenteriae GN=phoR PE=3 SV=1 1534 1797 2.0E-14
sp|Q9APE0|ZRAS_KLEOX Sensor protein ZraS OS=Klebsiella oxytoca GN=zraS PE=3 SV=1 1556 1805 3.0E-14
sp|P42245|YCBM_BACSU Sensor histidine kinase YcbM OS=Bacillus subtilis (strain 168) GN=ycbM PE=3 SV=2 1564 1785 3.0E-14
sp|Q31AE8|SASA_PROM9 Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus (strain MIT 9312) GN=sasA PE=3 SV=1 1550 1798 4.0E-14
sp|B7K3M6|SASA_CYAP8 Adaptive-response sensory-kinase SasA OS=Cyanothece sp. (strain PCC 8801) GN=sasA PE=3 SV=1 1550 1798 4.0E-14
sp|Q8XA47|QSEE_ECO57 Sensor histidine kinase QseE OS=Escherichia coli O157:H7 GN=qseE PE=1 SV=2 1569 1797 6.0E-14
sp|A0QNG1|PKNB_MYCS2 Serine/threonine-protein kinase PknB OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=pknB PE=1 SV=1 26 202 7.0E-14
sp|A8G5E7|SASA_PROM2 Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus (strain MIT 9215) GN=sasA PE=3 SV=1 1550 1798 7.0E-14
sp|A3PDI2|SASA_PROM0 Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus (strain MIT 9301) GN=sasA PE=3 SV=1 1550 1798 7.0E-14
sp|Q2YY04|ARLS_STAAB Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=arlS PE=3 SV=1 1569 1792 7.0E-14
sp|Q7A0W5|ARLS_STAAW Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain MW2) GN=arlS PE=3 SV=1 1569 1792 8.0E-14
sp|Q6G9E7|ARLS_STAAS Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain MSSA476) GN=arlS PE=3 SV=1 1569 1792 8.0E-14
sp|Q6GGZ4|ARLS_STAAR Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain MRSA252) GN=arlS PE=3 SV=1 1569 1792 8.0E-14
sp|Q7A5N3|ARLS_STAAN Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain N315) GN=arlS PE=1 SV=1 1569 1792 8.0E-14
sp|Q7A2R7|ARLS_STAAM Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=arlS PE=3 SV=1 1569 1792 8.0E-14
sp|Q5HG05|ARLS_STAAC Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain COL) GN=arlS PE=3 SV=1 1569 1792 8.0E-14
sp|Q9KJN3|ARLS_STAA8 Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain NCTC 8325) GN=arlS PE=1 SV=1 1569 1792 8.0E-14
sp|Q2FH24|ARLS_STAA3 Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain USA300) GN=arlS PE=3 SV=1 1569 1792 8.0E-14
sp|E0X9C7|TODS_PSEPT Sensor histidine kinase TodS OS=Pseudomonas putida (strain DOT-T1E) GN=todS PE=1 SV=1 1544 1798 1.0E-13
sp|A0QTK3|MTRB_MYCS2 Sensor histidine kinase MtrB OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mtrB PE=3 SV=2 1569 1798 1.0E-13
sp|Q5HPC4|ARLS_STAEQ Signal transduction histidine-protein kinase ArlS OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=arlS PE=3 SV=1 1494 1798 1.0E-13
sp|Q86AT9|DHKI_DICDI Hybrid signal transduction histidine kinase I OS=Dictyostelium discoideum GN=dhkI-1 PE=3 SV=1 1556 1698 1.0E-13
sp|Q8CSL7|ARLS_STAES Signal transduction histidine-protein kinase ArlS OS=Staphylococcus epidermidis (strain ATCC 12228) GN=arlS PE=3 SV=1 1494 1798 1.0E-13
sp|P37461|ZRAS_SALTY Sensor protein ZraS OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=zraS PE=2 SV=2 1556 1798 1.0E-13
sp|A5W4E3|TODS_PSEP1 Sensor histidine kinase TodS OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=todS PE=1 SV=1 1544 1798 2.0E-13
sp|P33529|PHY_MOUSC Phytochrome OS=Mougeotia scalaris GN=PHY PE=2 SV=2 1552 1794 2.0E-13
sp|Q8Z332|ZRAS_SALTI Sensor protein ZraS OS=Salmonella typhi GN=zraS PE=3 SV=1 1556 1798 2.0E-13
sp|Q9CCJ1|MTRB_MYCLE Sensor histidine kinase MtrB OS=Mycobacterium leprae (strain TN) GN=mtrB PE=3 SV=1 1569 1798 3.0E-13
sp|Q9LCC2|PHYA_NOSS1 Cyanobacterial phytochrome A OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=aphA PE=3 SV=1 1561 1798 3.0E-13
sp|P54744|PKNB_MYCLE Serine/threonine-protein kinase PknB OS=Mycobacterium leprae (strain TN) GN=pknB PE=3 SV=3 26 202 4.0E-13
sp|P71380|PHOR_HAEIN Phosphate regulon sensor protein PhoR OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=phoR PE=3 SV=1 1557 1807 4.0E-13
sp|Q7BWI3|SASA_PROMA Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=sasA PE=3 SV=1 1556 1798 5.0E-13
sp|Q7V113|SASA_PROMP Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=sasA PE=3 SV=1 1560 1798 6.0E-13
sp|O22267|CKI1_ARATH Histidine kinase CKI1 OS=Arabidopsis thaliana GN=CKI1 PE=1 SV=1 1538 1796 6.0E-13
sp|B2J946|SASA_NOSP7 Adaptive-response sensory-kinase SasA OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=sasA PE=3 SV=1 1550 1800 6.0E-13
sp|P9WGK9|MTRB_MYCTU Sensor histidine kinase MtrB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mtrB PE=1 SV=1 1569 1798 7.0E-13
sp|P9WGK8|MTRB_MYCTO Sensor histidine kinase MtrB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mtrB PE=3 SV=1 1569 1798 7.0E-13
sp|P59963|MTRB_MYCBO Sensor histidine kinase MtrB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mtrB PE=3 SV=1 1569 1798 7.0E-13
sp|Q8YR50|SASA_NOSS1 Adaptive-response sensory-kinase SasA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=sasA PE=3 SV=1 1550 1800 8.0E-13
sp|Q0IBF4|SASA_SYNS3 Adaptive-response sensory-kinase SasA OS=Synechococcus sp. (strain CC9311) GN=sasA PE=3 SV=1 1550 1810 1.0E-12
sp|B1WYT4|SASA_CYAA5 Adaptive-response sensory-kinase SasA OS=Cyanothece sp. (strain ATCC 51142) GN=sasA PE=3 SV=1 1550 1798 1.0E-12
sp|Q3M8A7|SASA_ANAVT Adaptive-response sensory-kinase SasA OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=sasA PE=3 SV=1 1550 1800 1.0E-12
sp|P9WGK5|SENX3_MYCTU Sensor-like histidine kinase senX3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=senX3 PE=1 SV=1 1561 1819 1.0E-12
sp|P9WGK4|SENX3_MYCTO Sensor-like histidine kinase senX3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=senX3 PE=3 SV=1 1561 1819 1.0E-12
sp|P0A601|SENX3_MYCBO Sensor-like histidine kinase senX3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=senX3 PE=3 SV=1 1561 1819 1.0E-12
sp|A2YFR6|OHK1_ORYSI Probable histidine kinase 1 OS=Oryza sativa subsp. indica GN=HK1 PE=3 SV=1 1725 1799 2.0E-12
sp|A3BE68|OHK1_ORYSJ Probable histidine kinase 1 OS=Oryza sativa subsp. japonica GN=HK1 PE=2 SV=1 1725 1799 2.0E-12
sp|Q55168|PHY1_SYNY3 Phytochrome-like protein cph1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cph1 PE=1 SV=1 1504 1798 2.0E-12
sp|Q8XJL8|PKN2_CLOPE Probable serine/threonine-protein kinase CPE1738 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE1738 PE=3 SV=1 26 213 2.0E-12
sp|P54738|PKN6_MYXXA Serine/threonine-protein kinase pkn6 OS=Myxococcus xanthus GN=pkn6 PE=2 SV=1 36 198 2.0E-12
sp|A2C884|SASA_PROM3 Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus (strain MIT 9303) GN=sasA PE=3 SV=1 1550 1805 2.0E-12
sp|Q49ZT9|HSSS_STAS1 Heme sensor protein HssS OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=hssS PE=3 SV=1 1569 1800 3.0E-12
sp|Q7V6P7|SASA_PROMM Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus (strain MIT 9313) GN=sasA PE=3 SV=1 1550 1805 4.0E-12
sp|P9WI81|PKNB_MYCTU Serine/threonine-protein kinase PknB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknB PE=1 SV=1 26 202 4.0E-12
sp|P9WI80|PKNB_MYCTO Serine/threonine-protein kinase PknB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknB PE=3 SV=1 26 202 4.0E-12
sp|P0A5S5|PKNB_MYCBO Serine/threonine-protein kinase PknB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknB PE=3 SV=1 26 202 4.0E-12
sp|Q54SK5|DHKM_DICDI Hybrid signal transduction histidine kinase M OS=Dictyostelium discoideum GN=dhkM PE=3 SV=1 1978 2096 7.0E-12
sp|O69729|TCRY_MYCTU Probable sensor histidine kinase TcrY OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=tcrY PE=1 SV=1 1571 1806 8.0E-12
sp|Q8DMT2|SASA_THEEB Adaptive-response sensory-kinase SasA OS=Thermosynechococcus elongatus (strain BP-1) GN=sasA PE=3 SV=1 1549 1798 1.0E-11
sp|Q9KM66|CQSS_VIBCH CAI-1 autoinducer sensor kinase/phosphatase CqsS OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cqsS PE=1 SV=1 1558 2092 1.0E-11
sp|Q55E44|DHKE_DICDI Hybrid signal transduction histidine kinase E OS=Dictyostelium discoideum GN=dhkE PE=3 SV=1 1977 2087 2.0E-11
sp|Q5SML4|OHK2_ORYSJ Probable histidine kinase 2 OS=Oryza sativa subsp. japonica GN=HK2 PE=2 SV=1 1545 1704 2.0E-11
sp|A2YA15|OHK2_ORYSI Probable histidine kinase 2 OS=Oryza sativa subsp. indica GN=HK2 PE=3 SV=1 1545 1704 2.0E-11
sp|Q5A872|SLN1_CANAL Histidine protein kinase SLN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLN1 PE=1 SV=1 1978 2103 3.0E-11
sp|P39928|SLN1_YEAST Osmosensing histidine protein kinase SLN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLN1 PE=1 SV=1 1724 1798 4.0E-11
sp|P9WGL2|KDPD_MYCTO Sensor protein KdpD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kdpD PE=3 SV=1 1532 1780 4.0E-11
sp|P9WGL3|KDPD_MYCTU Sensor protein KdpD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kdpD PE=1 SV=1 1532 1780 5.0E-11
sp|Q6T5K2|ETR3_ORYSI Ethylene receptor 3 OS=Oryza sativa subsp. indica GN=ETR3 PE=2 SV=2 1506 1798 7.0E-11
sp|Q0DWC7|ETR3_ORYSJ Ethylene receptor 3 OS=Oryza sativa subsp. japonica GN=ETR3 PE=2 SV=1 1506 1798 7.0E-11
sp|Q54U87|DHKA_DICDI Hybrid signal transduction histidine kinase A OS=Dictyostelium discoideum GN=dhkA PE=1 SV=1 1948 2105 1.0E-10
sp|A1A698|OHK4_ORYSJ Probable histidine kinase 4 OS=Oryza sativa subsp. japonica GN=HK4 PE=2 SV=1 1977 2099 1.0E-10
sp|P94608|KDPD_CLOAB Sensor protein KdpD OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=kdpD PE=3 SV=2 1545 1797 1.0E-10
sp|Q08408|RPRX_BACFR Sensor protein RprX OS=Bacteroides fragilis (strain YCH46) GN=rprX PE=3 SV=2 1564 1798 1.0E-10
sp|P54883|SEX3_MYCLE Sensor-like histidine kinase senX3 OS=Mycobacterium leprae (strain TN) GN=senX3 PE=3 SV=1 1561 1797 1.0E-10
sp|Q9P7Q7|MAK1_SCHPO Peroxide stress-activated histidine kinase mak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak1 PE=3 SV=1 1927 2097 2.0E-10
sp|Q86CZ2|DHKK_DICDI Hybrid signal transduction histidine kinase K OS=Dictyostelium discoideum GN=dhkK PE=1 SV=1 1978 2098 2.0E-10
sp|Q7U871|SASA_SYNPX Adaptive-response sensory-kinase SasA OS=Synechococcus sp. (strain WH8102) GN=sasA PE=3 SV=1 1550 1810 2.0E-10
sp|Q54RP6|DHKL_DICDI Hybrid signal transduction histidine kinase L OS=Dictyostelium discoideum GN=dhkL PE=3 SV=1 1964 2104 3.0E-10
sp|P23222|FIXL_BRADU Sensor protein FixL OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fixL PE=1 SV=1 1574 1798 3.0E-10
sp|Q07737|CHVG_AGRFC Sensor protein ChvG OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=chvG PE=3 SV=2 1536 1797 3.0E-10
sp|Q3AYV8|SASA_SYNS9 Adaptive-response sensory-kinase SasA OS=Synechococcus sp. (strain CC9902) GN=sasA PE=3 SV=1 1550 1810 3.0E-10
sp|P72292|CHVG_RHIME Sensor protein ChvG OS=Rhizobium meliloti (strain 1021) GN=chvG PE=3 SV=3 1571 1801 3.0E-10
sp|P14712|PHYA_ARATH Phytochrome A OS=Arabidopsis thaliana GN=PHYA PE=1 SV=2 1573 1780 4.0E-10
sp|Q54YH4|DHKB_DICDI Hybrid signal transduction histidine kinase B OS=Dictyostelium discoideum GN=dhkB PE=1 SV=1 1978 2093 8.0E-10
sp|Q5A872|SLN1_CANAL Histidine protein kinase SLN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLN1 PE=1 SV=1 1724 1804 8.0E-10
sp|Q4L6C5|ARLS_STAHJ Signal transduction histidine-protein kinase ArlS OS=Staphylococcus haemolyticus (strain JCSC1435) GN=arlS PE=3 SV=1 1496 1792 8.0E-10
sp|Q8NU98|PKN1_CORGL Probable serine/threonine-protein kinase PknB OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pknB PE=3 SV=1 29 207 8.0E-10
sp|Q01549|PHY1_SELMA Phytochrome 1 OS=Selaginella martensii GN=PHY1 PE=3 SV=1 1503 1780 8.0E-10
sp|Q06067|ATOS_ECOLI Signal transduction histidine-protein kinase AtoS OS=Escherichia coli (strain K12) GN=atoS PE=3 SV=1 1568 1804 8.0E-10
sp|Q8R9T6|PKN1_CALS4 Probable serine/threonine-protein kinase Sps1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=sps1 PE=3 SV=1 20 198 9.0E-10
sp|P23621|PHOR_PSEAE Phosphate regulon sensor protein PhoR OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=phoR PE=3 SV=2 1567 1792 1.0E-09
sp|Q97IC2|PKN2_CLOAB Probable serine/threonine-protein kinase CA_C1728 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C1728 PE=3 SV=1 20 221 1.0E-09
sp|Q40762|PHY_PICAB Phytochrome OS=Picea abies PE=2 SV=1 1552 1780 1.0E-09
sp|P33530|PHYA1_TOBAC Phytochrome A1 OS=Nicotiana tabacum GN=PHYA1 PE=3 SV=1 1549 1780 2.0E-09
sp|Q8GP19|RSSA_SERMA Swarming motility regulation sensor protein RssA OS=Serratia marcescens GN=rssA PE=1 SV=2 1558 1807 2.0E-09
sp|A3Q5L8|MPRB_MYCSJ Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium sp. (strain JLS) GN=mprB PE=3 SV=1 1569 1802 2.0E-09
sp|Q8THF6|MSMS_METAC Methyl sulfide methyltransferase-associated sensor OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=msmS PE=1 SV=1 1548 1797 2.0E-09
sp|P42499|PHYB_SOYBN Phytochrome B OS=Glycine max GN=PHYB PE=3 SV=1 1503 1805 2.0E-09
sp|Q1B3X9|MPRB_MYCSS Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium sp. (strain MCS) GN=mprB PE=3 SV=1 1569 1802 2.0E-09
sp|A1UL69|MPRB_MYCSK Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium sp. (strain KMS) GN=mprB PE=3 SV=1 1569 1802 2.0E-09
sp|O31661|KINE_BACSU Sporulation kinase E OS=Bacillus subtilis (strain 168) GN=kinE PE=1 SV=1 1556 1808 3.0E-09
sp|P34094|PHYB_SOLTU Phytochrome B OS=Solanum tuberosum GN=PHYB PE=3 SV=2 1552 1780 3.0E-09
sp|Q08430|KINB_BACSU Sporulation kinase B OS=Bacillus subtilis (strain 168) GN=kinB PE=3 SV=4 1555 1797 4.0E-09
sp|Q9S2C0|PKSC_STRCO Serine/threonine-protein kinase PksC OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pksC PE=3 SV=1 36 203 5.0E-09
sp|P19906|NTRB_VIBAL Nitrogen regulation protein NtrB OS=Vibrio alginolyticus GN=ntrB PE=3 SV=1 1539 1784 5.0E-09
sp|P0A4I6|CIAH_STRR6 Sensor protein CiaH OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=ciaH PE=3 SV=1 1563 1805 6.0E-09
sp|P0A4I5|CIAH_STRPN Sensor protein CiaH OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=ciaH PE=3 SV=1 1563 1805 6.0E-09
sp|A6QGC0|PRKC_STAAE Serine/threonine-protein kinase PrkC OS=Staphylococcus aureus (strain Newman) GN=prkC PE=1 SV=1 7 199 6.0E-09
sp|Q9XA16|PKNX_STRCO Probable serine/threonine-protein kinase SCO3848 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3848 PE=3 SV=1 26 201 7.0E-09
sp|Q9R6X3|PHYB_NOSS1 Cyanobacterial phytochrome B OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=bphB PE=3 SV=1 1572 1796 7.0E-09
sp|Q7MD16|LUXQ_VIBVY Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain YJ016) GN=luxQ PE=3 SV=1 1962 2092 2.0E-08
sp|Q8D5Z6|LUXQ_VIBVU Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain CMCP6) GN=luxQ PE=3 SV=1 1962 2092 2.0E-08
sp|Q9P4U6|TCSB_EMENI Two-component system protein B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tcsB PE=1 SV=2 1979 2099 2.0E-08
sp|P39928|SLN1_YEAST Osmosensing histidine protein kinase SLN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLN1 PE=1 SV=1 1978 2103 2.0E-08
sp|P30847|BAES_ECOLI Signal transduction histidine-protein kinase BaeS OS=Escherichia coli (strain K12) GN=baeS PE=1 SV=2 1564 1780 2.0E-08
sp|P87323|MCS4_SCHPO Response regulator mcs4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcs4 PE=3 SV=1 1977 2087 2.0E-08
sp|P29130|PHYB_TOBAC Phytochrome B OS=Nicotiana tabacum GN=PHYB PE=2 SV=2 1552 1780 2.0E-08
sp|Q5AKU6|SSK1_CANAL Oxidative stress response two-component system protein SSK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSK1 PE=1 SV=1 1978 2087 2.0E-08
sp|O34507|PRKC_BACSU Serine/threonine-protein kinase PrkC OS=Bacillus subtilis (strain 168) GN=prkC PE=1 SV=1 40 198 2.0E-08
sp|Q07084|SSK1_YEAST Osmolarity two-component system protein SSK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK1 PE=1 SV=1 1977 2087 2.0E-08
sp|Q81WH6|PRKC_BACAN Serine/threonine-protein kinase PrkC OS=Bacillus anthracis GN=prkC PE=1 SV=1 14 198 3.0E-08
sp|P51586|YSO1_LEPBY Uncharacterized 14.6 kDa protein in sodA1 3'region OS=Leptolyngbya boryana PE=3 SV=1 1977 2099 3.0E-08
sp|P06594|PHYA4_AVESA Phytochrome A type 4 OS=Avena sativa GN=PHYA4 PE=1 SV=3 1551 1780 4.0E-08
sp|I1WSZ3|IRLS_BURP2 Sensor protein IrlS OS=Burkholderia pseudomallei (strain 1026b) GN=irlS PE=3 SV=1 1570 1798 5.0E-08
sp|P26489|FIXL_AZOC5 Sensor protein FixL OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=fixL PE=3 SV=1 1574 1796 5.0E-08
sp|P0DMK6|IRLS_BURPS Sensor protein IrlS OS=Burkholderia pseudomallei (strain K96243) GN=irlS PE=3 SV=1 1570 1798 6.0E-08
sp|P06218|NTRB_KLEOX Nitrogen regulation protein NtrB OS=Klebsiella oxytoca GN=ntrB PE=3 SV=1 1552 1784 6.0E-08
sp|P54737|PKN5_MYXXA Serine/threonine-protein kinase pkn5 OS=Myxococcus xanthus GN=pkn5 PE=2 SV=1 30 200 7.0E-08
sp|Q742C0|MPRB_MYCPA Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mprB PE=3 SV=2 1569 1797 8.0E-08
sp|P10047|DCTB_RHILE C4-dicarboxylate transport sensor protein DctB OS=Rhizobium leguminosarum GN=dctB PE=3 SV=1 1574 1792 8.0E-08
sp|P93527|PHYB_SORBI Phytochrome B OS=Sorghum bicolor GN=PHYB PE=3 SV=2 1503 1780 9.0E-08
sp|Q47745|VANS_ENTFA Sensor protein VanSB OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=vanSB PE=3 SV=1 1552 1797 1.0E-07
sp|P14714|PHYC_ARATH Phytochrome C OS=Arabidopsis thaliana GN=PHYC PE=1 SV=1 1571 1777 1.0E-07
sp|Q9ZTP3|EIN4_ARATH Protein EIN4 OS=Arabidopsis thaliana GN=EIN4 PE=1 SV=1 1516 1783 1.0E-07
sp|Q54W36|DHKH_DICDI Hybrid signal transduction histidine kinase H OS=Dictyostelium discoideum GN=dhkH PE=3 SV=1 1729 1794 2.0E-07
sp|P18392|RSTB_ECOLI Sensor protein RstB OS=Escherichia coli (strain K12) GN=rstB PE=1 SV=2 1568 1798 2.0E-07
sp|P36557|BASS_SALTY Sensor protein BasS OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=basS PE=1 SV=1 1510 1793 2.0E-07
sp|P93825|ERS2_ARATH Ethylene response sensor 2 OS=Arabidopsis thaliana GN=ERS2 PE=1 SV=2 1513 1704 2.0E-07
sp|Q55E44|DHKE_DICDI Hybrid signal transduction histidine kinase E OS=Dictyostelium discoideum GN=dhkE PE=3 SV=1 1729 1792 3.0E-07
sp|Q86AT9|DHKI_DICDI Hybrid signal transduction histidine kinase I OS=Dictyostelium discoideum GN=dhkI-1 PE=3 SV=1 1978 2097 3.0E-07
sp|A1KHB8|MPRB_MYCBP Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=mprB PE=3 SV=1 1569 1773 3.0E-07
sp|Q7U0X3|MPRB_MYCBO Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mprB PE=1 SV=1 1569 1773 3.0E-07
sp|P13792|PHOP_BACSU Alkaline phosphatase synthesis transcriptional regulatory protein PhoP OS=Bacillus subtilis (strain 168) GN=phoP PE=1 SV=4 1977 2086 3.0E-07
sp|Q7XX84|ETR2_ORYSJ Ethylene receptor 2 OS=Oryza sativa subsp. japonica GN=ETR2 PE=1 SV=1 1520 1709 3.0E-07
sp|Q551X9|DHKF_DICDI Hybrid signal transduction histidine kinase F OS=Dictyostelium discoideum GN=dhkF PE=3 SV=1 1978 2088 4.0E-07
sp|A0R3I7|MPRB_MYCS2 Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mprB PE=3 SV=2 1564 1790 4.0E-07
sp|Q8CTI3|SAES_STAES Histidine protein kinase SaeS OS=Staphylococcus epidermidis (strain ATCC 12228) GN=saeS PE=3 SV=2 1684 1790 4.0E-07
sp|Q5HR29|SAES_STAEQ Histidine protein kinase SaeS OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=saeS PE=3 SV=2 1684 1790 4.0E-07
sp|P0DMC6|RCSC_ECOLX Sensor histidine kinase RcsC OS=Escherichia coli GN=rcsC PE=1 SV=1 1957 2087 5.0E-07
sp|Q97PA9|STKP2_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 35 201 5.0E-07
sp|P9WGL1|MPRB_MYCTU Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mprB PE=1 SV=1 1569 1773 5.0E-07
sp|P9WGL0|MPRB_MYCTO Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mprB PE=3 SV=1 1569 1773 5.0E-07
sp|A5U124|MPRB_MYCTA Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mprB PE=3 SV=1 1569 1773 5.0E-07
sp|P0AE82|CPXA_ECOLI Sensor protein CpxA OS=Escherichia coli (strain K12) GN=cpxA PE=1 SV=1 1568 1798 6.0E-07
sp|P0AE83|CPXA_ECOL6 Sensor protein CpxA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cpxA PE=3 SV=1 1568 1798 6.0E-07
sp|P0AE84|CPXA_ECO57 Sensor protein CpxA OS=Escherichia coli O157:H7 GN=cpxA PE=3 SV=1 1568 1798 6.0E-07
sp|Q8G6P9|PKNB_BIFLO Probable serine/threonine-protein kinase PknB OS=Bifidobacterium longum (strain NCC 2705) GN=pknB PE=3 SV=1 34 198 6.0E-07
sp|Q840P7|SAES_STAAE Histidine protein kinase SaeS OS=Staphylococcus aureus (strain Newman) GN=saeS PE=1 SV=1 1684 1790 6.0E-07
sp|Q5HHW5|SAES_STAAC Histidine protein kinase SaeS OS=Staphylococcus aureus (strain COL) GN=saeS PE=1 SV=1 1684 1790 7.0E-07
sp|Q2G2U1|SAES_STAA8 Histidine protein kinase SaeS OS=Staphylococcus aureus (strain NCTC 8325) GN=saeS PE=1 SV=1 1684 1790 7.0E-07
sp|Q2FIT5|SAES_STAA3 Histidine protein kinase SaeS OS=Staphylococcus aureus (strain USA300) GN=saeS PE=3 SV=1 1684 1790 7.0E-07
sp|Q8DNS0|STKP_STRR6 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=stkP PE=1 SV=1 35 201 7.0E-07
sp|Q04J43|STKP_STRP2 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=stkP PE=1 SV=1 35 201 7.0E-07
sp|Q8KY50|STKP1_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 35 201 7.0E-07
sp|Q8H1X1|ETR2_ORYSI Ethylene receptor 2 OS=Oryza sativa subsp. indica GN=ETR2 PE=2 SV=3 1520 1709 9.0E-07
sp|Q04943|AFSQ2_STRCO Signal transduction histidine-protein kinase AfsQ2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=afsQ2 PE=3 SV=1 1572 1800 9.0E-07
sp|Q56128|RCSC_SALTI Sensor histidine kinase RcsC OS=Salmonella typhi GN=rcsC PE=3 SV=2 1978 2100 1.0E-06
sp|Q54SK5|DHKM_DICDI Hybrid signal transduction histidine kinase M OS=Dictyostelium discoideum GN=dhkM PE=3 SV=1 1532 1709 1.0E-06
sp|Q9M8Y4|ARR22_ARATH Two-component response regulator ARR22 OS=Arabidopsis thaliana GN=ARR22 PE=2 SV=1 1977 2097 1.0E-06
sp|Q6GIT7|SAES_STAAR Histidine protein kinase SaeS OS=Staphylococcus aureus (strain MRSA252) GN=saeS PE=3 SV=1 1684 1790 1.0E-06
sp|Q7A1J2|SAES_STAAW Histidine protein kinase SaeS OS=Staphylococcus aureus (strain MW2) GN=saeS PE=3 SV=1 1684 1790 1.0E-06
sp|Q6GBC5|SAES_STAAS Histidine protein kinase SaeS OS=Staphylococcus aureus (strain MSSA476) GN=saeS PE=3 SV=1 1684 1790 1.0E-06
sp|Q7A6V4|SAES_STAAN Histidine protein kinase SaeS OS=Staphylococcus aureus (strain N315) GN=saeS PE=1 SV=1 1684 1790 1.0E-06
sp|Q99VR8|SAES_STAAM Histidine protein kinase SaeS OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=saeS PE=3 SV=1 1684 1790 1.0E-06
sp|Q2YSM6|SAES_STAAB Histidine protein kinase SaeS OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=saeS PE=3 SV=1 1684 1790 1.0E-06
sp|A2XFW2|PHYB_ORYSI Phytochrome B OS=Oryza sativa subsp. indica GN=PHYB PE=3 SV=2 1573 1780 1.0E-06
sp|P93673|PHYA_LATSA Phytochrome type A OS=Lathyrus sativus GN=PHYA PE=3 SV=1 1549 1780 1.0E-06
sp|O34638|YKOH_BACSU Sensor histidine kinase YkoH OS=Bacillus subtilis (strain 168) GN=ykoH PE=3 SV=1 1569 1772 1.0E-06
sp|Q9KLK7|LUXQ_VIBCH Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=luxQ PE=1 SV=1 1957 2103 2.0E-06
sp|P58662|RCSC_SALTY Sensor histidine kinase RcsC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rcsC PE=3 SV=1 1978 2100 2.0E-06
sp|Q86AT9|DHKI_DICDI Hybrid signal transduction histidine kinase I OS=Dictyostelium discoideum GN=dhkI-1 PE=3 SV=1 1725 1799 2.0E-06
sp|P37433|PGTB_SALTY Phosphoglycerate transport system sensor protein PgtB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pgtB PE=1 SV=2 1539 1786 2.0E-06
sp|P15001|PHYA_PEA Phytochrome A OS=Pisum sativum GN=PHYA PE=3 SV=1 1549 1780 2.0E-06
sp|Q9Z5G7|MPRB_MYCLE Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium leprae (strain TN) GN=mprB PE=3 SV=1 1569 1800 2.0E-06
sp|Q0WPQ2|ETR2_ARATH Ethylene receptor 2 OS=Arabidopsis thaliana GN=ETR2 PE=1 SV=2 1511 1697 2.0E-06
sp|Q10MG9|PHYB_ORYSJ Phytochrome B OS=Oryza sativa subsp. japonica GN=PHYB PE=2 SV=1 1573 1780 2.0E-06
sp|Q9HWR3|BPHY_PSEAE Bacteriophytochrome OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=bphP PE=1 SV=1 1562 1799 2.0E-06
sp|Q8FK37|CUSS_ECOL6 Sensor kinase CusS OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cusS PE=3 SV=1 1569 1797 2.0E-06
sp|P0C0F6|RPFC_XANCP Sensory/regulatory protein RpfC OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpfC PE=1 SV=2 1930 2097 3.0E-06
sp|P0C0F7|RPFC_XANC8 Sensory/regulatory protein RpfC OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpfC PE=3 SV=2 1930 2097 3.0E-06
sp|P16497|KINA_BACSU Sporulation kinase A OS=Bacillus subtilis (strain 168) GN=kinA PE=1 SV=2 1549 1799 3.0E-06
sp|P42497|PHYD_ARATH Phytochrome D OS=Arabidopsis thaliana GN=PHYD PE=1 SV=2 1549 1780 3.0E-06
sp|P37739|DCTS_RHOCA C4-dicarboxylate transport sensor protein DctS OS=Rhodobacter capsulatus GN=dctS PE=3 SV=1 1557 1798 3.0E-06
sp|P42500|PHYA_SOYBN Phytochrome A OS=Glycine max GN=PHYA PE=2 SV=1 1523 1780 3.0E-06
sp|Q5A872|SLN1_CANAL Histidine protein kinase SLN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLN1 PE=1 SV=1 1548 1699 4.0E-06
sp|P0AEJ5|ENVZ_SHIFL Osmolarity sensor protein EnvZ OS=Shigella flexneri GN=envZ PE=1 SV=1 1569 1798 4.0E-06
sp|P0AEJ4|ENVZ_ECOLI Osmolarity sensor protein EnvZ OS=Escherichia coli (strain K12) GN=envZ PE=1 SV=1 1569 1798 4.0E-06
sp|P0A4I8|CUTS_STRLI Sensor protein CutS OS=Streptomyces lividans GN=cutS PE=3 SV=1 1500 1798 4.0E-06
sp|P0A4I7|CUTS_STRCO Sensor protein CutS OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=cutS PE=3 SV=1 1500 1798 4.0E-06
sp|P77485|CUSS_ECOLI Sensor kinase CusS OS=Escherichia coli (strain K12) GN=cusS PE=1 SV=1 1569 1797 4.0E-06
sp|P10955|FIXL_RHIME Sensor protein FixL OS=Rhizobium meliloti (strain 1021) GN=fixL PE=1 SV=2 1675 1797 4.0E-06
sp|Q95PI2|DHKC_DICDI Hybrid signal transduction histidine kinase C OS=Dictyostelium discoideum GN=dhkC PE=1 SV=1 1978 2088 5.0E-06
sp|P38889|SKN7_YEAST Transcription factor SKN7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKN7 PE=1 SV=1 1945 2096 8.0E-06
sp|Q1DB00|MASK_MYXXD Tyrosine-protein kinase MasK OS=Myxococcus xanthus (strain DK 1622) GN=masK PE=1 SV=1 19 198 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000155 phosphorelay sensor kinase activity Yes
GO:0005515 protein binding Yes
GO:0006468 protein phosphorylation Yes
GO:0004672 protein kinase activity Yes
GO:0000160 phosphorelay signal transduction system Yes
GO:0005524 ATP binding Yes
GO:0007165 signal transduction Yes
GO:0036094 small molecule binding No
GO:0032555 purine ribonucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0019538 protein metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0065007 biological regulation No
GO:0044238 primary metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0016740 transferase activity No
GO:0032559 adenyl ribonucleotide binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016310 phosphorylation No
GO:0035556 intracellular signal transduction No
GO:0000166 nucleotide binding No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0097367 carbohydrate derivative binding No
GO:0016301 kinase activity No
GO:0017076 purine nucleotide binding No
GO:0004673 protein histidine kinase activity No
GO:0006793 phosphorus metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0140299 small molecule sensor activity No
GO:0032553 ribonucleotide binding No
GO:0008150 biological_process No
GO:0016775 phosphotransferase activity, nitrogenous group as acceptor No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0036211 protein modification process No
GO:0050789 regulation of biological process No
GO:0097159 organic cyclic compound binding No
GO:0043170 macromolecule metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0043168 anion binding No
GO:0043412 macromolecule modification No
GO:0050794 regulation of cellular process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|009080
MLDNEGAPEVPEDGDGYDIMDLATFLEFAIQATHCLEVLNKHGIIHREVRGNAFHLNAHTGAVRFVHFGNRAISL
ENYGSPSSLVLTTIEESRKRKVKEALCYLAPEQTGSVETNTQDHRTDLYSLGILFWTLLVGHGQMPFEGSSFELM
HSIVQKRPMPVHEVRRDVPQVLANIVDKLLAKNPDLRYQSAQGLKTDLAECHRRLLATINSPSEPQHELIPLFDI
ALQDRFMEFTLPIALYGRDKELCVIRNIIRNTSTSFSQHFPVATSGGHHDTGTSAYDDSSDTTLSRSSALDNSTN
PLIKSSDSGEDHRPAAAHDQLKIPKVVIVAGSAGIGKSSMILNHQAKWRSHGLWGQAKFQSVDFAPFAAMLGCMS
SVLRQLMVFHIDLQRFVDNLKERLGPQICNVPLLFQAVPELQDVLRQYNIDLNVLPQERLATRDLRTRFQFLVQH
VFAVIAETRLFALFLDDLHDADESTLELVSALINSKSRMLIFITLRSDKTQVCERVRKMFSSKSRFTWINVEPLS
HSAISSLISKTLRRSEDECEALSTFITRASSGNAFSVKNILTTLQRQHHITFNLERNHWEYDMKAIEESMIGQKT
SDPTDLTFLCEHMRSLPEEARRYLIWAVFFGETFKVTDVASMMDLDDSSDSRGDEETNHRRDLQKAVTHLENVDS
NFTRSSMRGLQLALSEGWLIQRARDMCSFTHDRYRQAAQAEMESLPPDITANMSFRIIVTMLHENPSDIYRIAEY
ARRCLSLLRDHFQRDTLLGVLVNAGEAAWARGAHELAIQSFVCARSLFCENPWLGDPDRVFKILERLISLYRWKG
DLNSSDDIIQECLQHVTRVEDKCVLLRARSKNHWIRGQTTEAFSDILLALRMLGIDLNPSPTACDIDTAFQQVKN
EILSIGFGEILSIPRSRDVKIELAVALLNDAGMNAHLSSDSAALMDMVGLKCIQIILTGGMVPGVASGIFWTVPG
TAERRGLYRFAVDLGRLALEIADRRGTMGEKCRVQVLFCSLVSGFDQIHLKSNLDRLEEAVQYGETAGDRLYTNL
AGIHSICVRLYICEHLSDLVTSAEAIANDVDQWLPQRESKILVMGILNCIRVYGGYNESDDPATLFDTDGFVEQE
FFGQETSESDAFAITWYNSFKVASYYCIGHVDEAVSLGFAVFNTREAHPGHRHTRYGIFFHSLAMVACLRRRVPG
DLREKYIKQIESNQKFLRRWLSPSPTNASIWIALVDAELSSYLGNPKAFRLYDLAVRLAMENNWFLEEGWGLFLQ
GGHYSRCGIEGLGQELQQRGISRQAQWGAQGIAKHMTKMVGIKPQQSLKRSLFTTDIGIQTEVPVGDIAGLSQVK
ASRAVSRNGKKLDLDASDLGSILKWSTDIASDINLFFALRRLTEIATETSESQNACVAIALDGGEYTIATSMKPP
STCVVPEHPQSIRAIDDPLSRAIIQHAINTREKIVYDDASNDPRFSSEAGQSEHKSVLCLPIISNRDQTLGAAYF
ASKFPFSKHIVTMLTLLCQQASISISNALYFRSVQAGTRENLKMIAAQRDSLEDARRSREDALKATKTKSNFLAS
MSHELRTPFSSFYGLLDLLSGTELNPGQSEIVQTAKQSCEQLLKIIDSILDYSKLEASAVKLEPSGFAFENIIAD
CMELLLPMAAKKLDLSYNIEPDVPEWIYADNARISQVLMNLIGNAIKFTTRGYVRVNVSVEESPPGTTPENATLI
KVDITDTGIGLASTDVALLFVPFQQADNSSTRRFGGTGLGLSISRQLIKLMDGAIGVSSELNVGSRFWFNMPVKP
YSSEESRNAIAELQQLKTNLNKNRPLEMLVYSPSEATVRYLNTILSGSHISSTTSTSVLRDQIYAYATARIPIDF
IVLDDQTEGGAERLIQELEIIGYFETRVIHLHTPMIGQLGQPVFPLDKHPNIFRLTKPPRKSRILQAIAELKNVP
NKLSTMPAFELPKAEEALLAQRTLYGNVLIAEDNPIAQSLLVKQLERQDLTVTATNNGEEAIAEWEKHDPGYFQV
ALFDHHMPVCDGVEATKRLRVLENKRKAQFLLPIVALSADCQEVTKQLCLSAGMNAFFTKPMKKSDLFTLLSMFG
SGHNNSES*
Coding >Agabi119p4|009080
ATGCTGGATAATGAAGGAGCCCCTGAAGTTCCCGAGGATGGGGATGGGTATGATATAATGGATCTTGCCACATTT
CTAGAATTTGCTATACAAGCAACTCATTGTCTCGAAGTGTTGAACAAACATGGAATAATTCATCGGGAAGTTCGA
GGAAATGCCTTCCATCTCAACGCACACACGGGAGCTGTTCGTTTTGTTCATTTCGGCAACCGCGCAATATCGCTT
GAAAACTATGGCTCGCCGTCCTCTCTTGTACTAACTACTATCGAAGAAAGTCGAAAGCGAAAGGTCAAAGAAGCG
CTGTGCTACCTCGCTCCTGAGCAGACCGGGAGTGTAGAAACCAATACCCAAGACCACCGGACAGATCTTTATTCA
CTCGGCATCTTGTTCTGGACTCTTCTTGTTGGACATGGACAGATGCCATTCGAGGGAAGTTCTTTTGAATTAATG
CATTCTATTGTCCAAAAGCGTCCTATGCCTGTGCACGAGGTGCGACGAGATGTCCCCCAGGTCCTTGCCAATATC
GTGGACAAGTTACTAGCGAAGAATCCAGATCTGCGATATCAAAGCGCACAAGGTCTGAAGACTGACCTTGCGGAA
TGCCATAGGAGGTTGTTGGCAACTATTAATTCCCCGAGCGAACCGCAACATGAACTTATTCCACTATTTGATATC
GCGCTCCAAGACCGTTTTATGGAATTCACACTTCCGATTGCTCTGTACGGTCGAGACAAGGAGTTATGTGTCATT
AGGAACATCATACGGAACACATCTACAAGCTTTTCTCAGCACTTTCCGGTCGCTACTTCAGGTGGTCATCATGAT
ACTGGGACGAGTGCATACGATGACAGCAGTGATACTACATTGTCCAGATCATCAGCATTGGACAATTCTACGAAC
CCGCTAATAAAATCTTCCGATTCGGGAGAGGACCATCGACCAGCAGCTGCTCACGACCAGCTCAAAATTCCCAAA
GTTGTTATTGTGGCGGGGTCGGCAGGTATCGGAAAGAGCTCCATGATTCTCAATCACCAAGCGAAGTGGCGCTCT
CATGGATTGTGGGGACAAGCCAAATTTCAGAGTGTAGATTTTGCTCCATTTGCAGCTATGTTAGGTTGCATGTCG
TCAGTTCTTCGCCAACTGATGGTTTTCCATATCGATCTACAACGTTTCGTTGATAACCTCAAAGAACGGCTCGGT
CCTCAGATATGTAACGTACCCCTCCTGTTCCAAGCTGTTCCAGAGCTTCAAGACGTACTGCGCCAATATAACATC
GACCTCAACGTTCTCCCCCAAGAGCGTCTTGCTACGCGTGATCTACGAACCCGATTTCAATTCCTAGTGCAGCAT
GTCTTTGCTGTCATTGCTGAAACTCGTTTATTCGCCCTGTTTTTGGACGACCTTCACGACGCCGACGAATCGACC
CTTGAGCTCGTCTCAGCCCTCATCAACTCGAAAAGTCGGATGTTGATTTTCATCACTCTTCGTTCTGATAAAACT
CAGGTTTGTGAGAGAGTTCGGAAAATGTTTTCTAGCAAATCACGTTTCACATGGATCAACGTCGAGCCACTGTCA
CACTCAGCAATATCGTCATTAATATCAAAAACATTACGTCGTTCCGAGGACGAATGTGAAGCCCTTTCAACATTC
ATCACAAGAGCTTCTTCAGGAAATGCTTTTTCGGTCAAAAACATTCTTACGACTTTGCAACGACAACATCATATT
ACGTTCAACTTGGAAAGAAATCACTGGGAATATGACATGAAGGCTATTGAAGAGAGTATGATTGGCCAGAAAACT
TCTGACCCAACAGACTTGACTTTCCTTTGCGAACATATGCGTAGTCTACCAGAAGAAGCAAGGAGATATCTTATT
TGGGCTGTTTTCTTTGGTGAAACATTCAAAGTGACTGACGTTGCCTCGATGATGGACCTGGACGATTCTAGCGAC
AGTAGAGGTGATGAAGAGACAAATCACAGACGGGATTTGCAAAAGGCTGTGACGCATCTGGAAAATGTTGATTCT
AATTTTACTCGCAGTTCTATGCGTGGCCTACAGCTTGCTCTCTCAGAAGGCTGGCTGATTCAGCGCGCGCGAGAT
ATGTGTAGCTTCACTCATGATCGATATCGCCAAGCAGCGCAGGCAGAAATGGAATCACTCCCACCTGATATCACG
GCAAATATGTCCTTTCGTATCATCGTCACAATGCTACACGAAAACCCTAGCGATATCTATCGCATTGCTGAATAT
GCGAGGAGGTGTTTATCTCTGTTGCGCGATCATTTCCAAAGAGACACGTTACTCGGTGTTTTAGTAAATGCTGGA
GAAGCGGCTTGGGCCAGAGGTGCACATGAACTTGCCATCCAATCCTTTGTTTGCGCACGCTCGCTATTTTGCGAA
AACCCTTGGCTTGGAGATCCTGATCGTGTTTTCAAGATTCTTGAACGCCTTATCTCTCTATATCGGTGGAAAGGT
GATCTGAATTCCTCAGATGATATTATTCAGGAGTGTTTGCAACATGTTACCAGAGTGGAGGATAAATGCGTGTTA
TTGCGTGCACGTTCTAAAAACCACTGGATACGTGGCCAAACCACTGAAGCTTTCAGTGACATTTTACTTGCCCTC
AGGATGCTTGGAATCGACCTCAATCCATCACCTACTGCCTGCGACATAGATACGGCCTTCCAACAAGTCAAAAAT
GAAATTTTGTCGATCGGATTTGGTGAAATTCTTTCTATACCTCGATCCCGGGACGTCAAAATTGAACTCGCAGTT
GCTCTCCTGAATGACGCCGGCATGAATGCTCATTTGAGTTCAGATTCTGCCGCATTAATGGACATGGTGGGGTTA
AAGTGCATCCAAATTATATTGACCGGTGGTATGGTACCGGGCGTTGCATCTGGTATCTTCTGGACAGTTCCAGGT
ACAGCCGAGCGAAGAGGATTGTATCGTTTTGCGGTAGACCTAGGAAGGTTGGCATTAGAAATCGCGGATAGACGT
GGGACAATGGGAGAGAAATGCCGAGTTCAAGTACTTTTCTGCTCCCTCGTCTCAGGATTTGATCAGATACATCTT
AAGTCTAATCTTGATAGGTTGGAGGAAGCTGTTCAATATGGAGAGACAGCGGGTGACCGCCTCTACACGAATCTG
GCGGGTATTCACAGCATTTGTGTTCGGCTATATATTTGTGAACATCTCTCTGATTTGGTGACTTCCGCTGAGGCG
ATCGCGAACGACGTGGACCAATGGCTACCTCAGAGGGAATCGAAAATTTTAGTCATGGGCATCCTTAACTGCATC
CGCGTATATGGCGGCTACAATGAATCTGATGATCCTGCCACTCTTTTTGATACTGATGGATTCGTCGAACAGGAA
TTCTTTGGACAGGAAACATCGGAAAGTGATGCGTTTGCAATCACCTGGTATAACTCTTTCAAGGTGGCCAGCTAT
TACTGCATTGGTCATGTTGACGAAGCCGTCTCCCTTGGATTCGCCGTCTTCAACACGCGCGAGGCTCACCCTGGT
CATAGGCACACTCGATACGGAATATTCTTCCACAGTCTCGCTATGGTTGCCTGCCTGCGCCGAAGAGTACCAGGG
GATCTTCGGGAAAAATATATCAAACAAATCGAATCCAACCAGAAATTTTTGAGAAGGTGGCTCTCCCCTAGCCCA
ACAAATGCGAGCATTTGGATTGCACTTGTGGATGCAGAATTGTCGTCGTATCTTGGTAACCCTAAGGCCTTTCGA
TTGTATGATCTTGCAGTCCGTTTGGCCATGGAAAATAACTGGTTTTTGGAAGAAGGCTGGGGCCTCTTCTTGCAA
GGAGGCCATTACTCCAGGTGTGGAATAGAAGGGCTCGGTCAAGAATTACAACAACGTGGTATCTCTCGTCAGGCT
CAGTGGGGTGCTCAAGGCATTGCAAAACACATGACAAAAATGGTTGGAATAAAGCCACAACAATCACTCAAAAGG
TCCCTTTTTACTACGGACATTGGAATTCAGACAGAAGTTCCAGTGGGTGATATCGCTGGACTCTCGCAAGTAAAA
GCAAGCAGAGCTGTTTCTCGAAATGGCAAAAAGTTGGATTTGGACGCAAGCGATCTTGGTTCAATCTTGAAGTGG
AGCACAGATATCGCCAGTGACATCAATCTGTTCTTTGCCTTGAGGCGACTGACAGAAATTGCGACTGAAACCTCT
GAGTCGCAAAATGCCTGTGTCGCGATTGCATTGGATGGTGGCGAGTACACCATAGCAACAAGCATGAAGCCACCG
AGTACCTGCGTAGTACCTGAGCATCCACAATCTATACGGGCTATTGATGATCCGCTCTCAAGAGCTATCATTCAA
CACGCTATTAATACCAGGGAAAAAATTGTTTATGACGACGCATCCAACGATCCTCGCTTCTCTTCCGAGGCAGGC
CAATCAGAACACAAATCCGTTCTCTGTCTGCCCATTATCAGCAACCGAGATCAAACTCTCGGCGCAGCCTATTTC
GCCTCAAAGTTTCCTTTTTCAAAACATATCGTAACGATGCTCACACTCTTATGTCAACAGGCGAGCATCAGCATT
TCCAATGCCCTCTATTTTCGGTCTGTCCAAGCCGGAACGCGAGAGAATCTTAAAATGATTGCTGCTCAGCGCGAT
TCACTAGAGGATGCTAGACGGAGCAGAGAGGATGCTCTGAAAGCCACTAAGACCAAGAGCAACTTCCTGGCCTCA
ATGAGCCATGAATTGAGAACGCCTTTCAGCTCTTTTTATGGACTACTTGACCTTCTGTCTGGGACAGAACTCAAT
CCAGGGCAAAGTGAAATAGTACAAACCGCCAAGCAATCCTGCGAGCAACTACTCAAGATCATCGATTCTATCTTA
GACTATAGCAAGCTAGAAGCATCTGCCGTCAAACTTGAACCGAGCGGTTTTGCTTTTGAGAACATAATAGCGGAC
TGCATGGAGCTACTTCTACCAATGGCTGCAAAGAAACTTGATTTATCCTACAACATTGAGCCTGACGTCCCCGAG
TGGATTTATGCTGATAATGCTCGAATATCCCAAGTTCTGATGAATCTCATCGGAAACGCTATCAAATTCACCACC
AGGGGTTATGTTCGTGTCAATGTCTCCGTTGAAGAAAGTCCACCCGGCACTACGCCGGAAAATGCAACGCTTATC
AAGGTTGATATTACTGATACTGGAATCGGGCTAGCATCAACAGATGTGGCTTTACTTTTTGTTCCTTTCCAGCAG
GCAGATAATTCCTCGACGCGTCGTTTCGGAGGGACAGGTCTAGGACTTTCAATATCGAGACAATTAATCAAACTT
ATGGATGGAGCGATCGGAGTTTCCTCGGAGCTCAATGTCGGTTCTCGGTTCTGGTTCAACATGCCTGTAAAACCA
TATTCTTCAGAGGAGAGCCGGAACGCCATTGCAGAGTTGCAGCAGCTGAAAACAAACCTCAACAAGAATCGACCC
CTCGAAATGCTTGTTTACTCACCCTCAGAAGCTACTGTTAGATATCTCAACACAATCCTCAGTGGATCTCACATA
TCTTCCACGACCAGTACGAGTGTTCTCAGAGACCAGATATATGCATATGCGACGGCTCGGATTCCGATCGACTTT
ATCGTCTTGGATGACCAGACAGAGGGCGGCGCCGAGCGTCTTATCCAAGAACTGGAGATCATAGGTTACTTTGAA
ACTAGGGTCATACATCTTCACACCCCAATGATCGGTCAACTGGGACAACCTGTTTTTCCTTTGGACAAGCATCCA
AATATCTTCAGACTCACGAAACCTCCGAGAAAGTCTCGCATCCTACAAGCAATCGCTGAATTGAAAAATGTGCCC
AATAAATTATCTACTATGCCTGCATTTGAACTTCCCAAGGCCGAGGAAGCACTTCTAGCACAACGGACGCTGTAT
GGGAATGTGTTAATCGCTGAAGACAATCCCATTGCTCAAAGTTTACTGGTAAAACAACTAGAAAGACAAGATCTC
ACTGTAACGGCGACAAACAATGGGGAGGAAGCAATTGCTGAGTGGGAAAAACATGACCCTGGATACTTTCAGGTC
GCTTTGTTTGATCATCATATGCCAGTTTGTGATGGCGTTGAGGCAACCAAACGTTTACGAGTACTCGAAAATAAA
CGAAAGGCACAGTTTCTCTTACCGATTGTCGCACTTAGTGCGGATTGTCAAGAAGTTACTAAACAGCTATGCCTG
AGTGCAGGAATGAATGCCTTCTTCACTAAACCTATGAAAAAAAGTGACCTTTTTACGCTACTTTCGATGTTTGGA
TCTGGACACAACAACTCTGAGTCTTGA
Transcript >Agabi119p4|009080
ATGCTGGATAATGAAGGAGCCCCTGAAGTTCCCGAGGATGGGGATGGGTATGATATAATGGATCTTGCCACATTT
CTAGAATTTGCTATACAAGCAACTCATTGTCTCGAAGTGTTGAACAAACATGGAATAATTCATCGGGAAGTTCGA
GGAAATGCCTTCCATCTCAACGCACACACGGGAGCTGTTCGTTTTGTTCATTTCGGCAACCGCGCAATATCGCTT
GAAAACTATGGCTCGCCGTCCTCTCTTGTACTAACTACTATCGAAGAAAGTCGAAAGCGAAAGGTCAAAGAAGCG
CTGTGCTACCTCGCTCCTGAGCAGACCGGGAGTGTAGAAACCAATACCCAAGACCACCGGACAGATCTTTATTCA
CTCGGCATCTTGTTCTGGACTCTTCTTGTTGGACATGGACAGATGCCATTCGAGGGAAGTTCTTTTGAATTAATG
CATTCTATTGTCCAAAAGCGTCCTATGCCTGTGCACGAGGTGCGACGAGATGTCCCCCAGGTCCTTGCCAATATC
GTGGACAAGTTACTAGCGAAGAATCCAGATCTGCGATATCAAAGCGCACAAGGTCTGAAGACTGACCTTGCGGAA
TGCCATAGGAGGTTGTTGGCAACTATTAATTCCCCGAGCGAACCGCAACATGAACTTATTCCACTATTTGATATC
GCGCTCCAAGACCGTTTTATGGAATTCACACTTCCGATTGCTCTGTACGGTCGAGACAAGGAGTTATGTGTCATT
AGGAACATCATACGGAACACATCTACAAGCTTTTCTCAGCACTTTCCGGTCGCTACTTCAGGTGGTCATCATGAT
ACTGGGACGAGTGCATACGATGACAGCAGTGATACTACATTGTCCAGATCATCAGCATTGGACAATTCTACGAAC
CCGCTAATAAAATCTTCCGATTCGGGAGAGGACCATCGACCAGCAGCTGCTCACGACCAGCTCAAAATTCCCAAA
GTTGTTATTGTGGCGGGGTCGGCAGGTATCGGAAAGAGCTCCATGATTCTCAATCACCAAGCGAAGTGGCGCTCT
CATGGATTGTGGGGACAAGCCAAATTTCAGAGTGTAGATTTTGCTCCATTTGCAGCTATGTTAGGTTGCATGTCG
TCAGTTCTTCGCCAACTGATGGTTTTCCATATCGATCTACAACGTTTCGTTGATAACCTCAAAGAACGGCTCGGT
CCTCAGATATGTAACGTACCCCTCCTGTTCCAAGCTGTTCCAGAGCTTCAAGACGTACTGCGCCAATATAACATC
GACCTCAACGTTCTCCCCCAAGAGCGTCTTGCTACGCGTGATCTACGAACCCGATTTCAATTCCTAGTGCAGCAT
GTCTTTGCTGTCATTGCTGAAACTCGTTTATTCGCCCTGTTTTTGGACGACCTTCACGACGCCGACGAATCGACC
CTTGAGCTCGTCTCAGCCCTCATCAACTCGAAAAGTCGGATGTTGATTTTCATCACTCTTCGTTCTGATAAAACT
CAGGTTTGTGAGAGAGTTCGGAAAATGTTTTCTAGCAAATCACGTTTCACATGGATCAACGTCGAGCCACTGTCA
CACTCAGCAATATCGTCATTAATATCAAAAACATTACGTCGTTCCGAGGACGAATGTGAAGCCCTTTCAACATTC
ATCACAAGAGCTTCTTCAGGAAATGCTTTTTCGGTCAAAAACATTCTTACGACTTTGCAACGACAACATCATATT
ACGTTCAACTTGGAAAGAAATCACTGGGAATATGACATGAAGGCTATTGAAGAGAGTATGATTGGCCAGAAAACT
TCTGACCCAACAGACTTGACTTTCCTTTGCGAACATATGCGTAGTCTACCAGAAGAAGCAAGGAGATATCTTATT
TGGGCTGTTTTCTTTGGTGAAACATTCAAAGTGACTGACGTTGCCTCGATGATGGACCTGGACGATTCTAGCGAC
AGTAGAGGTGATGAAGAGACAAATCACAGACGGGATTTGCAAAAGGCTGTGACGCATCTGGAAAATGTTGATTCT
AATTTTACTCGCAGTTCTATGCGTGGCCTACAGCTTGCTCTCTCAGAAGGCTGGCTGATTCAGCGCGCGCGAGAT
ATGTGTAGCTTCACTCATGATCGATATCGCCAAGCAGCGCAGGCAGAAATGGAATCACTCCCACCTGATATCACG
GCAAATATGTCCTTTCGTATCATCGTCACAATGCTACACGAAAACCCTAGCGATATCTATCGCATTGCTGAATAT
GCGAGGAGGTGTTTATCTCTGTTGCGCGATCATTTCCAAAGAGACACGTTACTCGGTGTTTTAGTAAATGCTGGA
GAAGCGGCTTGGGCCAGAGGTGCACATGAACTTGCCATCCAATCCTTTGTTTGCGCACGCTCGCTATTTTGCGAA
AACCCTTGGCTTGGAGATCCTGATCGTGTTTTCAAGATTCTTGAACGCCTTATCTCTCTATATCGGTGGAAAGGT
GATCTGAATTCCTCAGATGATATTATTCAGGAGTGTTTGCAACATGTTACCAGAGTGGAGGATAAATGCGTGTTA
TTGCGTGCACGTTCTAAAAACCACTGGATACGTGGCCAAACCACTGAAGCTTTCAGTGACATTTTACTTGCCCTC
AGGATGCTTGGAATCGACCTCAATCCATCACCTACTGCCTGCGACATAGATACGGCCTTCCAACAAGTCAAAAAT
GAAATTTTGTCGATCGGATTTGGTGAAATTCTTTCTATACCTCGATCCCGGGACGTCAAAATTGAACTCGCAGTT
GCTCTCCTGAATGACGCCGGCATGAATGCTCATTTGAGTTCAGATTCTGCCGCATTAATGGACATGGTGGGGTTA
AAGTGCATCCAAATTATATTGACCGGTGGTATGGTACCGGGCGTTGCATCTGGTATCTTCTGGACAGTTCCAGGT
ACAGCCGAGCGAAGAGGATTGTATCGTTTTGCGGTAGACCTAGGAAGGTTGGCATTAGAAATCGCGGATAGACGT
GGGACAATGGGAGAGAAATGCCGAGTTCAAGTACTTTTCTGCTCCCTCGTCTCAGGATTTGATCAGATACATCTT
AAGTCTAATCTTGATAGGTTGGAGGAAGCTGTTCAATATGGAGAGACAGCGGGTGACCGCCTCTACACGAATCTG
GCGGGTATTCACAGCATTTGTGTTCGGCTATATATTTGTGAACATCTCTCTGATTTGGTGACTTCCGCTGAGGCG
ATCGCGAACGACGTGGACCAATGGCTACCTCAGAGGGAATCGAAAATTTTAGTCATGGGCATCCTTAACTGCATC
CGCGTATATGGCGGCTACAATGAATCTGATGATCCTGCCACTCTTTTTGATACTGATGGATTCGTCGAACAGGAA
TTCTTTGGACAGGAAACATCGGAAAGTGATGCGTTTGCAATCACCTGGTATAACTCTTTCAAGGTGGCCAGCTAT
TACTGCATTGGTCATGTTGACGAAGCCGTCTCCCTTGGATTCGCCGTCTTCAACACGCGCGAGGCTCACCCTGGT
CATAGGCACACTCGATACGGAATATTCTTCCACAGTCTCGCTATGGTTGCCTGCCTGCGCCGAAGAGTACCAGGG
GATCTTCGGGAAAAATATATCAAACAAATCGAATCCAACCAGAAATTTTTGAGAAGGTGGCTCTCCCCTAGCCCA
ACAAATGCGAGCATTTGGATTGCACTTGTGGATGCAGAATTGTCGTCGTATCTTGGTAACCCTAAGGCCTTTCGA
TTGTATGATCTTGCAGTCCGTTTGGCCATGGAAAATAACTGGTTTTTGGAAGAAGGCTGGGGCCTCTTCTTGCAA
GGAGGCCATTACTCCAGGTGTGGAATAGAAGGGCTCGGTCAAGAATTACAACAACGTGGTATCTCTCGTCAGGCT
CAGTGGGGTGCTCAAGGCATTGCAAAACACATGACAAAAATGGTTGGAATAAAGCCACAACAATCACTCAAAAGG
TCCCTTTTTACTACGGACATTGGAATTCAGACAGAAGTTCCAGTGGGTGATATCGCTGGACTCTCGCAAGTAAAA
GCAAGCAGAGCTGTTTCTCGAAATGGCAAAAAGTTGGATTTGGACGCAAGCGATCTTGGTTCAATCTTGAAGTGG
AGCACAGATATCGCCAGTGACATCAATCTGTTCTTTGCCTTGAGGCGACTGACAGAAATTGCGACTGAAACCTCT
GAGTCGCAAAATGCCTGTGTCGCGATTGCATTGGATGGTGGCGAGTACACCATAGCAACAAGCATGAAGCCACCG
AGTACCTGCGTAGTACCTGAGCATCCACAATCTATACGGGCTATTGATGATCCGCTCTCAAGAGCTATCATTCAA
CACGCTATTAATACCAGGGAAAAAATTGTTTATGACGACGCATCCAACGATCCTCGCTTCTCTTCCGAGGCAGGC
CAATCAGAACACAAATCCGTTCTCTGTCTGCCCATTATCAGCAACCGAGATCAAACTCTCGGCGCAGCCTATTTC
GCCTCAAAGTTTCCTTTTTCAAAACATATCGTAACGATGCTCACACTCTTATGTCAACAGGCGAGCATCAGCATT
TCCAATGCCCTCTATTTTCGGTCTGTCCAAGCCGGAACGCGAGAGAATCTTAAAATGATTGCTGCTCAGCGCGAT
TCACTAGAGGATGCTAGACGGAGCAGAGAGGATGCTCTGAAAGCCACTAAGACCAAGAGCAACTTCCTGGCCTCA
ATGAGCCATGAATTGAGAACGCCTTTCAGCTCTTTTTATGGACTACTTGACCTTCTGTCTGGGACAGAACTCAAT
CCAGGGCAAAGTGAAATAGTACAAACCGCCAAGCAATCCTGCGAGCAACTACTCAAGATCATCGATTCTATCTTA
GACTATAGCAAGCTAGAAGCATCTGCCGTCAAACTTGAACCGAGCGGTTTTGCTTTTGAGAACATAATAGCGGAC
TGCATGGAGCTACTTCTACCAATGGCTGCAAAGAAACTTGATTTATCCTACAACATTGAGCCTGACGTCCCCGAG
TGGATTTATGCTGATAATGCTCGAATATCCCAAGTTCTGATGAATCTCATCGGAAACGCTATCAAATTCACCACC
AGGGGTTATGTTCGTGTCAATGTCTCCGTTGAAGAAAGTCCACCCGGCACTACGCCGGAAAATGCAACGCTTATC
AAGGTTGATATTACTGATACTGGAATCGGGCTAGCATCAACAGATGTGGCTTTACTTTTTGTTCCTTTCCAGCAG
GCAGATAATTCCTCGACGCGTCGTTTCGGAGGGACAGGTCTAGGACTTTCAATATCGAGACAATTAATCAAACTT
ATGGATGGAGCGATCGGAGTTTCCTCGGAGCTCAATGTCGGTTCTCGGTTCTGGTTCAACATGCCTGTAAAACCA
TATTCTTCAGAGGAGAGCCGGAACGCCATTGCAGAGTTGCAGCAGCTGAAAACAAACCTCAACAAGAATCGACCC
CTCGAAATGCTTGTTTACTCACCCTCAGAAGCTACTGTTAGATATCTCAACACAATCCTCAGTGGATCTCACATA
TCTTCCACGACCAGTACGAGTGTTCTCAGAGACCAGATATATGCATATGCGACGGCTCGGATTCCGATCGACTTT
ATCGTCTTGGATGACCAGACAGAGGGCGGCGCCGAGCGTCTTATCCAAGAACTGGAGATCATAGGTTACTTTGAA
ACTAGGGTCATACATCTTCACACCCCAATGATCGGTCAACTGGGACAACCTGTTTTTCCTTTGGACAAGCATCCA
AATATCTTCAGACTCACGAAACCTCCGAGAAAGTCTCGCATCCTACAAGCAATCGCTGAATTGAAAAATGTGCCC
AATAAATTATCTACTATGCCTGCATTTGAACTTCCCAAGGCCGAGGAAGCACTTCTAGCACAACGGACGCTGTAT
GGGAATGTGTTAATCGCTGAAGACAATCCCATTGCTCAAAGTTTACTGGTAAAACAACTAGAAAGACAAGATCTC
ACTGTAACGGCGACAAACAATGGGGAGGAAGCAATTGCTGAGTGGGAAAAACATGACCCTGGATACTTTCAGGTC
GCTTTGTTTGATCATCATATGCCAGTTTGTGATGGCGTTGAGGCAACCAAACGTTTACGAGTACTCGAAAATAAA
CGAAAGGCACAGTTTCTCTTACCGATTGTCGCACTTAGTGCGGATTGTCAAGAAGTTACTAAACAGCTATGCCTG
AGTGCAGGAATGAATGCCTTCTTCACTAAACCTATGAAAAAAAGTGACCTTTTTACGCTACTTTCGATGTTTGGA
TCTGGACACAACAACTCTGAGTCTTGA
Gene >Agabi119p4|009080
ATGCTGGATAATGAAGGAGCCCCTGAAGTTCCCGAGGATGGGGATGGGTATGATATAATGGATCTTGCCACATTT
CTAGAGTATGTGAAGTTGTGTCAATAAATTTAATGCTCACGTTTTGCAAGATTTGCTATACAAGCAACTCATTGT
CTCGAAGTGTTGAACAAGTGTGTATTGCAGCGTATCTTATAATCTCGCTACTCATAGTCCATGCTCAATCAGACA
TGGAATAATTCATCGGGAAGGTGACCTATAATCACTGGCTTTTGATTATCGACTCCTCATGCATTGTCGTAGTTC
GAGGAAATGCCTTCCATCTCAACGCACACACGGGAGCTGTTCGTTTTGTTCATTTCGGCAACCGCGCAATATCGC
TTGAAAACTATGGCTCGCCGTCCTCTCTTGTACTAACTACTATCGAAGAAAGTCGAAAGCGAAAGGTCAAAGAAG
CGCTGTGCTACCTCGCTCCTGAGCAGACCGGGAGTGTAGAAACCAATACCCAAGACCACCGGACAGATCTTTATT
CACTCGGCATCTTGTTCTGGACTCTTCTTGTTGGACATGGACAGATGCCATTCGAGGGAAGTTCTTTTGAATTAA
TGCATTCTATTGTCCAAAAGCGTCCTATGCCTGTGCACGAGGTGCGACGAGATGTCCCCCAGGTCCTTGCCAATA
TCGTGGACAAGGTATGTCAATGATCTGTGCTCGAGCTTTTTTTACTCATCCTCCGTCTGATTGGAAAGTTACTAG
CGAAGAATCCAGATCTGCGATATCAAAGCGCACAAGGTCTGAAGACTGACCTTGCGGAATGCCATAGGAGGTTGT
TGGCAACTATTAATTCCCCGAGCGAACCGCAACATGAAGTACAAATCTAACCGTTCCTTTTTTTTTTTTTTTGCT
AAATCACTGTATTAGCTTATTCCACTATTTGATATCGCGCTCCAAGACCGTTTTATGGTTCGTGTACTCTAGTGT
CTGTTATCAAAAGATGAACATGAGGTTGTTATAGGAATTCACACTTCCGATTGCTCTGGTTAGTGTTATATCATG
TATTTGTTCCACACGCTGATCAGGATCTTATAGTACGGTCGAGACAAGGAGTTATGTGTCATTAGGAACATCAGT
AAGTGGCATCTATCATCATGGTAGTCAAACATACGCTTAAACCTTCCTAGTACGGAACACATCTACAAGCTTTTC
TCAGCACTTTCCGGTCGCTACTTCAGGTGGTCATCATGATACTGGGACGAGTGCATACGATGACAGCAGTGATAC
TACATTGTCCAGATGTGAGTAACTCTAGTATGACTTTCGACGTTAGTTCTAAGCTTTTTTTATGTCCCGTTAGCA
TCAGCATTGGACAATTCTACGAACCCGCTAATAAAATCTTCCGATTCGGGAGAGGACCATCGACCAGCAGCTGCT
CACGACCAGCTCAAAATTCCCAAAGTTGTTATTGTGGCGGGGTCGGCAGGGTGAGTTTATGGCTTCGGTTTGATT
GGAAACCACCCGTGTTGATTCTGCCAGTATCGGAAAGAGCTCCATGATTCTCAATCACCAAGCGAAGTGGCGCTG
TATGTATCTACTTCGCGTATGTATACAATCATCTCAACAATTACCAGCTCATGGATTGTGGGGACAAGCCAAATT
TCAGAGTGTAGATTTTGCTCCATTTGCAGCTATGGTACAAATCATTCACTTATCGCTTTCCCTTTTCCATTTAAG
TCGTCTCAGTTAGGTTGCATGTCGTCAGTTCTTCGCCAACTGATGGTTTTCCATATCGATCTACAACGTTTCGTT
GATAACCTCAAAGAACGGCTCGGTCCTCAGATATGTAACGTACCCCTCCTGTTCCAAGCTGTTCCAGAGCTTCAA
GACGTACTGCGCCAATATAACATCGACCTCAACGTTCTCCCCCAAGAGCGTCTTGCTACGCGTGATCTACGAACC
CGATTTCAATTCCTAGTGCAGCATGTCTTTGCTGTCATTGCTGAAACTCGTTTATTCGCCCTGTTTTTGGACGAC
CTTCACGACGCCGACGAATCGTATGCAAAATTACTATGCTTTCGGGCGAGACATTGATCACTAACAGGACCCTTG
AGCTCGTCTCAGCCCTCATCAACTCGAAAAGTCGGATGGTATATTCACTTTTCGGACTTCGATGTTTTTGTTCTG
ATAGTGACATAGTTGATTTTCATCACTCTTCGTTCTGATAAAACGTGCCAAGCTTCAATTCTCTTGCTTGGCCGG
CTCTGATATTGTTTTACTAGTCAGGTTTGTGAGAGAGTTCGGAAAATGTTTTCTAGCAAATCACGTTTCACATGG
ATCAACGTCGAGCCACTGTCACACTCAGCAATATCGTCATTAATATCAAAAACATTACGTCGTTCCGAGGACGAA
TGTGAAGCCCTTTCAACATTCATCACAAGAGCTTCTTCAGGAAATGCTTTTTCGGTCAAAAACATTCTTACGACT
TTGCAACGACAACATCATGTGGGCGCAAAGAGTGTCACGAAGCGATTCCAAACTGAAGAGACTCATTTTGACTTA
GATTACGTTCAACTTGGAAAGAAATCACTGGGAGTTAGTCAGACTCTCGCATCAATGTTTTTTTTTTCTAATGGA
CACAGATATGACATGAAGGCTATTGAAGAGAGTATGATTGGCCAGAAAACTTCTGACCCAACAGACTTGACTTTC
CTTTGCGAACATATGCGTAGTCTACCAGAAGAAGCAAGGAGATATCTTATTTGGGCTGTTTTCTTTGGTGAAACG
TAAGTCTTTGACGGATCTTCTCCATGAACTTAGGTACTTACTTTACTTCCAGATTCAAAGTGACTGACGTTGCCT
CGATGATGGACCTGGACGATTCTAGCGACAGTAGAGGTGATGAAGAGACAAATCACAGACGGGATTTGCAAAAGG
CTGTGACGCATCTGGAAAATGTTGATTCTAATTTTACTCGCAGTTCTATGCGTGGCCTACAGCTTGCTCTCTCAG
AAGGCTGGCTGATTCAGCGCGCGCGAGATATGTGTAGCTTCACTCATGATCGATATCGCCAAGCAGCGCAGGCAG
AAATGGAATCACTCCCACCTGATATCACGGCAAATATGTCCTTTCGTGTATGTCCATAAATCTCTCGTCATCCTC
TGTATCCCGACCTTACTGTCGTAGATCATCGTCACAATGCTACACGAAAACCCTAGCGATATCTATCGCATTGCT
GAATATGCGAGGAGGTAGGTGGCTAAATCATTCGATTCGGGCATGTTAAAAACGTCGCCGCAGGTGTTTATCTCT
GTTGCGCGATCATTTCCAAAGAGACACGTTACTCGGTGTTTTAGTAAATGCTGGAGAAGCGGCTTGGGCCAGAGG
TGCACATGAAGTACGCTATTATATTTTTCCATCTATTTATCTTATCGTTTTCTGTTGTTCCATCTTTTACTATAG
CTTGCCATCCAATCCTTTGTTTGCGCACGCTCGCTATTTTGCGAAAACCCTTGGCTTGGAGATCCTGATCGTGTT
TTCAAGATTCTTGAACGCCTTATCTCGTGTGTAATAGTTCATCTGAGTTTTAACTTTTGCTGAGTTTGACAGTCT
ATATCGGTGGAAAGGTCGTAGTTTACCCTTACGTCAACGAATACTAACATTCCTTTAGGTGATCTGAATTCCTCA
GATGATATTATTCAGGAGTGTTTGCAACATGTTACCAGAGTGGAGGATAAATGCGTGTTATTGCGTGCACGTTCT
AAAAACCACTGGATACGTGGCCAAACCACTGAAGCTTTCAGTGACATTTTACTTGCCCTCAGGATGCTTGGAATC
GACCTCAATCCATCACCTACTGCCTGCGACATAGATACGGCCTTCCAACAAGTCAAAAATGAAATTTTGTCGATC
GGATTTGGTGAAATTCTTTCTATACCTCGATCCCGGGACGTCAAAATTGAACTCGCAGTTGCTCTCCTGAATGAC
GCCGGTAAAACTTTCACATCTATAATTGTCAAAAACTAACCACCTTCACTTCAGGCATGAATGCTCATTTGAGTT
CAGATTCTGCCGCATTAATGGACATGGTGGGGTTAAAGGTGCGTTTGATTTTGGTGGTGATTTGGTGATGAGCCA
ACTGAGATTACAAGTGCATCCAAATTATATTGACGTGAGGCTCTTGTTATGACCTTTCCAATCGACAGTAACAAA
ATGATATTTTTCGACAGCGGTGGTATGGTACCGGGCGTTGCATCTGGTATCTTCTGGACAGTTCCAGGTACAGCC
GAGCGAAGAGGATTGTATCGTTTTGCGGTAGACCTAGGAAGGTTGGCATTAGAAATCGCGGATAGACGTGGGACA
ATGGGAGAGAAATGGTCAGTCACCCTTGTCCTCATGTGAGAAGCTTTCTCATTGTCACAAGCCGAGTTCAAGTAC
TTTTCTGCTCCCTCGTCTCAGGATTTGATCAGATACATCTTAAGTCTAATCTTGATAGGTTGGAGGAAGCTGTTC
AATATGGAGAGACAGCGGGTGACCGGTGCGTATTTCATAGTAAACGAGGGGAACAAGAATTATGGACCATATTAG
CCTCTACACGAATCTGGCGGGTATTCACAGCATTTGTGTTCGGCTATATATTTGTGAACATCGTAGGTAGTCGGA
TTGGAGTTTTGTGTCTCGAATGCTTACAAGCACAGTCTCTGATTTGGTGACTTCCGCTGAGGCGGTGCGTCTTTG
ACTCACGATATTATCACTAGAACTGAAATATACTAGATCGCGAACGACGTGGACCAATGGCTACCTCAGAGGGAA
TCGAAAATTTTAGTCATGGGTCGGTCCTCTCCCGTTTCGCGTCTATTTCTTGGGATTCATTTAGGAGAACTAGGC
ATCCTTAACTGCATCCGCGTATATGGCGGCTACAATGAATCTGATGATCCTGCCACTCTTTTTGATACTGATGGA
TTCGTCGAACAGGAATTCTTTGGACAGGAAACATCGGAAAGTGATGCGTTTGCAATCACCTGGTACGTACACCAT
CTTTTCTGTTGCAAGAACAAGTTTCAATCGATCCGTTGTCGTTTCCATTGTCATAGGTATAACTCTTTCAAGGTT
TTCTTTTCTTTTCCTTTCTGGAGCTATAAAACTTAACATTCTCCAGGTGGCCAGCTATTACTGCATTGGTCATGT
TGACGAAGCCGTCTCCCTTGGATTCGCCGTCTTCAACACGCGCGAGGCTCACCCTGGGTACATATCTATTTCCTT
TTGTTTGCCTTCGATACTTTTTAACTTCTTATGAAGTCATAGGCACACTCGATACGGAATATTCTTCCACAGTCT
CGCTATGGTTGCCTGCCTGCGCCGAAGAGTACCAGGGGATCTTCGGGAAAAATATATCAAACAAATCGAATCCAA
CCAGAAATTTTTGAGAAGGTATATATCATTTAAGTCTCAATTTTGGCCTGAGTTCATTTCCACAAAGGTGGCTCT
CCCCTAGCCCAACAAATGCGAGCATTTGGATTGCACTTGTGGTATGTGCCATCCCAAATGGTGCTCTCATGACTG
ATGAGTTTCAGGATGCAGAATTGTCGTCGTATCTTGGTAACCCTAAGGCCTTTCGATTGTATGATCTTGCAGTCC
GGTATGTTTTCAAGATTTACTCCGTCGAAGTATCTTACCTTCGTAAGTTTGGCCATGGAAAATAACTGGTTTTTG
GAAGAAGGCTGGGGCCTCTTCTTGGTAACATACTTTTCCGTTTTTGTCAGCATAGGTGACATTGATAGTTGTTGA
AGCAAGGAGGCCATTACTCCAGGTGTGGAATAGAAGGGCTCGGTCAAGAATTACAACAACGTGGTATCTCTCGTC
AGGCTCAGTGGGGTGCTCAAGGCATTGCGTGAGTGACAATATTCAGTAGAGCTCAGCCTTGTGACGGTATTGCAG
AAAACACATGACAAAAATGGTTGGAATAAAGCCACAACAATCACTCAAAAGGTCCCTTTTTACTACGGACATTGG
AATTCAGACAGAAGTTCCAGTGGGTGATATCGCTGGACTCTCGCAAGTAAAAGCAAGCAGAGCTGTTTCTCGAAA
TGGCAAAAAGTTGGATTTGGACGCAAGCGATCTTGGTTCAATCTTGAAGTGGAGCACAGATATCGCCAGTGACAT
CAATCTGTTCTTTGGTATGTCCTTGTTACATGAATTATTCAGGTTAATCCAATCTATATTAGCCTTGAGGCGACT
GACAGAAATTGCGACTGGTACAATCTCCTGGCAGCTTCATTCCTCCAGTAGGTTGACTGTTTTTTTCGACTAGAA
ACCTCTGAGTCGCAAAATGCCTGTGGTATGGGATACCGACATGGGTACTGTCTTTTGTTACTGACTTAATACTCC
AGTCGCGATTGCATTGGATGGTGGCGAGTACACCATAGCAACAAGCATGAAGCCACCGAGTACCTGCGTAGTACC
TGAGTACATCAGACTCTTTTTTCCTTTGGATCATTCTCATGAACTACCAGGCATCCACAATCTATACGGGCTATT
GATGATCCGCTCTCAAGAGCTATCATTCAACACGGTGAGTCGAAGCATTCTGCAGTTACACGCAGCTGCTAACAT
AGCTGCTTCTCCTATAGCTATTAATACCAGGGAAAAAATTGTTTATGACGACGCATCCAACGATCCTCGCTTCTC
TTCCGAGGCAGGCCAATCAGAACACAAATCCGTTCTCTGTCTGCCCATTATCAGCAACCGAGATCAAACTCTCGG
CGCAGCCTATTTCGCCTCAAAGTTTCCTTTTTCAAAACATATCGTAACGATGCTCACACTCTTATGTCAACAGGC
GAGCATCAGCATTTCCAATGCCCTCTATTTTCGGTCTGTCCAAGCCGGAACGCGAGAGAATCTTAAAATGATTGC
TGCTCAGCGCGATTCACTAGAGGATGCTAGACGGAGCAGAGAGGATGCTCTGAAAGCCACTAAGGTATGTGGAAA
GAACTTAATGCCCTTTGAACATGACACTCACGCACTGAGTCTAGACCAAGAGCAACTTCCTGGCCTCAATGAGCC
ATGAATTGAGAACGCCTTTCAGGTTTGTCTCGATCGAATCAGAGAGTTCTGAACTAACCCTTATGTTCAGCTCTT
TTTATGGACTACTTGACCTTCTGTCTGGGACAGAACTCAATCCAGGGCAAAGTGAAATAGTACAAACCGCCAAGC
AATCCTGCGAGCAACTACTCAAGGTCATTCACTTTTCGTCCTGTAGTAGCACAGTATTCATCCCGAGCACAGATC
ATCGATTCTATCTTAGACTATAGCAAGCTAGAAGCATCTGGTAAGCTCCCTATGAAGGTTGTAATCCCAGGGTCA
CGTAGTTTCCATAGCCGTCAAACTTGAACCGAGCGGTTTTGCTTTTGAGGTGCGACTTCGTCTCTCAGCCCGTTC
CCGATGCTCATCGTAAAAACAGAACATAATAGCGGTACGCGCTTAAATTTCAGAAGAGTACTCAGTACTCAGGCT
CCTCCAGGACTGCATGGAGCTACTTCTACCAATGGCTGCAAAGAAACTTGATTTATCCTACAACATTGAGCCTGA
CGTCCCCGAGTGTATGCACCTTAGAGTCATCGAAGTACATATTGCTCATACAGATGCAGGGATTTATGCTGATAA
TGCTCGAATATCCCAAGGTGCTGCTTACCTTCTGGTTCATTGTTATCAATACTAACAAGAGACCTAGTTCTGATG
AATCTCATCGGAAACGCTATCAAATTCACCACCAGGGGTTATGTTCGTGTCAATGTCTCCGTTGAAGAAAGTCCA
CCCGGCACTACGCCGGAAAATGCAACGCTTATCAAGGTTGATATTACGTTAGTTAAAAGTGCATCTGCCATATGA
CTGTATCTCACCTCTATGCAGTGATACTGGAATCGGGCTAGCATCAACAGATGTGGCTTTACTTTTTGTTCCTTT
CCAGCAGGCAGATGTGCGTACCTCAGTTGATTTATTGTCCCCAGAATTAATGACTCAGGACTTGCTGTGACTGAT
CAGAATTCCTCGACGCGTCGTTTCGGAGGGACAGGTCTAGGACTTTCAATATCGAGACAATTAATCAAACTTATG
GATGGAGCGATCGGAGTTTCCTCGGAGCTCAATGTCGGTTCTCGGTTCTGGTTCAACATGCCTGTAAAACCATAT
TCTTCAGAGGAGAGCCGGAACGTGCGTAATCTTCCTATCTTATGAATTATGCCCTCTTTAAACCAAATCAGGCCA
TTGCAGAGTTGCAGCAGCTGAAAACAAACCTCAACAAGAATCGACCCCTCGAAATGCTTGTTTACTCACCCTCAG
AAGCTACTGTTAGATATCTCAACACAATCCTCAGTGGATCTCACATATCTTCCACGACCAGTACGAGTGTTCTCA
GAGACCAGATATATGCATATGCGACGGCTCGGATTCCGATCGACTTTATCGTCTTGGATGACCAGACAGAGGGCG
GCGCCGAGCGTCTTATCCAAGAACTGGAGATCATAGGTTACTTTGAAACTAGGGTCATACATCTTCACACCCCAA
TGATCGGTCAACTGGGACAACCTGTTTTTCCTTTGGACAAGCATCCAAATATCTTCAGACTCACGAAACCTCCGA
GAAAGTCTCGCATCCTACAAGCAATCGCTGAATTGAAAAATGTGCCCAATAAATTATCTACTATGCCTGCATTTG
AACTTCCCAAGGCCGAGGAAGCACTTCTAGCACAACGGACGCTGTATGGGAATGTGTTAATCGCTGAAGGTGACG
CATTACCCTGTTGTTTCCTTGTACTTAAACCAATCGCACCCCTAGACAATCCCATTGCTCAAAGTTTACTGGTAA
AACAACTAGAAAGACAAGATCTCACTGTAACGGCGACAAACAATGGGGAGGAAGCAATTGCTGGTACGTATTGTA
ACAAACAAAGATGGCGAAGTGTACACCGAATGTCCATATGTTTTTCAGAGTGGGAAAAACATGACCCTGGATACT
TTCAGGTCGCTTTGTTTGATCATCGTAAGTGGGTTTGCACTTCAGTCGAGCTAACTTCTAATCCTTGAGCTAGAT
ATGCCAGTTTGTGATGGCGTTGAGGCAACCAAACGTTTACGAGTACTCGAAAATAAACGAAAGGCACAGTTTCTC
TTACCGAGTAAGCGGTGGCAGATACCAAATATCTATTCACTGACCTTCGAAATTGTAGTTGTCGCACTTAGTGCG
GATTGTCAAGAAGTTACTAAACAGCTATGCCTGAGTGCAGGAATGAATGCCTTCTTCACTAAACCTATGAAAAAA
AGTAAAAACATTGCTTAGAAAGATATGTATCAACCCTAACTTTTTGTCAGGTGACCTTTTTACGCTACTTTCGAT
GTTTGGATCTGGACACAACAACTCTGAGTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail