Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|009060
Gene name
Locationscaffold_01a:2118405..2120858
Strand-
Gene length (bp)2453
Transcript length (bp)2211
Coding sequence length (bp)2211
Protein length (aa) 737

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04003 Utp12 Dip2/Utp12 Family 1.6E-24 507 624

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HE11|UTP5_SCHPO U3 small nucleolar RNA-associated protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp5 PE=3 SV=2 91 725 2.0E-23
sp|Q15061|WDR43_HUMAN WD repeat-containing protein 43 OS=Homo sapiens GN=WDR43 PE=1 SV=3 71 626 3.0E-21
sp|Q04177|UTP5_YEAST U3 small nucleolar RNA-associated protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP5 PE=1 SV=1 499 627 2.0E-13
sp|Q6ZQL4|WDR43_MOUSE WD repeat-containing protein 43 OS=Mus musculus GN=Wdr43 PE=2 SV=2 484 626 3.0E-13
sp|Q9Y7N1|YCK3_SCHPO Uncharacterized protein C1450.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1450.03 PE=1 SV=1 496 680 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HE11|UTP5_SCHPO U3 small nucleolar RNA-associated protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp5 PE=3 SV=2 91 725 2.0E-23
sp|Q15061|WDR43_HUMAN WD repeat-containing protein 43 OS=Homo sapiens GN=WDR43 PE=1 SV=3 71 626 3.0E-21
sp|Q04177|UTP5_YEAST U3 small nucleolar RNA-associated protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP5 PE=1 SV=1 499 627 2.0E-13
sp|Q6ZQL4|WDR43_MOUSE WD repeat-containing protein 43 OS=Mus musculus GN=Wdr43 PE=2 SV=2 484 626 3.0E-13
sp|Q9Y7N1|YCK3_SCHPO Uncharacterized protein C1450.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1450.03 PE=1 SV=1 496 680 1.0E-09
sp|Q6ZQL4|WDR43_MOUSE WD repeat-containing protein 43 OS=Mus musculus GN=Wdr43 PE=2 SV=2 68 302 1.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID5
Orthogroup1599
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|009060
Agaricus bisporus var bisporus H97 AgabiH97|009060
Agaricus bisporus var burnettii H119p4 Agabi119p4|009060 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|009060
MPDPRPWHKYPSRPSKIYPLKPHPHPFHPAVIILRQAIADHVVDIARISSMTWCALDTTAANSSGTPQPSKKKKR
KRDSALISDVKNKATEIVVLGLSDGRILCFSPSHGRVLYSLSHASSASAILATAVEEYEDQWLVWASGADSTLRM
WDMKTNNIIANWKNDDRIPYTSLKIRPCDVDGRTDILAASHSIYLLSKSASAGTTDPKKLHKAATFTGHASPVKS
TTWDLSKPVPARFFSMAESDRFVYVWDILDSPDVSGKAVASIPLDAAARSFAVATSAEPTGPSTLLALSASGKIT
LYHVPDQIITASTSNRSSSTLPTLHFRSSIIATSESAQSPSDIIDVSFVHGRPGSICVARLVRGIRPVFTTVRYL
DDAGRFIENIQLEDVPDVSLEDKQPLIHHQRYSESSVAVGSSMELGYDENPDETTSRNMDGELDVNLAELSLGQR
LATVTDADYHQPSDSESEDVTHSRSSRVTNKKEKSELDVIPANSLTRTLIQALHSSDTKLIETCLAHSNSDLIRN
TVKRLPSQLAIPLLNACVERLGRGARAANMKGGGAAASAQRGMTLIIWIRTVLTFHMGHLMTVPDLVARLSGLHA
TLTARLALQESLLSLSGRLDVVLSQIEMRSSLPPTIVATTNGKRQGATRENFVKQYVEGESDSSGDDNDQMDVEL
EIGDDEGSIEDVELGGSSEGSEDDQDEDGEEKEEEDDGSGSDGFIDDEAEEYSEDDEDESE*
Coding >Agabi119p4|009060
ATGCCAGACCCCCGTCCATGGCACAAATATCCCAGCCGGCCGTCCAAGATATACCCACTCAAGCCGCATCCTCAT
CCTTTTCACCCAGCGGTGATTATTTTGCGACAAGCCATTGCAGATCACGTCGTCGATATTGCACGCATATCCTCT
ATGACCTGGTGTGCCCTAGACACAACAGCAGCGAATAGCTCAGGCACTCCTCAGCCGAGCAAGAAGAAGAAGAGG
AAACGTGATAGTGCTCTGATATCTGACGTCAAAAATAAAGCGACTGAAATTGTGGTTTTGGGCTTGTCTGATGGG
AGGATCCTCTGCTTTTCACCCTCACATGGCCGCGTGCTGTACTCGCTATCTCACGCATCTAGTGCTTCTGCGATC
TTGGCTACCGCTGTTGAGGAGTACGAGGACCAGTGGCTCGTATGGGCGTCCGGTGCAGATAGTACGCTTCGGATG
TGGGACATGAAGACGAATAACATTATAGCGAATTGGAAAAACGATGATCGGATACCCTACACATCTTTGAAAATA
CGACCTTGCGATGTAGATGGCCGAACTGATATTCTTGCTGCAAGTCATAGCATCTACTTGCTGTCCAAGTCTGCA
TCGGCAGGAACAACCGACCCTAAGAAACTTCACAAAGCAGCCACATTTACCGGACATGCATCCCCTGTCAAATCG
ACGACGTGGGACCTTTCAAAACCTGTGCCTGCAAGGTTCTTCTCTATGGCTGAATCTGACCGCTTCGTCTACGTT
TGGGATATCCTTGACTCACCTGACGTTAGTGGCAAAGCTGTAGCATCTATACCACTAGACGCTGCTGCAAGGTCA
TTTGCTGTTGCGACTTCTGCAGAGCCTACCGGCCCTTCGACCCTCCTCGCTCTTTCAGCATCCGGAAAAATCACC
CTATACCATGTTCCTGATCAAATCATCACCGCTAGCACATCAAACCGTTCTTCTTCAACTCTACCTACACTTCAT
TTTCGGTCCAGCATCATAGCCACCTCTGAAAGCGCGCAATCCCCCTCAGACATAATCGACGTATCATTTGTGCAC
GGGAGACCTGGAAGTATATGTGTGGCGCGACTTGTCCGAGGCATTCGACCAGTGTTCACCACAGTGCGCTATCTA
GACGACGCAGGTCGTTTTATCGAAAATATACAACTTGAGGACGTCCCGGACGTGTCACTTGAGGACAAGCAACCT
CTCATTCACCATCAGCGGTACAGTGAATCTTCTGTTGCAGTTGGTTCCAGCATGGAATTAGGTTATGATGAAAAT
CCCGATGAAACAACATCCCGAAATATGGATGGGGAGCTCGATGTTAATCTTGCGGAACTCTCTCTGGGTCAGAGA
TTGGCAACTGTGACCGATGCCGATTACCATCAACCGTCTGATAGTGAAAGCGAAGATGTTACTCACTCGAGAAGT
TCTCGAGTAACAAACAAGAAAGAAAAATCGGAATTAGACGTCATTCCTGCGAATTCACTCACACGGACACTCATT
CAGGCTCTACATTCTTCTGACACAAAACTCATAGAGACTTGTTTGGCTCATTCGAATTCAGACCTCATTCGAAAT
ACAGTCAAGAGGTTACCTTCCCAGCTGGCCATACCGCTCCTTAACGCATGTGTTGAGAGGCTGGGCAGAGGTGCG
AGAGCTGCTAACATGAAAGGTGGGGGGGCTGCAGCAAGTGCTCAGCGTGGTATGACCTTGATCATCTGGATTAGG
ACCGTTCTGACCTTTCACATGGGCCATCTTATGACGGTACCGGATCTCGTGGCTCGACTCTCTGGCCTTCATGCC
ACGTTAACTGCTCGCTTGGCACTCCAGGAAAGCCTTCTTTCACTGAGTGGAAGGTTGGATGTGGTGCTGTCGCAG
ATTGAGATGCGATCCTCGCTTCCACCTACCATCGTTGCAACAACAAATGGCAAGCGTCAAGGTGCCACAAGAGAG
AACTTCGTGAAACAATATGTTGAAGGCGAAAGTGACTCCAGTGGGGATGATAACGACCAAATGGACGTAGAACTC
GAAATAGGCGATGATGAAGGTAGTATAGAAGACGTTGAGCTTGGCGGTAGCAGCGAGGGGAGTGAAGATGATCAA
GATGAAGATGGGGAAGAGAAGGAGGAAGAAGACGATGGTTCAGGTTCGGATGGCTTCATCGATGATGAGGCTGAA
GAATATAGTGAGGATGATGAAGACGAGAGCGAGTGA
Transcript >Agabi119p4|009060
ATGCCAGACCCCCGTCCATGGCACAAATATCCCAGCCGGCCGTCCAAGATATACCCACTCAAGCCGCATCCTCAT
CCTTTTCACCCAGCGGTGATTATTTTGCGACAAGCCATTGCAGATCACGTCGTCGATATTGCACGCATATCCTCT
ATGACCTGGTGTGCCCTAGACACAACAGCAGCGAATAGCTCAGGCACTCCTCAGCCGAGCAAGAAGAAGAAGAGG
AAACGTGATAGTGCTCTGATATCTGACGTCAAAAATAAAGCGACTGAAATTGTGGTTTTGGGCTTGTCTGATGGG
AGGATCCTCTGCTTTTCACCCTCACATGGCCGCGTGCTGTACTCGCTATCTCACGCATCTAGTGCTTCTGCGATC
TTGGCTACCGCTGTTGAGGAGTACGAGGACCAGTGGCTCGTATGGGCGTCCGGTGCAGATAGTACGCTTCGGATG
TGGGACATGAAGACGAATAACATTATAGCGAATTGGAAAAACGATGATCGGATACCCTACACATCTTTGAAAATA
CGACCTTGCGATGTAGATGGCCGAACTGATATTCTTGCTGCAAGTCATAGCATCTACTTGCTGTCCAAGTCTGCA
TCGGCAGGAACAACCGACCCTAAGAAACTTCACAAAGCAGCCACATTTACCGGACATGCATCCCCTGTCAAATCG
ACGACGTGGGACCTTTCAAAACCTGTGCCTGCAAGGTTCTTCTCTATGGCTGAATCTGACCGCTTCGTCTACGTT
TGGGATATCCTTGACTCACCTGACGTTAGTGGCAAAGCTGTAGCATCTATACCACTAGACGCTGCTGCAAGGTCA
TTTGCTGTTGCGACTTCTGCAGAGCCTACCGGCCCTTCGACCCTCCTCGCTCTTTCAGCATCCGGAAAAATCACC
CTATACCATGTTCCTGATCAAATCATCACCGCTAGCACATCAAACCGTTCTTCTTCAACTCTACCTACACTTCAT
TTTCGGTCCAGCATCATAGCCACCTCTGAAAGCGCGCAATCCCCCTCAGACATAATCGACGTATCATTTGTGCAC
GGGAGACCTGGAAGTATATGTGTGGCGCGACTTGTCCGAGGCATTCGACCAGTGTTCACCACAGTGCGCTATCTA
GACGACGCAGGTCGTTTTATCGAAAATATACAACTTGAGGACGTCCCGGACGTGTCACTTGAGGACAAGCAACCT
CTCATTCACCATCAGCGGTACAGTGAATCTTCTGTTGCAGTTGGTTCCAGCATGGAATTAGGTTATGATGAAAAT
CCCGATGAAACAACATCCCGAAATATGGATGGGGAGCTCGATGTTAATCTTGCGGAACTCTCTCTGGGTCAGAGA
TTGGCAACTGTGACCGATGCCGATTACCATCAACCGTCTGATAGTGAAAGCGAAGATGTTACTCACTCGAGAAGT
TCTCGAGTAACAAACAAGAAAGAAAAATCGGAATTAGACGTCATTCCTGCGAATTCACTCACACGGACACTCATT
CAGGCTCTACATTCTTCTGACACAAAACTCATAGAGACTTGTTTGGCTCATTCGAATTCAGACCTCATTCGAAAT
ACAGTCAAGAGGTTACCTTCCCAGCTGGCCATACCGCTCCTTAACGCATGTGTTGAGAGGCTGGGCAGAGGTGCG
AGAGCTGCTAACATGAAAGGTGGGGGGGCTGCAGCAAGTGCTCAGCGTGGTATGACCTTGATCATCTGGATTAGG
ACCGTTCTGACCTTTCACATGGGCCATCTTATGACGGTACCGGATCTCGTGGCTCGACTCTCTGGCCTTCATGCC
ACGTTAACTGCTCGCTTGGCACTCCAGGAAAGCCTTCTTTCACTGAGTGGAAGGTTGGATGTGGTGCTGTCGCAG
ATTGAGATGCGATCCTCGCTTCCACCTACCATCGTTGCAACAACAAATGGCAAGCGTCAAGGTGCCACAAGAGAG
AACTTCGTGAAACAATATGTTGAAGGCGAAAGTGACTCCAGTGGGGATGATAACGACCAAATGGACGTAGAACTC
GAAATAGGCGATGATGAAGGTAGTATAGAAGACGTTGAGCTTGGCGGTAGCAGCGAGGGGAGTGAAGATGATCAA
GATGAAGATGGGGAAGAGAAGGAGGAAGAAGACGATGGTTCAGGTTCGGATGGCTTCATCGATGATGAGGCTGAA
GAATATAGTGAGGATGATGAAGACGAGAGCGAGTGA
Gene >Agabi119p4|009060
ATGCCAGACCCCCGTCCATGGCACAAATATCCCAGCCGGCCGTCCAAGATATACCCACTCAAGCCGCATCCTCAT
CCTTTTCACCCAGCGGTGATTATTTTGCGTATGTATCCCTTGCGGTGGATAAAAACAGACTACGTGTCTACAATG
CCACCACAGGACAAGCCATTGCAGATCACGTCGTCGATATTGCACGCATATCCTCTATGACCTGGTGTGCCCTAG
ACACAACAGCAGCGAATAGCTCAGGCACTCCTCAGCCGAGCAAGAAGAAGAAGAGGAAACGTGATAGTGCTCTGA
TATCTGACGTCAAAAATAAAGCGACTGAAATTGTGGTTTTGGGCTTGTCTGATGGGAGGATCCTCTGCTTTTCAC
CCTCACATGGCCGCGTGCTGTACTCGCTATCTCACGCATCTAGTGCTTCTGCGATCTTGGCTACCGCTGTTGAGG
AGTACGAGGACCAGTGGCTCGTATGGGCGTCCGGTGCAGATAGTACGCTTCGGATGTGGGACATGAAGACGAATA
ACATTATAGCGAATTGGAAAAACGATGATCGGATACCCTACACATCTTTGAAAATACGACCTTGCGATGTAGATG
GCCGAACTGATATTCTTGCTGCAAGTCATAGCATCTACTTGCTGTCCAAGTCTGCATCGGCAGGAACAACCGACC
CTAAGAAACTTCACAAAGCAGCCACATTTACCGGACATGCATCCCCTGTCAAATCGACGACGTGGGACCTTTCAA
AACCTGTGCCTGCAAGGTTCTTCTCTATGGCTGAATCTGACCGCTTCGTCTACGTTTGGGATATCCTTGACTCAC
CTGACGTTAGTGGCAAAGCTGTAGCATCTATACCACTAGACGCTGCTGCAAGGTCATTTGCTGTTGCGACTTCTG
CAGAGCCTACCGGCCCTTCGACCCTCCTCGCTCTTTCAGCATCCGGAAAAATCACCCTATACCATGTTCCTGATC
AAATCATCACCGCTAGCACATCAAACCGTTCTTCTTCAACTCTACCTACACTTCATTTTCGGTCCAGCATCATAG
CCACCTCTGAAAGCGCGCAATCCCCCTCAGACATAATCGACGTATCATTTGTGCACGGGAGACCTGGAAGTATAT
GTGTGGCGCGACTTGTCCGAGGCATTCGACCAGTGTTCACCACAGTGGTACGCAGTTCTTTTCTTCATGGCGCAG
TTCTGGGGCTCAAAAATCGTTACAGCGCTATCTAGACGACGCAGGTCGTTTTATCGAAAATATACAACTTGAGGA
CGTCCCGGACGTGTCACTTGAGGACAAGCAACCTGTAAGGGGTATATTCCTTCGTTTTCGAAATACTGTATTAAA
CACAGAAATATTGTTCAATTTTTCTTGCAGCTCATTCACCATCAGCGGTACAGTGAATCTTCTGTTGCAGTTGGT
TCCAGCATGGAATTAGGTTATGATGAAAATCCCGATGAAACAACATCCCGAAATATGGATGGGGAGCTCGATGTT
AATCTTGCGGAACTCTCTCTGGGTCAGAGATTGGCAACTGTGACCGATGCCGATTACCATCAACCGTCTGATAGT
GAAAGCGAAGATGTTACTCACTCGAGAAGTTCTCGAGTAACAAACAAGAAAGAAAAATCGGAATTAGACGTCATT
CCTGCGAATTCACTCACACGGACACTCATTCAGGCTCTACATTCTTCTGACACAAAACTCATAGAGACTTGTTTG
GCTCATTCGAATTCAGACCTCATTCGAAATACAGTCAAGAGGTTACCTTCCCAGCTGGCCATACCGCTCCTTAAC
GCATGTGTTGAGAGGCTGGGCAGAGGTGCGAGAGCTGCTAACATGAAAGGTGGGGGGGCTGCAGCAAGTGCTCAG
CGTGGTATGACCTTGATCATCTGGATTAGGACCGTTCTGACCTTTCACATGGGCCATCTTATGACGGCAAGCGCT
TTTCCTTAATCAGCAAAAGATACAACATTGATCATCGCGTGTGACGCTCATAGGTACCGGATCTCGTGGCTCGAC
TCTCTGGCCTTCATGCCACGTTAACTGCTCGCTTGGCACTCCAGGAAAGCCTTCTTTCACTGAGTGGAAGGTTGG
ATGTGGTGCTGTCGCAGATTGAGATGCGATCCTCGCTTCCACCTACCATCGTTGCAACAACAAATGGCAAGCGTC
AAGGTGCCACAAGAGAGAACTTCGTGAAACAATATGTTGAAGGCGAAAGTGACTCCAGTGGGGATGATAACGACC
AAATGGACGTAGAACTCGAAATAGGCGATGATGAAGGTAGTATAGAAGACGTTGAGCTTGGCGGTAGCAGCGAGG
GGAGTGAAGATGATCAAGATGAAGATGGGGAAGAGAAGGAGGAAGAAGACGATGGTTCAGGTTCGGATGGCTTCA
TCGATGATGAGGCTGAAGAATATAGTGAGGATGATGAAGACGAGAGCGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail