Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|009060
Gene name
Locationscaffold_01a:2118405..2120858
Strand-
Gene length (bp)2453
Transcript length (bp)2211
Coding sequence length (bp)2211
Protein length (aa) 737

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04003 Utp12 Dip2/Utp12 Family 1.6E-24 507 624

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HE11|UTP5_SCHPO U3 small nucleolar RNA-associated protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp5 PE=3 SV=2 91 725 2.0E-23
sp|Q15061|WDR43_HUMAN WD repeat-containing protein 43 OS=Homo sapiens GN=WDR43 PE=1 SV=3 71 626 3.0E-21
sp|Q04177|UTP5_YEAST U3 small nucleolar RNA-associated protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP5 PE=1 SV=1 499 627 2.0E-13
sp|Q6ZQL4|WDR43_MOUSE WD repeat-containing protein 43 OS=Mus musculus GN=Wdr43 PE=2 SV=2 484 626 3.0E-13
sp|Q9Y7N1|YCK3_SCHPO Uncharacterized protein C1450.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1450.03 PE=1 SV=1 496 680 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HE11|UTP5_SCHPO U3 small nucleolar RNA-associated protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp5 PE=3 SV=2 91 725 2.0E-23
sp|Q15061|WDR43_HUMAN WD repeat-containing protein 43 OS=Homo sapiens GN=WDR43 PE=1 SV=3 71 626 3.0E-21
sp|Q04177|UTP5_YEAST U3 small nucleolar RNA-associated protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP5 PE=1 SV=1 499 627 2.0E-13
sp|Q6ZQL4|WDR43_MOUSE WD repeat-containing protein 43 OS=Mus musculus GN=Wdr43 PE=2 SV=2 484 626 3.0E-13
sp|Q9Y7N1|YCK3_SCHPO Uncharacterized protein C1450.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1450.03 PE=1 SV=1 496 680 1.0E-09
sp|Q6ZQL4|WDR43_MOUSE WD repeat-containing protein 43 OS=Mus musculus GN=Wdr43 PE=2 SV=2 68 302 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|009060
MPDPRPWHKYPSRPSKIYPLKPHPHPFHPAVIILRQAIADHVVDIARISSMTWCALDTTAANSSGTPQPSKKKKR
KRDSALISDVKNKATEIVVLGLSDGRILCFSPSHGRVLYSLSHASSASAILATAVEEYEDQWLVWASGADSTLRM
WDMKTNNIIANWKNDDRIPYTSLKIRPCDVDGRTDILAASHSIYLLSKSASAGTTDPKKLHKAATFTGHASPVKS
TTWDLSKPVPARFFSMAESDRFVYVWDILDSPDVSGKAVASIPLDAAARSFAVATSAEPTGPSTLLALSASGKIT
LYHVPDQIITASTSNRSSSTLPTLHFRSSIIATSESAQSPSDIIDVSFVHGRPGSICVARLVRGIRPVFTTVRYL
DDAGRFIENIQLEDVPDVSLEDKQPLIHHQRYSESSVAVGSSMELGYDENPDETTSRNMDGELDVNLAELSLGQR
LATVTDADYHQPSDSESEDVTHSRSSRVTNKKEKSELDVIPANSLTRTLIQALHSSDTKLIETCLAHSNSDLIRN
TVKRLPSQLAIPLLNACVERLGRGARAANMKGGGAAASAQRGMTLIIWIRTVLTFHMGHLMTVPDLVARLSGLHA
TLTARLALQESLLSLSGRLDVVLSQIEMRSSLPPTIVATTNGKRQGATRENFVKQYVEGESDSSGDDNDQMDVEL
EIGDDEGSIEDVELGGSSEGSEDDQDEDGEEKEEEDDGSGSDGFIDDEAEEYSEDDEDESE*
Coding >Agabi119p4|009060
ATGCCAGACCCCCGTCCATGGCACAAATATCCCAGCCGGCCGTCCAAGATATACCCACTCAAGCCGCATCCTCAT
CCTTTTCACCCAGCGGTGATTATTTTGCGACAAGCCATTGCAGATCACGTCGTCGATATTGCACGCATATCCTCT
ATGACCTGGTGTGCCCTAGACACAACAGCAGCGAATAGCTCAGGCACTCCTCAGCCGAGCAAGAAGAAGAAGAGG
AAACGTGATAGTGCTCTGATATCTGACGTCAAAAATAAAGCGACTGAAATTGTGGTTTTGGGCTTGTCTGATGGG
AGGATCCTCTGCTTTTCACCCTCACATGGCCGCGTGCTGTACTCGCTATCTCACGCATCTAGTGCTTCTGCGATC
TTGGCTACCGCTGTTGAGGAGTACGAGGACCAGTGGCTCGTATGGGCGTCCGGTGCAGATAGTACGCTTCGGATG
TGGGACATGAAGACGAATAACATTATAGCGAATTGGAAAAACGATGATCGGATACCCTACACATCTTTGAAAATA
CGACCTTGCGATGTAGATGGCCGAACTGATATTCTTGCTGCAAGTCATAGCATCTACTTGCTGTCCAAGTCTGCA
TCGGCAGGAACAACCGACCCTAAGAAACTTCACAAAGCAGCCACATTTACCGGACATGCATCCCCTGTCAAATCG
ACGACGTGGGACCTTTCAAAACCTGTGCCTGCAAGGTTCTTCTCTATGGCTGAATCTGACCGCTTCGTCTACGTT
TGGGATATCCTTGACTCACCTGACGTTAGTGGCAAAGCTGTAGCATCTATACCACTAGACGCTGCTGCAAGGTCA
TTTGCTGTTGCGACTTCTGCAGAGCCTACCGGCCCTTCGACCCTCCTCGCTCTTTCAGCATCCGGAAAAATCACC
CTATACCATGTTCCTGATCAAATCATCACCGCTAGCACATCAAACCGTTCTTCTTCAACTCTACCTACACTTCAT
TTTCGGTCCAGCATCATAGCCACCTCTGAAAGCGCGCAATCCCCCTCAGACATAATCGACGTATCATTTGTGCAC
GGGAGACCTGGAAGTATATGTGTGGCGCGACTTGTCCGAGGCATTCGACCAGTGTTCACCACAGTGCGCTATCTA
GACGACGCAGGTCGTTTTATCGAAAATATACAACTTGAGGACGTCCCGGACGTGTCACTTGAGGACAAGCAACCT
CTCATTCACCATCAGCGGTACAGTGAATCTTCTGTTGCAGTTGGTTCCAGCATGGAATTAGGTTATGATGAAAAT
CCCGATGAAACAACATCCCGAAATATGGATGGGGAGCTCGATGTTAATCTTGCGGAACTCTCTCTGGGTCAGAGA
TTGGCAACTGTGACCGATGCCGATTACCATCAACCGTCTGATAGTGAAAGCGAAGATGTTACTCACTCGAGAAGT
TCTCGAGTAACAAACAAGAAAGAAAAATCGGAATTAGACGTCATTCCTGCGAATTCACTCACACGGACACTCATT
CAGGCTCTACATTCTTCTGACACAAAACTCATAGAGACTTGTTTGGCTCATTCGAATTCAGACCTCATTCGAAAT
ACAGTCAAGAGGTTACCTTCCCAGCTGGCCATACCGCTCCTTAACGCATGTGTTGAGAGGCTGGGCAGAGGTGCG
AGAGCTGCTAACATGAAAGGTGGGGGGGCTGCAGCAAGTGCTCAGCGTGGTATGACCTTGATCATCTGGATTAGG
ACCGTTCTGACCTTTCACATGGGCCATCTTATGACGGTACCGGATCTCGTGGCTCGACTCTCTGGCCTTCATGCC
ACGTTAACTGCTCGCTTGGCACTCCAGGAAAGCCTTCTTTCACTGAGTGGAAGGTTGGATGTGGTGCTGTCGCAG
ATTGAGATGCGATCCTCGCTTCCACCTACCATCGTTGCAACAACAAATGGCAAGCGTCAAGGTGCCACAAGAGAG
AACTTCGTGAAACAATATGTTGAAGGCGAAAGTGACTCCAGTGGGGATGATAACGACCAAATGGACGTAGAACTC
GAAATAGGCGATGATGAAGGTAGTATAGAAGACGTTGAGCTTGGCGGTAGCAGCGAGGGGAGTGAAGATGATCAA
GATGAAGATGGGGAAGAGAAGGAGGAAGAAGACGATGGTTCAGGTTCGGATGGCTTCATCGATGATGAGGCTGAA
GAATATAGTGAGGATGATGAAGACGAGAGCGAGTGA
Transcript >Agabi119p4|009060
ATGCCAGACCCCCGTCCATGGCACAAATATCCCAGCCGGCCGTCCAAGATATACCCACTCAAGCCGCATCCTCAT
CCTTTTCACCCAGCGGTGATTATTTTGCGACAAGCCATTGCAGATCACGTCGTCGATATTGCACGCATATCCTCT
ATGACCTGGTGTGCCCTAGACACAACAGCAGCGAATAGCTCAGGCACTCCTCAGCCGAGCAAGAAGAAGAAGAGG
AAACGTGATAGTGCTCTGATATCTGACGTCAAAAATAAAGCGACTGAAATTGTGGTTTTGGGCTTGTCTGATGGG
AGGATCCTCTGCTTTTCACCCTCACATGGCCGCGTGCTGTACTCGCTATCTCACGCATCTAGTGCTTCTGCGATC
TTGGCTACCGCTGTTGAGGAGTACGAGGACCAGTGGCTCGTATGGGCGTCCGGTGCAGATAGTACGCTTCGGATG
TGGGACATGAAGACGAATAACATTATAGCGAATTGGAAAAACGATGATCGGATACCCTACACATCTTTGAAAATA
CGACCTTGCGATGTAGATGGCCGAACTGATATTCTTGCTGCAAGTCATAGCATCTACTTGCTGTCCAAGTCTGCA
TCGGCAGGAACAACCGACCCTAAGAAACTTCACAAAGCAGCCACATTTACCGGACATGCATCCCCTGTCAAATCG
ACGACGTGGGACCTTTCAAAACCTGTGCCTGCAAGGTTCTTCTCTATGGCTGAATCTGACCGCTTCGTCTACGTT
TGGGATATCCTTGACTCACCTGACGTTAGTGGCAAAGCTGTAGCATCTATACCACTAGACGCTGCTGCAAGGTCA
TTTGCTGTTGCGACTTCTGCAGAGCCTACCGGCCCTTCGACCCTCCTCGCTCTTTCAGCATCCGGAAAAATCACC
CTATACCATGTTCCTGATCAAATCATCACCGCTAGCACATCAAACCGTTCTTCTTCAACTCTACCTACACTTCAT
TTTCGGTCCAGCATCATAGCCACCTCTGAAAGCGCGCAATCCCCCTCAGACATAATCGACGTATCATTTGTGCAC
GGGAGACCTGGAAGTATATGTGTGGCGCGACTTGTCCGAGGCATTCGACCAGTGTTCACCACAGTGCGCTATCTA
GACGACGCAGGTCGTTTTATCGAAAATATACAACTTGAGGACGTCCCGGACGTGTCACTTGAGGACAAGCAACCT
CTCATTCACCATCAGCGGTACAGTGAATCTTCTGTTGCAGTTGGTTCCAGCATGGAATTAGGTTATGATGAAAAT
CCCGATGAAACAACATCCCGAAATATGGATGGGGAGCTCGATGTTAATCTTGCGGAACTCTCTCTGGGTCAGAGA
TTGGCAACTGTGACCGATGCCGATTACCATCAACCGTCTGATAGTGAAAGCGAAGATGTTACTCACTCGAGAAGT
TCTCGAGTAACAAACAAGAAAGAAAAATCGGAATTAGACGTCATTCCTGCGAATTCACTCACACGGACACTCATT
CAGGCTCTACATTCTTCTGACACAAAACTCATAGAGACTTGTTTGGCTCATTCGAATTCAGACCTCATTCGAAAT
ACAGTCAAGAGGTTACCTTCCCAGCTGGCCATACCGCTCCTTAACGCATGTGTTGAGAGGCTGGGCAGAGGTGCG
AGAGCTGCTAACATGAAAGGTGGGGGGGCTGCAGCAAGTGCTCAGCGTGGTATGACCTTGATCATCTGGATTAGG
ACCGTTCTGACCTTTCACATGGGCCATCTTATGACGGTACCGGATCTCGTGGCTCGACTCTCTGGCCTTCATGCC
ACGTTAACTGCTCGCTTGGCACTCCAGGAAAGCCTTCTTTCACTGAGTGGAAGGTTGGATGTGGTGCTGTCGCAG
ATTGAGATGCGATCCTCGCTTCCACCTACCATCGTTGCAACAACAAATGGCAAGCGTCAAGGTGCCACAAGAGAG
AACTTCGTGAAACAATATGTTGAAGGCGAAAGTGACTCCAGTGGGGATGATAACGACCAAATGGACGTAGAACTC
GAAATAGGCGATGATGAAGGTAGTATAGAAGACGTTGAGCTTGGCGGTAGCAGCGAGGGGAGTGAAGATGATCAA
GATGAAGATGGGGAAGAGAAGGAGGAAGAAGACGATGGTTCAGGTTCGGATGGCTTCATCGATGATGAGGCTGAA
GAATATAGTGAGGATGATGAAGACGAGAGCGAGTGA
Gene >Agabi119p4|009060
ATGCCAGACCCCCGTCCATGGCACAAATATCCCAGCCGGCCGTCCAAGATATACCCACTCAAGCCGCATCCTCAT
CCTTTTCACCCAGCGGTGATTATTTTGCGTATGTATCCCTTGCGGTGGATAAAAACAGACTACGTGTCTACAATG
CCACCACAGGACAAGCCATTGCAGATCACGTCGTCGATATTGCACGCATATCCTCTATGACCTGGTGTGCCCTAG
ACACAACAGCAGCGAATAGCTCAGGCACTCCTCAGCCGAGCAAGAAGAAGAAGAGGAAACGTGATAGTGCTCTGA
TATCTGACGTCAAAAATAAAGCGACTGAAATTGTGGTTTTGGGCTTGTCTGATGGGAGGATCCTCTGCTTTTCAC
CCTCACATGGCCGCGTGCTGTACTCGCTATCTCACGCATCTAGTGCTTCTGCGATCTTGGCTACCGCTGTTGAGG
AGTACGAGGACCAGTGGCTCGTATGGGCGTCCGGTGCAGATAGTACGCTTCGGATGTGGGACATGAAGACGAATA
ACATTATAGCGAATTGGAAAAACGATGATCGGATACCCTACACATCTTTGAAAATACGACCTTGCGATGTAGATG
GCCGAACTGATATTCTTGCTGCAAGTCATAGCATCTACTTGCTGTCCAAGTCTGCATCGGCAGGAACAACCGACC
CTAAGAAACTTCACAAAGCAGCCACATTTACCGGACATGCATCCCCTGTCAAATCGACGACGTGGGACCTTTCAA
AACCTGTGCCTGCAAGGTTCTTCTCTATGGCTGAATCTGACCGCTTCGTCTACGTTTGGGATATCCTTGACTCAC
CTGACGTTAGTGGCAAAGCTGTAGCATCTATACCACTAGACGCTGCTGCAAGGTCATTTGCTGTTGCGACTTCTG
CAGAGCCTACCGGCCCTTCGACCCTCCTCGCTCTTTCAGCATCCGGAAAAATCACCCTATACCATGTTCCTGATC
AAATCATCACCGCTAGCACATCAAACCGTTCTTCTTCAACTCTACCTACACTTCATTTTCGGTCCAGCATCATAG
CCACCTCTGAAAGCGCGCAATCCCCCTCAGACATAATCGACGTATCATTTGTGCACGGGAGACCTGGAAGTATAT
GTGTGGCGCGACTTGTCCGAGGCATTCGACCAGTGTTCACCACAGTGGTACGCAGTTCTTTTCTTCATGGCGCAG
TTCTGGGGCTCAAAAATCGTTACAGCGCTATCTAGACGACGCAGGTCGTTTTATCGAAAATATACAACTTGAGGA
CGTCCCGGACGTGTCACTTGAGGACAAGCAACCTGTAAGGGGTATATTCCTTCGTTTTCGAAATACTGTATTAAA
CACAGAAATATTGTTCAATTTTTCTTGCAGCTCATTCACCATCAGCGGTACAGTGAATCTTCTGTTGCAGTTGGT
TCCAGCATGGAATTAGGTTATGATGAAAATCCCGATGAAACAACATCCCGAAATATGGATGGGGAGCTCGATGTT
AATCTTGCGGAACTCTCTCTGGGTCAGAGATTGGCAACTGTGACCGATGCCGATTACCATCAACCGTCTGATAGT
GAAAGCGAAGATGTTACTCACTCGAGAAGTTCTCGAGTAACAAACAAGAAAGAAAAATCGGAATTAGACGTCATT
CCTGCGAATTCACTCACACGGACACTCATTCAGGCTCTACATTCTTCTGACACAAAACTCATAGAGACTTGTTTG
GCTCATTCGAATTCAGACCTCATTCGAAATACAGTCAAGAGGTTACCTTCCCAGCTGGCCATACCGCTCCTTAAC
GCATGTGTTGAGAGGCTGGGCAGAGGTGCGAGAGCTGCTAACATGAAAGGTGGGGGGGCTGCAGCAAGTGCTCAG
CGTGGTATGACCTTGATCATCTGGATTAGGACCGTTCTGACCTTTCACATGGGCCATCTTATGACGGCAAGCGCT
TTTCCTTAATCAGCAAAAGATACAACATTGATCATCGCGTGTGACGCTCATAGGTACCGGATCTCGTGGCTCGAC
TCTCTGGCCTTCATGCCACGTTAACTGCTCGCTTGGCACTCCAGGAAAGCCTTCTTTCACTGAGTGGAAGGTTGG
ATGTGGTGCTGTCGCAGATTGAGATGCGATCCTCGCTTCCACCTACCATCGTTGCAACAACAAATGGCAAGCGTC
AAGGTGCCACAAGAGAGAACTTCGTGAAACAATATGTTGAAGGCGAAAGTGACTCCAGTGGGGATGATAACGACC
AAATGGACGTAGAACTCGAAATAGGCGATGATGAAGGTAGTATAGAAGACGTTGAGCTTGGCGGTAGCAGCGAGG
GGAGTGAAGATGATCAAGATGAAGATGGGGAAGAGAAGGAGGAAGAAGACGATGGTTCAGGTTCGGATGGCTTCA
TCGATGATGAGGCTGAAGAATATAGTGAGGATGATGAAGACGAGAGCGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail