Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|009050
Gene name
Locationscaffold_01a:2116795..2118364
Strand+
Gene length (bp)1569
Transcript length (bp)1080
Coding sequence length (bp)1080
Protein length (aa) 360

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01149 Fapy_DNA_glyco Formamidopyrimidine-DNA glycosylase N-terminal domain 1.7E-29 1 138
PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain 7.7E-21 153 243

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O80358|FPG_ARATH Formamidopyrimidine-DNA glycosylase OS=Arabidopsis thaliana GN=FPG1 PE=1 SV=1 1 313 3.0E-74
sp|A5D0T6|FPG_PELTS Formamidopyrimidine-DNA glycosylase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=mutM PE=3 SV=1 1 295 6.0E-27
sp|A5UUN1|FPG_ROSS1 Formamidopyrimidine-DNA glycosylase OS=Roseiflexus sp. (strain RS-1) GN=mutM PE=3 SV=1 1 294 4.0E-25
sp|A7NQM8|FPG_ROSCS Formamidopyrimidine-DNA glycosylase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=mutM PE=3 SV=1 1 304 1.0E-24
sp|P19210|FPG_BACFI Formamidopyrimidine-DNA glycosylase OS=Bacillus firmus GN=mutM PE=3 SV=3 1 293 3.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O80358|FPG_ARATH Formamidopyrimidine-DNA glycosylase OS=Arabidopsis thaliana GN=FPG1 PE=1 SV=1 1 313 3.0E-74
sp|A5D0T6|FPG_PELTS Formamidopyrimidine-DNA glycosylase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=mutM PE=3 SV=1 1 295 6.0E-27
sp|A5UUN1|FPG_ROSS1 Formamidopyrimidine-DNA glycosylase OS=Roseiflexus sp. (strain RS-1) GN=mutM PE=3 SV=1 1 294 4.0E-25
sp|A7NQM8|FPG_ROSCS Formamidopyrimidine-DNA glycosylase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=mutM PE=3 SV=1 1 304 1.0E-24
sp|P19210|FPG_BACFI Formamidopyrimidine-DNA glycosylase OS=Bacillus firmus GN=mutM PE=3 SV=3 1 293 3.0E-22
sp|A4J4X3|FPG_DESRM Formamidopyrimidine-DNA glycosylase OS=Desulfotomaculum reducens (strain MI-1) GN=mutM PE=3 SV=1 1 294 6.0E-22
sp|O34403|FPG_BACSU Formamidopyrimidine-DNA glycosylase OS=Bacillus subtilis (strain 168) GN=mutM PE=3 SV=4 1 242 6.0E-22
sp|A9WDC2|FPG_CHLAA Formamidopyrimidine-DNA glycosylase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=mutM PE=3 SV=1 1 293 9.0E-22
sp|A8YWE6|FPG_LACH4 Formamidopyrimidine-DNA glycosylase OS=Lactobacillus helveticus (strain DPC 4571) GN=mutM PE=3 SV=1 1 293 1.0E-21
sp|Q24XW2|FPG_DESHY Formamidopyrimidine-DNA glycosylase OS=Desulfitobacterium hafniense (strain Y51) GN=mutM PE=3 SV=1 1 293 2.0E-21
sp|B8FU83|FPG_DESHD Formamidopyrimidine-DNA glycosylase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=mutM PE=3 SV=1 1 293 2.0E-21
sp|Q01RU9|FPG_SOLUE Formamidopyrimidine-DNA glycosylase OS=Solibacter usitatus (strain Ellin6076) GN=mutM PE=3 SV=1 1 294 2.0E-21
sp|Q74EG5|FPG_GEOSL Formamidopyrimidine-DNA glycosylase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=mutM PE=3 SV=3 1 294 5.0E-20
sp|Q03GC2|FPG_PEDPA Formamidopyrimidine-DNA glycosylase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=mutM PE=3 SV=1 1 295 7.0E-20
sp|B0TER7|FPG_HELMI Formamidopyrimidine-DNA glycosylase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=mutM PE=3 SV=1 1 260 1.0E-19
sp|Q1WUN7|FPG_LACS1 Formamidopyrimidine-DNA glycosylase OS=Lactobacillus salivarius (strain UCC118) GN=mutM PE=3 SV=1 1 293 1.0E-19
sp|A1BAN2|FPG_PARDP Formamidopyrimidine-DNA glycosylase OS=Paracoccus denitrificans (strain Pd 1222) GN=mutM PE=3 SV=1 1 294 3.0E-19
sp|Q65G93|FPG_BACLD Formamidopyrimidine-DNA glycosylase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=mutM PE=3 SV=3 1 294 3.0E-19
sp|A8LNK8|FPG_DINSH Formamidopyrimidine-DNA glycosylase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=mutM PE=3 SV=1 1 294 6.0E-19
sp|Q117D2|FPG_TRIEI Formamidopyrimidine-DNA glycosylase OS=Trichodesmium erythraeum (strain IMS101) GN=mutM PE=3 SV=1 1 294 8.0E-19
sp|C6BUX8|FPG_DESAD Formamidopyrimidine-DNA glycosylase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=mutM PE=3 SV=1 1 295 1.0E-18
sp|Q92BF1|FPG_LISIN Formamidopyrimidine-DNA glycosylase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=mutM PE=3 SV=3 1 294 1.0E-18
sp|Q88WV4|FPG_LACPL Formamidopyrimidine-DNA glycosylase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=mutM PE=3 SV=3 1 295 2.0E-18
sp|Q5WEG7|FPG_BACSK Formamidopyrimidine-DNA glycosylase OS=Bacillus clausii (strain KSM-K16) GN=mutM PE=3 SV=3 1 293 4.0E-18
sp|B7K1T1|FPG_CYAP8 Formamidopyrimidine-DNA glycosylase OS=Cyanothece sp. (strain PCC 8801) GN=mutM PE=3 SV=1 1 293 4.0E-18
sp|P42371|FPG_LACLC Formamidopyrimidine-DNA glycosylase OS=Lactococcus lactis subsp. cremoris GN=mutM PE=1 SV=3 1 294 8.0E-18
sp|Q2GAT0|FPG_NOVAD Formamidopyrimidine-DNA glycosylase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=mutM PE=3 SV=1 1 294 1.0E-17
sp|Q2RHE9|FPG_MOOTA Formamidopyrimidine-DNA glycosylase OS=Moorella thermoacetica (strain ATCC 39073) GN=mutM PE=3 SV=1 1 293 1.0E-17
sp|C0Z7Z0|FPG_BREBN Formamidopyrimidine-DNA glycosylase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=mutM PE=3 SV=1 1 294 1.0E-17
sp|P74290|FPG_SYNY3 Formamidopyrimidine-DNA glycosylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=mutM PE=3 SV=3 1 293 2.0E-17
sp|Q9CIK4|FPG_LACLA Formamidopyrimidine-DNA glycosylase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=mutM PE=3 SV=3 1 237 2.0E-17
sp|Q16DL0|FPG_ROSDO Formamidopyrimidine-DNA glycosylase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=mutM PE=3 SV=1 1 294 2.0E-17
sp|Q817G5|FPG_BACCR Formamidopyrimidine-DNA glycosylase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=mutM PE=3 SV=3 1 293 3.0E-17
sp|Q041U1|FPG_LACGA Formamidopyrimidine-DNA glycosylase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=mutM PE=3 SV=1 1 235 3.0E-17
sp|Q9K855|FPG_BACHD Formamidopyrimidine-DNA glycosylase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=mutM PE=3 SV=3 1 294 4.0E-17
sp|Q5FIV8|FPG_LACAC Formamidopyrimidine-DNA glycosylase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=mutM PE=3 SV=3 1 227 5.0E-17
sp|B2J5G0|FPG_NOSP7 Formamidopyrimidine-DNA glycosylase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=mutM PE=3 SV=1 1 302 8.0E-17
sp|Q3IY64|FPG_RHOS4 Formamidopyrimidine-DNA glycosylase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=mutM PE=3 SV=3 1 294 1.0E-16
sp|B8G9X1|FPG_CHLAD Formamidopyrimidine-DNA glycosylase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=mutM PE=3 SV=1 1 296 1.0E-16
sp|Q72ZF1|FPG_BACC1 Formamidopyrimidine-DNA glycosylase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=mutM PE=3 SV=3 1 293 1.0E-16
sp|Q6APT2|FPG_DESPS Formamidopyrimidine-DNA glycosylase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=mutM PE=3 SV=3 1 295 1.0E-16
sp|B9KQJ9|FPG_RHOSK Formamidopyrimidine-DNA glycosylase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=mutM PE=3 SV=1 1 294 1.0E-16
sp|Q71ZA3|FPG_LISMF Formamidopyrimidine-DNA glycosylase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=mutM PE=3 SV=3 1 294 2.0E-16
sp|Q6HCU5|FPG_BACHK Formamidopyrimidine-DNA glycosylase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=mutM PE=3 SV=3 1 293 2.0E-16
sp|Q633L1|FPG_BACCZ Formamidopyrimidine-DNA glycosylase OS=Bacillus cereus (strain ZK / E33L) GN=mutM PE=3 SV=3 1 293 2.0E-16
sp|Q81L04|FPG_BACAN Formamidopyrimidine-DNA glycosylase OS=Bacillus anthracis GN=mutM PE=3 SV=3 1 293 2.0E-16
sp|O50606|FPG_THET8 Formamidopyrimidine-DNA glycosylase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=mutM PE=1 SV=3 1 293 2.0E-16
sp|Q72HN2|FPG_THET2 Formamidopyrimidine-DNA glycosylase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=mutM PE=3 SV=3 1 293 2.0E-16
sp|Q6MCT3|FPG_PARUW Formamidopyrimidine-DNA glycosylase OS=Protochlamydia amoebophila (strain UWE25) GN=mutM PE=3 SV=3 1 232 2.0E-16
sp|Q8Y6W7|FPG_LISMO Formamidopyrimidine-DNA glycosylase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=mutM PE=3 SV=3 1 294 2.0E-16
sp|A3PFL2|FPG_RHOS1 Formamidopyrimidine-DNA glycosylase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=mutM PE=3 SV=1 1 294 3.0E-16
sp|Q5KWC3|FPG_GEOKA Formamidopyrimidine-DNA glycosylase OS=Geobacillus kaustophilus (strain HTA426) GN=mutM PE=3 SV=3 1 294 3.0E-16
sp|B1WTF7|FPG_CYAA5 Formamidopyrimidine-DNA glycosylase OS=Cyanothece sp. (strain ATCC 51142) GN=mutM PE=3 SV=1 1 295 3.0E-16
sp|Q0AVE3|FPG_SYNWW Formamidopyrimidine-DNA glycosylase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=mutM PE=3 SV=1 1 294 3.0E-16
sp|C4L470|FPG_EXISA Formamidopyrimidine-DNA glycosylase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=mutM PE=3 SV=1 1 294 4.0E-16
sp|Q6KHS0|FPG_MYCMO Formamidopyrimidine-DNA glycosylase OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=mutM PE=3 SV=3 1 295 4.0E-16
sp|P64153|FPG_STRA5 Formamidopyrimidine-DNA glycosylase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=mutM PE=3 SV=3 1 295 5.0E-16
sp|P64152|FPG_STRA3 Formamidopyrimidine-DNA glycosylase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=mutM PE=3 SV=3 1 295 5.0E-16
sp|Q3K028|FPG_STRA1 Formamidopyrimidine-DNA glycosylase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=mutM PE=3 SV=3 1 295 5.0E-16
sp|Q74IB5|FPG_LACJO Formamidopyrimidine-DNA glycosylase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=mutM PE=3 SV=3 1 235 6.0E-16
sp|Q4UMW5|FPG_RICFE Formamidopyrimidine-DNA glycosylase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=mutM PE=3 SV=3 1 236 7.0E-16
sp|P55045|FPG_STRMU Formamidopyrimidine-DNA glycosylase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=mutM PE=3 SV=4 1 294 8.0E-16
sp|Q98BG6|FPG_RHILO Formamidopyrimidine-DNA glycosylase OS=Rhizobium loti (strain MAFF303099) GN=mutM PE=3 SV=3 1 293 8.0E-16
sp|A8G2Y9|FPG_PROM2 Formamidopyrimidine-DNA glycosylase OS=Prochlorococcus marinus (strain MIT 9215) GN=mutM PE=3 SV=1 1 294 8.0E-16
sp|A4FMJ7|FPG_SACEN Formamidopyrimidine-DNA glycosylase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=mutM PE=3 SV=1 1 249 8.0E-16
sp|P95744|FPG_SYNEL Formamidopyrimidine-DNA glycosylase OS=Synechococcus elongatus GN=mutM PE=3 SV=4 1 301 9.0E-16
sp|Q8YP80|FPG_NOSS1 Formamidopyrimidine-DNA glycosylase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=mutM PE=3 SV=3 1 293 1.0E-15
sp|Q5FN17|FPG_GLUOX Formamidopyrimidine-DNA glycosylase OS=Gluconobacter oxydans (strain 621H) GN=mutM PE=3 SV=3 1 294 1.0E-15
sp|Q38VS5|FPG_LACSS Formamidopyrimidine-DNA glycosylase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=mutM PE=3 SV=3 1 236 2.0E-15
sp|B9L1Z5|FPG_THERP Formamidopyrimidine-DNA glycosylase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=mutM PE=3 SV=1 1 295 2.0E-15
sp|B1VYY1|FPG_STRGG Formamidopyrimidine-DNA glycosylase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=mutM PE=3 SV=1 1 217 2.0E-15
sp|P59065|FPG_THEEB Formamidopyrimidine-DNA glycosylase OS=Thermosynechococcus elongatus (strain BP-1) GN=mutM PE=3 SV=3 1 301 2.0E-15
sp|Q3MDP1|FPG_ANAVT Formamidopyrimidine-DNA glycosylase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=mutM PE=3 SV=1 1 293 3.0E-15
sp|Q8EPE6|FPG_OCEIH Formamidopyrimidine-DNA glycosylase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=mutM PE=3 SV=3 1 223 3.0E-15
sp|Q1G9A3|FPG_LACDA Formamidopyrimidine-DNA glycosylase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=mutM PE=3 SV=1 1 235 3.0E-15
sp|Q8FXR6|FPG_BRUSU Formamidopyrimidine-DNA glycosylase OS=Brucella suis biovar 1 (strain 1330) GN=mutM PE=3 SV=3 1 293 4.0E-15
sp|A9MAB2|FPG_BRUC2 Formamidopyrimidine-DNA glycosylase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=mutM PE=3 SV=1 1 293 4.0E-15
sp|Q5LWT9|FPG_RUEPO Formamidopyrimidine-DNA glycosylase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=mutM PE=3 SV=3 1 294 4.0E-15
sp|Q5WYY6|FPG_LEGPL Formamidopyrimidine-DNA glycosylase OS=Legionella pneumophila (strain Lens) GN=mutM PE=3 SV=3 1 296 4.0E-15
sp|B1YKA0|FPG_EXIS2 Formamidopyrimidine-DNA glycosylase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=mutM PE=3 SV=1 1 295 5.0E-15
sp|Q67R59|FPG_SYMTH Formamidopyrimidine-DNA glycosylase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=mutM PE=3 SV=3 1 295 5.0E-15
sp|Q049F3|FPG_LACDB Formamidopyrimidine-DNA glycosylase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=mutM PE=3 SV=1 1 235 6.0E-15
sp|A1SLU7|FPG_NOCSJ Formamidopyrimidine-DNA glycosylase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=mutM PE=3 SV=1 1 239 6.0E-15
sp|B2AGU2|FPG_CUPTR Formamidopyrimidine-DNA glycosylase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=mutM PE=3 SV=1 1 227 8.0E-15
sp|B9M5V2|FPG_GEODF Formamidopyrimidine-DNA glycosylase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=mutM PE=3 SV=1 1 294 9.0E-15
sp|Q2T1B3|FPG_BURTA Formamidopyrimidine-DNA glycosylase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=mutM PE=3 SV=1 1 294 1.0E-14
sp|Q8YED2|FPG_BRUME Formamidopyrimidine-DNA glycosylase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=mutM PE=3 SV=3 1 293 1.0E-14
sp|C0RG65|FPG_BRUMB Formamidopyrimidine-DNA glycosylase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=mutM PE=3 SV=1 1 293 1.0E-14
sp|Q57A83|FPG_BRUAB Formamidopyrimidine-DNA glycosylase OS=Brucella abortus biovar 1 (strain 9-941) GN=mutM PE=3 SV=3 1 293 1.0E-14
sp|Q2YQP8|FPG_BRUA2 Formamidopyrimidine-DNA glycosylase OS=Brucella abortus (strain 2308) GN=mutM PE=3 SV=3 1 293 1.0E-14
sp|B2S9T2|FPG_BRUA1 Formamidopyrimidine-DNA glycosylase OS=Brucella abortus (strain S19) GN=mutM PE=3 SV=1 1 293 1.0E-14
sp|Q5XDE4|FPG_STRP6 Formamidopyrimidine-DNA glycosylase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=mutM PE=3 SV=3 1 294 2.0E-14
sp|A9IN26|FPG_BART1 Formamidopyrimidine-DNA glycosylase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=mutM PE=3 SV=1 1 294 2.0E-14
sp|B8EKR5|FPG_METSB Formamidopyrimidine-DNA glycosylase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=mutM PE=3 SV=1 1 294 2.0E-14
sp|Q9ZBQ6|FPG_STRCO Formamidopyrimidine-DNA glycosylase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=mutM PE=3 SV=3 1 237 2.0E-14
sp|Q98QQ1|FPG_MYCPU Formamidopyrimidine-DNA glycosylase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=mutM PE=3 SV=3 1 294 2.0E-14
sp|A7HZC4|FPG_PARL1 Formamidopyrimidine-DNA glycosylase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=mutM PE=3 SV=1 1 294 2.0E-14
sp|A9HI30|FPG_GLUDA Formamidopyrimidine-DNA glycosylase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=mutM PE=3 SV=1 1 293 3.0E-14
sp|A5VTD0|FPG_BRUO2 Formamidopyrimidine-DNA glycosylase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=mutM PE=3 SV=1 1 293 3.0E-14
sp|Q5ZY18|FPG_LEGPH Formamidopyrimidine-DNA glycosylase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=mutM PE=3 SV=3 1 296 3.0E-14
sp|A4WVR6|FPG_RHOS5 Formamidopyrimidine-DNA glycosylase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=mutM PE=3 SV=1 1 294 3.0E-14
sp|Q31CK0|FPG_PROM9 Formamidopyrimidine-DNA glycosylase OS=Prochlorococcus marinus (strain MIT 9312) GN=mutM PE=3 SV=1 1 294 4.0E-14
sp|B0UR68|FPG_METS4 Formamidopyrimidine-DNA glycosylase OS=Methylobacterium sp. (strain 4-46) GN=mutM PE=3 SV=1 1 209 6.0E-14
sp|A4X4F8|FPG_SALTO Formamidopyrimidine-DNA glycosylase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=mutM PE=3 SV=1 1 239 7.0E-14
sp|A8M661|FPG_SALAI Formamidopyrimidine-DNA glycosylase OS=Salinispora arenicola (strain CNS-205) GN=mutM PE=3 SV=1 1 216 7.0E-14
sp|Q82JU0|FPG_STRAW Formamidopyrimidine-DNA glycosylase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=mutM PE=3 SV=3 1 237 7.0E-14
sp|A8GTA0|FPG_RICRS Formamidopyrimidine-DNA glycosylase OS=Rickettsia rickettsii (strain Sheila Smith) GN=mutM PE=3 SV=1 1 236 8.0E-14
sp|B0BUU0|FPG_RICRO Formamidopyrimidine-DNA glycosylase OS=Rickettsia rickettsii (strain Iowa) GN=mutM PE=3 SV=1 1 236 8.0E-14
sp|B0VRV3|FPG_ACIBS Formamidopyrimidine-DNA glycosylase OS=Acinetobacter baumannii (strain SDF) GN=mutM PE=3 SV=1 1 295 1.0E-13
sp|Q92GT4|FPG_RICCN Formamidopyrimidine-DNA glycosylase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=mutM PE=3 SV=3 1 236 1.0E-13
sp|C4K2K4|FPG_RICPU Formamidopyrimidine-DNA glycosylase OS=Rickettsia peacockii (strain Rustic) GN=mutM PE=3 SV=1 1 236 1.0E-13
sp|Q39WD1|FPG_GEOMG Formamidopyrimidine-DNA glycosylase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=mutM PE=3 SV=3 1 293 1.0E-13
sp|A3PB53|FPG_PROM0 Formamidopyrimidine-DNA glycosylase OS=Prochlorococcus marinus (strain MIT 9301) GN=mutM PE=3 SV=1 1 294 2.0E-13
sp|Q63XL4|FPG_BURPS Formamidopyrimidine-DNA glycosylase OS=Burkholderia pseudomallei (strain K96243) GN=mutM PE=3 SV=3 1 294 2.0E-13
sp|A3N5K5|FPG_BURP6 Formamidopyrimidine-DNA glycosylase OS=Burkholderia pseudomallei (strain 668) GN=mutM PE=3 SV=1 1 294 2.0E-13
sp|Q3JW82|FPG_BURP1 Formamidopyrimidine-DNA glycosylase OS=Burkholderia pseudomallei (strain 1710b) GN=mutM PE=3 SV=3 1 294 2.0E-13
sp|A3NRA1|FPG_BURP0 Formamidopyrimidine-DNA glycosylase OS=Burkholderia pseudomallei (strain 1106a) GN=mutM PE=3 SV=1 1 294 2.0E-13
sp|Q5X7I9|FPG_LEGPA Formamidopyrimidine-DNA glycosylase OS=Legionella pneumophila (strain Paris) GN=mutM PE=3 SV=3 1 296 2.0E-13
sp|Q2SPF3|FPG_HAHCH Formamidopyrimidine-DNA glycosylase OS=Hahella chejuensis (strain KCTC 2396) GN=mutM PE=3 SV=1 1 294 2.0E-13
sp|B2JCP3|FPG_BURP8 Formamidopyrimidine-DNA glycosylase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=mutM PE=3 SV=1 1 294 2.0E-13
sp|Q8P250|FPG_STRP8 Formamidopyrimidine-DNA glycosylase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=mutM PE=3 SV=3 1 294 2.0E-13
sp|C3PLF5|FPG_RICAE Formamidopyrimidine-DNA glycosylase OS=Rickettsia africae (strain ESF-5) GN=mutM PE=3 SV=1 1 236 2.0E-13
sp|A8EZP5|FPG_RICCK Formamidopyrimidine-DNA glycosylase OS=Rickettsia canadensis (strain McKiel) GN=mutM PE=3 SV=1 1 236 3.0E-13
sp|Q9A131|FPG_STRP1 Formamidopyrimidine-DNA glycosylase OS=Streptococcus pyogenes serotype M1 GN=mutM PE=3 SV=3 1 294 3.0E-13
sp|B0TN04|FPG_SHEHH Formamidopyrimidine-DNA glycosylase OS=Shewanella halifaxensis (strain HAW-EB4) GN=mutM PE=3 SV=1 1 295 3.0E-13
sp|A9B0X2|FPG_HERA2 Formamidopyrimidine-DNA glycosylase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=mutM PE=3 SV=1 1 293 3.0E-13
sp|Q3ABL4|FPG_CARHZ Formamidopyrimidine-DNA glycosylase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=mutM PE=3 SV=3 1 256 4.0E-13
sp|B1LWY6|FPG_METRJ Formamidopyrimidine-DNA glycosylase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=mutM PE=3 SV=1 1 280 4.0E-13
sp|A1UZN2|FPG_BURMS Formamidopyrimidine-DNA glycosylase OS=Burkholderia mallei (strain SAVP1) GN=mutM PE=3 SV=1 1 294 4.0E-13
sp|Q62FC7|FPG_BURMA Formamidopyrimidine-DNA glycosylase OS=Burkholderia mallei (strain ATCC 23344) GN=mutM PE=3 SV=3 1 294 4.0E-13
sp|A2S6C0|FPG_BURM9 Formamidopyrimidine-DNA glycosylase OS=Burkholderia mallei (strain NCTC 10229) GN=mutM PE=3 SV=1 1 294 4.0E-13
sp|A8L594|FPG_FRASN Formamidopyrimidine-DNA glycosylase OS=Frankia sp. (strain EAN1pec) GN=mutM PE=3 SV=1 1 236 4.0E-13
sp|Q8UIH4|FPG_AGRFC Formamidopyrimidine-DNA glycosylase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=mutM PE=3 SV=4 1 294 4.0E-13
sp|B0C5D4|FPG_ACAM1 Formamidopyrimidine-DNA glycosylase OS=Acaryochloris marina (strain MBIC 11017) GN=mutM PE=3 SV=1 1 293 5.0E-13
sp|P57910|FPG_PASMU Formamidopyrimidine-DNA glycosylase OS=Pasteurella multocida (strain Pm70) GN=mutM PE=3 SV=3 1 294 5.0E-13
sp|B2IE81|FPG_BEII9 Formamidopyrimidine-DNA glycosylase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=mutM PE=3 SV=1 1 294 5.0E-13
sp|B0T7D1|FPG_CAUSK Formamidopyrimidine-DNA glycosylase OS=Caulobacter sp. (strain K31) GN=mutM PE=3 SV=1 1 254 7.0E-13
sp|A2BPD1|FPG_PROMS Formamidopyrimidine-DNA glycosylase OS=Prochlorococcus marinus (strain AS9601) GN=mutM PE=3 SV=1 1 294 1.0E-12
sp|B6JCQ7|FPG_OLICO Formamidopyrimidine-DNA glycosylase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=mutM PE=3 SV=1 1 294 1.0E-12
sp|Q3A3F2|FPG_PELCD Formamidopyrimidine-DNA glycosylase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=mutM PE=3 SV=3 1 294 1.0E-12
sp|A9AEZ2|FPG_BURM1 Formamidopyrimidine-DNA glycosylase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=mutM PE=3 SV=1 1 294 1.0E-12
sp|B8IIZ9|FPG_METNO Formamidopyrimidine-DNA glycosylase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=mutM PE=3 SV=1 1 216 1.0E-12
sp|Q602J1|FPG_METCA Formamidopyrimidine-DNA glycosylase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=mutM PE=3 SV=3 1 294 1.0E-12
sp|Q1RJY6|FPG_RICBR Formamidopyrimidine-DNA glycosylase OS=Rickettsia bellii (strain RML369-C) GN=mutM PE=3 SV=1 1 234 2.0E-12
sp|A8GXR0|FPG_RICB8 Formamidopyrimidine-DNA glycosylase OS=Rickettsia bellii (strain OSU 85-389) GN=mutM PE=3 SV=1 1 234 2.0E-12
sp|Q2N7Y8|FPG_ERYLH Formamidopyrimidine-DNA glycosylase OS=Erythrobacter litoralis (strain HTCC2594) GN=mutM PE=3 SV=1 1 294 2.0E-12
sp|Q6G4T2|FPG_BARHE Formamidopyrimidine-DNA glycosylase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=mutM PE=3 SV=3 1 294 2.0E-12
sp|B3Q620|FPG_RHOPT Formamidopyrimidine-DNA glycosylase OS=Rhodopseudomonas palustris (strain TIE-1) GN=mutM PE=3 SV=1 1 294 2.0E-12
sp|Q1GC55|FPG_RUEST Formamidopyrimidine-DNA glycosylase OS=Ruegeria sp. (strain TM1040) GN=mutM PE=3 SV=1 1 294 2.0E-12
sp|Q97R61|FPG_STRPN Formamidopyrimidine-DNA glycosylase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=mutM PE=3 SV=3 1 294 2.0E-12
sp|Q837G3|FPG_ENTFA Formamidopyrimidine-DNA glycosylase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=mutM PE=3 SV=3 1 236 2.0E-12
sp|Q48UU6|FPG_STRPM Formamidopyrimidine-DNA glycosylase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=mutM PE=3 SV=3 1 294 2.0E-12
sp|Q8DQ33|FPG_STRR6 Formamidopyrimidine-DNA glycosylase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=mutM PE=3 SV=3 1 294 3.0E-12
sp|Q6G0L3|FPG_BARQU Formamidopyrimidine-DNA glycosylase OS=Bartonella quintana (strain Toulouse) GN=mutM PE=3 SV=3 1 294 3.0E-12
sp|Q8E8D9|FPG_SHEON Formamidopyrimidine-DNA glycosylase OS=Shewanella oneidensis (strain MR-1) GN=mutM PE=3 SV=3 1 234 3.0E-12
sp|A1UU20|FPG_BARBK Formamidopyrimidine-DNA glycosylase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=mutM PE=3 SV=1 1 294 3.0E-12
sp|P0DB15|FPG_STRPQ Formamidopyrimidine-DNA glycosylase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=mutM PE=3 SV=1 1 226 3.0E-12
sp|P0DB14|FPG_STRP3 Formamidopyrimidine-DNA glycosylase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=mutM PE=3 SV=1 1 226 3.0E-12
sp|B5ENT6|FPG_ACIF5 Formamidopyrimidine-DNA glycosylase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=mutM PE=3 SV=1 1 294 3.0E-12
sp|B7J8I7|FPG_ACIF2 Formamidopyrimidine-DNA glycosylase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=mutM PE=3 SV=1 1 294 3.0E-12
sp|C0ZXQ5|FPG_RHOE4 Formamidopyrimidine-DNA glycosylase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=mutM PE=3 SV=1 1 223 3.0E-12
sp|Q8FP17|FPG_COREF Formamidopyrimidine-DNA glycosylase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=mutM PE=3 SV=3 1 225 5.0E-12
sp|Q4JUY8|FPG_CORJK Formamidopyrimidine-DNA glycosylase OS=Corynebacterium jeikeium (strain K411) GN=mutM PE=3 SV=3 1 294 5.0E-12
sp|Q726D5|FPG_DESVH Formamidopyrimidine-DNA glycosylase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=mutM PE=3 SV=3 125 294 5.0E-12
sp|Q6FE90|FPG_ACIAD Formamidopyrimidine-DNA glycosylase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=mutM PE=3 SV=3 1 295 5.0E-12
sp|Q5M0P0|FPG_STRT1 Formamidopyrimidine-DNA glycosylase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=mutM PE=3 SV=3 1 294 5.0E-12
sp|Q7U4V2|FPG_SYNPX Formamidopyrimidine-DNA glycosylase OS=Synechococcus sp. (strain WH8102) GN=mutM PE=3 SV=3 1 293 5.0E-12
sp|Q0AD66|FPG_NITEC Formamidopyrimidine-DNA glycosylase OS=Nitrosomonas eutropha (strain C91) GN=mutM PE=3 SV=1 1 246 6.0E-12
sp|Q5M576|FPG_STRT2 Formamidopyrimidine-DNA glycosylase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=mutM PE=3 SV=3 1 294 7.0E-12
sp|Q3SWN3|FPG_NITWN Formamidopyrimidine-DNA glycosylase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=mutM PE=3 SV=3 1 218 7.0E-12
sp|A8HA27|FPG_SHEPA Formamidopyrimidine-DNA glycosylase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=mutM PE=3 SV=1 1 276 7.0E-12
sp|A8F2H0|FPG_RICM5 Formamidopyrimidine-DNA glycosylase OS=Rickettsia massiliae (strain Mtu5) GN=mutM PE=3 SV=1 1 236 7.0E-12
sp|B9JZF5|FPG_AGRVS Formamidopyrimidine-DNA glycosylase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=mutM PE=3 SV=1 1 294 8.0E-12
sp|Q9RX22|FPG_DEIRA Formamidopyrimidine-DNA glycosylase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=mutM PE=3 SV=4 1 295 8.0E-12
sp|Q7VDK6|FPG_PROMA Formamidopyrimidine-DNA glycosylase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=mutM PE=3 SV=3 1 246 9.0E-12
sp|C3PH91|FPG_CORA7 Formamidopyrimidine-DNA glycosylase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=mutM PE=3 SV=1 1 294 1.0E-11
sp|B0RZ50|FPG_XANCB Formamidopyrimidine-DNA glycosylase OS=Xanthomonas campestris pv. campestris (strain B100) GN=mutM PE=3 SV=1 1 234 1.0E-11
sp|A7IKJ3|FPG_XANP2 Formamidopyrimidine-DNA glycosylase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=mutM PE=3 SV=1 1 294 2.0E-11
sp|B1KL38|FPG_SHEWM Formamidopyrimidine-DNA glycosylase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=mutM PE=3 SV=1 1 234 2.0E-11
sp|Q6NDM1|FPG_RHOPA Formamidopyrimidine-DNA glycosylase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=mutM PE=3 SV=3 1 294 2.0E-11
sp|Q46H41|FPG_PROMT Formamidopyrimidine-DNA glycosylase OS=Prochlorococcus marinus (strain NATL2A) GN=mutM PE=3 SV=3 1 294 2.0E-11
sp|A4STD1|FPG_AERS4 Formamidopyrimidine-DNA glycosylase OS=Aeromonas salmonicida (strain A449) GN=mutM PE=3 SV=1 1 294 2.0E-11
sp|Q12SR9|FPG_SHEDO Formamidopyrimidine-DNA glycosylase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=mutM PE=3 SV=1 1 265 2.0E-11
sp|Q145W8|FPG_BURXL Formamidopyrimidine-DNA glycosylase OS=Burkholderia xenovorans (strain LB400) GN=mutM PE=3 SV=1 1 227 2.0E-11
sp|Q2RMQ2|FPG_RHORT Formamidopyrimidine-DNA glycosylase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=mutM PE=3 SV=1 1 254 2.0E-11
sp|Q5NGY3|FPG_FRATT Formamidopyrimidine-DNA glycosylase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=mutM PE=3 SV=3 1 236 2.0E-11
sp|A3QJA8|FPG_SHELP Formamidopyrimidine-DNA glycosylase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=mutM PE=3 SV=1 1 259 3.0E-11
sp|A4QFD9|FPG_CORGB Formamidopyrimidine-DNA glycosylase OS=Corynebacterium glutamicum (strain R) GN=mutM PE=3 SV=1 1 239 3.0E-11
sp|Q476F5|FPG_CUPPJ Formamidopyrimidine-DNA glycosylase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=mutM PE=3 SV=3 1 227 3.0E-11
sp|A2C0H4|FPG_PROM1 Formamidopyrimidine-DNA glycosylase OS=Prochlorococcus marinus (strain NATL1A) GN=mutM PE=3 SV=1 1 294 3.0E-11
sp|Q0KEP4|FPG_CUPNH Formamidopyrimidine-DNA glycosylase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=mutM PE=3 SV=1 1 227 4.0E-11
sp|Q7V8Y5|FPG_PROMM Formamidopyrimidine-DNA glycosylase OS=Prochlorococcus marinus (strain MIT 9313) GN=mutM PE=3 SV=3 1 246 4.0E-11
sp|C5B9D8|FPG_EDWI9 Formamidopyrimidine-DNA glycosylase OS=Edwardsiella ictaluri (strain 93-146) GN=mutM PE=3 SV=1 1 294 4.0E-11
sp|A8IQM5|FPG_AZOC5 Formamidopyrimidine-DNA glycosylase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=mutM PE=3 SV=1 1 216 4.0E-11
sp|Q6ML45|FPG_BDEBA Formamidopyrimidine-DNA glycosylase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=mutM PE=3 SV=3 1 246 4.0E-11
sp|Q8NNV7|FPG_CORGL Formamidopyrimidine-DNA glycosylase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=mutM PE=3 SV=3 1 239 5.0E-11
sp|B4EAR7|FPG_BURCJ Formamidopyrimidine-DNA glycosylase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=mutM PE=3 SV=1 1 294 5.0E-11
sp|A1RE25|FPG_SHESW Formamidopyrimidine-DNA glycosylase OS=Shewanella sp. (strain W3-18-1) GN=mutM PE=3 SV=1 1 259 5.0E-11
sp|A0KEN2|FPG_AERHH Formamidopyrimidine-DNA glycosylase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=mutM PE=3 SV=1 1 294 5.0E-11
sp|B5ZYK9|FPG_RHILW Formamidopyrimidine-DNA glycosylase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=mutM PE=3 SV=1 1 294 6.0E-11
sp|Q6AFJ3|FPG_LEIXX Formamidopyrimidine-DNA glycosylase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=mutM PE=3 SV=3 1 239 6.0E-11
sp|A4JHZ1|FPG_BURVG Formamidopyrimidine-DNA glycosylase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=mutM PE=3 SV=1 1 227 6.0E-11
sp|A1WZG2|FPG_HALHL Formamidopyrimidine-DNA glycosylase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=mutM PE=3 SV=1 1 236 7.0E-11
sp|Q39CU4|FPG_BURL3 Formamidopyrimidine-DNA glycosylase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=mutM PE=3 SV=3 1 227 7.0E-11
sp|A2BUV8|FPG_PROM5 Formamidopyrimidine-DNA glycosylase OS=Prochlorococcus marinus (strain MIT 9515) GN=mutM PE=3 SV=1 1 246 7.0E-11
sp|Q8P3C4|FPG_XANCP Formamidopyrimidine-DNA glycosylase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=mutM PE=3 SV=3 1 234 8.0E-11
sp|Q4UNU6|FPG_XANC8 Formamidopyrimidine-DNA glycosylase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=mutM PE=3 SV=3 1 234 8.0E-11
sp|Q7V2X4|FPG_PROMP Formamidopyrimidine-DNA glycosylase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=mutM PE=3 SV=3 1 246 9.0E-11
sp|A0KAM1|FPG_BURCH Formamidopyrimidine-DNA glycosylase OS=Burkholderia cenocepacia (strain HI2424) GN=mutM PE=3 SV=1 1 227 9.0E-11
sp|Q1BTH0|FPG_BURCA Formamidopyrimidine-DNA glycosylase OS=Burkholderia cenocepacia (strain AU 1054) GN=mutM PE=3 SV=1 1 227 9.0E-11
sp|B1YN48|FPG_BURA4 Formamidopyrimidine-DNA glycosylase OS=Burkholderia ambifaria (strain MC40-6) GN=mutM PE=3 SV=1 1 227 1.0E-10
sp|Q82S12|FPG_NITEU Formamidopyrimidine-DNA glycosylase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=mutM PE=3 SV=3 1 227 1.0E-10
sp|Q2NQU4|FPG_SODGM Formamidopyrimidine-DNA glycosylase OS=Sodalis glossinidius (strain morsitans) GN=mutM PE=3 SV=1 1 230 1.0E-10
sp|A4YJG9|FPG_BRASO Formamidopyrimidine-DNA glycosylase OS=Bradyrhizobium sp. (strain ORS278) GN=mutM PE=3 SV=1 1 216 1.0E-10
sp|A5E887|FPG_BRASB Formamidopyrimidine-DNA glycosylase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=mutM PE=3 SV=1 1 216 2.0E-10
sp|B2SXG9|FPG_BURPP Formamidopyrimidine-DNA glycosylase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=mutM PE=3 SV=1 1 227 2.0E-10
sp|B6IVU4|FPG_RHOCS Formamidopyrimidine-DNA glycosylase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=mutM PE=3 SV=1 1 294 2.0E-10
sp|Q6LVN0|FPG_PHOPR Formamidopyrimidine-DNA glycosylase OS=Photobacterium profundum GN=mutM PE=3 SV=3 1 294 2.0E-10
sp|Q21CD4|FPG_RHOPB Formamidopyrimidine-DNA glycosylase OS=Rhodopseudomonas palustris (strain BisB18) GN=mutM PE=3 SV=1 1 294 3.0E-10
sp|A5EXK6|FPG_DICNV Formamidopyrimidine-DNA glycosylase OS=Dichelobacter nodosus (strain VCS1703A) GN=mutM PE=3 SV=1 1 294 3.0E-10
sp|B4RC43|FPG_PHEZH Formamidopyrimidine-DNA glycosylase OS=Phenylobacterium zucineum (strain HLK1) GN=mutM PE=3 SV=1 1 236 3.0E-10
sp|Q5QZC1|FPG_IDILO Formamidopyrimidine-DNA glycosylase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=mutM PE=3 SV=3 1 294 3.0E-10
sp|A5FZ95|FPG_ACICJ Formamidopyrimidine-DNA glycosylase OS=Acidiphilium cryptum (strain JF-5) GN=mutM PE=3 SV=1 1 254 3.0E-10
sp|Q7NFW7|FPG_GLOVI Formamidopyrimidine-DNA glycosylase OS=Gloeobacter violaceus (strain PCC 7421) GN=mutM PE=3 SV=3 1 294 4.0E-10
sp|Q7VN67|FPG_HAEDU Formamidopyrimidine-DNA glycosylase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=mutM PE=3 SV=3 1 295 4.0E-10
sp|A6VSY6|FPG_MARMS Formamidopyrimidine-DNA glycosylase OS=Marinomonas sp. (strain MWYL1) GN=mutM PE=3 SV=1 1 234 4.0E-10
sp|Q59752|FPG_RHIME Formamidopyrimidine-DNA glycosylase OS=Rhizobium meliloti (strain 1021) GN=mutM PE=3 SV=4 1 294 4.0E-10
sp|A0LV85|FPG_ACIC1 Formamidopyrimidine-DNA glycosylase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=mutM PE=3 SV=1 1 207 4.0E-10
sp|B5XTG8|FPG_KLEP3 Formamidopyrimidine-DNA glycosylase OS=Klebsiella pneumoniae (strain 342) GN=mutM PE=3 SV=1 1 230 4.0E-10
sp|A1S1S3|FPG_SHEAM Formamidopyrimidine-DNA glycosylase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=mutM PE=3 SV=1 1 259 5.0E-10
sp|Q9PQ76|FPG_UREPA Formamidopyrimidine-DNA glycosylase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=mutM PE=3 SV=3 1 228 5.0E-10
sp|A1U749|FPG_MARHV Formamidopyrimidine-DNA glycosylase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=mutM PE=3 SV=1 1 227 5.0E-10
sp|Q1LRP7|FPG_CUPMC Formamidopyrimidine-DNA glycosylase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=mutM PE=3 SV=1 1 223 6.0E-10
sp|Q11AV8|FPG_CHESB Formamidopyrimidine-DNA glycosylase OS=Chelativorans sp. (strain BNC1) GN=mutM PE=3 SV=1 1 294 6.0E-10
sp|Q21EE3|FPG_SACD2 Formamidopyrimidine-DNA glycosylase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=mutM PE=3 SV=1 1 234 6.0E-10
sp|Q0VLB7|FPG_ALCBS Formamidopyrimidine-DNA glycosylase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=mutM PE=3 SV=1 1 294 6.0E-10
sp|B1VG60|FPG_CORU7 Formamidopyrimidine-DNA glycosylase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=mutM PE=3 SV=1 1 236 7.0E-10
sp|A9BDY5|FPG_PROM4 Formamidopyrimidine-DNA glycosylase OS=Prochlorococcus marinus (strain MIT 9211) GN=mutM PE=3 SV=1 1 293 7.0E-10
sp|P64155|FPG_XYLFT Formamidopyrimidine-DNA glycosylase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=mutM1 PE=3 SV=3 1 227 1.0E-09
sp|P64154|FPG_XYLFA Formamidopyrimidine-DNA glycosylase OS=Xylella fastidiosa (strain 9a5c) GN=mutM1 PE=3 SV=3 1 227 1.0E-09
sp|B1XS61|FPG_POLNS Formamidopyrimidine-DNA glycosylase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=mutM PE=3 SV=1 1 246 1.0E-09
sp|Q5F8Z9|FPG_NEIG1 Formamidopyrimidine-DNA glycosylase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=mutM PE=3 SV=3 1 294 1.0E-09
sp|P55044|FPG_NEIMB Formamidopyrimidine-DNA glycosylase OS=Neisseria meningitidis serogroup B (strain MC58) GN=mutM PE=3 SV=4 1 294 1.0E-09
sp|C1DBB4|FPG_LARHH Formamidopyrimidine-DNA glycosylase OS=Laribacter hongkongensis (strain HLHK9) GN=mutM PE=3 SV=1 1 294 1.0E-09
sp|Q1MMD9|FPG_RHIL3 Formamidopyrimidine-DNA glycosylase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=mutM PE=3 SV=1 1 294 1.0E-09
sp|Q5YS09|FPG_NOCFA Formamidopyrimidine-DNA glycosylase OS=Nocardia farcinica (strain IFM 10152) GN=mutM PE=3 SV=3 1 239 1.0E-09
sp|Q1H3I3|FPG_METFK Formamidopyrimidine-DNA glycosylase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=mutM PE=3 SV=1 1 299 1.0E-09
sp|Q73G10|FPG_WOLPM Formamidopyrimidine-DNA glycosylase OS=Wolbachia pipientis wMel GN=mutM PE=3 SV=3 1 227 2.0E-09
sp|Q3J7U5|FPG_NITOC Formamidopyrimidine-DNA glycosylase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=mutM PE=3 SV=3 1 234 2.0E-09
sp|B4SRN0|FPG_STRM5 Formamidopyrimidine-DNA glycosylase OS=Stenotrophomonas maltophilia (strain R551-3) GN=mutM PE=3 SV=1 1 236 2.0E-09
sp|Q9A259|FPG_CAUCR Formamidopyrimidine-DNA glycosylase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=mutM PE=3 SV=4 1 293 2.0E-09
sp|B8GVY4|FPG_CAUCN Formamidopyrimidine-DNA glycosylase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=mutM PE=3 SV=1 1 293 2.0E-09
sp|Q7NQS5|FPG_CHRVO Formamidopyrimidine-DNA glycosylase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=mutM PE=3 SV=3 1 293 2.0E-09
sp|Q89WC9|FPG_BRADU Formamidopyrimidine-DNA glycosylase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=mutM PE=3 SV=3 1 294 2.0E-09
sp|A9W8R7|FPG_METEP Formamidopyrimidine-DNA glycosylase OS=Methylobacterium extorquens (strain PA1) GN=mutM PE=3 SV=1 1 295 2.0E-09
sp|C1B2Q5|FPG_RHOOB Formamidopyrimidine-DNA glycosylase OS=Rhodococcus opacus (strain B4) GN=mutM PE=3 SV=1 1 236 2.0E-09
sp|P75402|FPG_MYCPN Formamidopyrimidine-DNA glycosylase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=mutM PE=3 SV=3 1 237 2.0E-09
sp|A6UYG0|FPG_PSEA7 Formamidopyrimidine-DNA glycosylase OS=Pseudomonas aeruginosa (strain PA7) GN=mutM PE=3 SV=1 1 294 2.0E-09
sp|C3MCY7|FPG_RHISN Formamidopyrimidine-DNA glycosylase OS=Rhizobium sp. (strain NGR234) GN=mutM PE=3 SV=1 1 294 2.0E-09
sp|A1AV29|FPG_PELPD Formamidopyrimidine-DNA glycosylase OS=Pelobacter propionicus (strain DSM 2379) GN=mutM PE=3 SV=1 1 294 2.0E-09
sp|Q9L7T2|FPG_PSEAE Formamidopyrimidine-DNA glycosylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mutM PE=3 SV=3 1 294 2.0E-09
sp|Q02U58|FPG_PSEAB Formamidopyrimidine-DNA glycosylase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=mutM PE=3 SV=1 1 294 2.0E-09
sp|B7V2S0|FPG_PSEA8 Formamidopyrimidine-DNA glycosylase OS=Pseudomonas aeruginosa (strain LESB58) GN=mutM PE=3 SV=1 1 294 2.0E-09
sp|A6TFM6|FPG_KLEP7 Formamidopyrimidine-DNA glycosylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mutM PE=3 SV=1 1 294 3.0E-09
sp|Q47S77|FPG_THEFY Formamidopyrimidine-DNA glycosylase OS=Thermobifida fusca (strain YX) GN=mutM PE=3 SV=3 1 236 3.0E-09
sp|B7KN75|FPG_METC4 Formamidopyrimidine-DNA glycosylase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=mutM PE=3 SV=1 1 295 4.0E-09
sp|C3LQI3|FPG_VIBCM Formamidopyrimidine-DNA glycosylase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=mutM PE=3 SV=1 47 234 4.0E-09
sp|Q9KVC5|FPG_VIBCH Formamidopyrimidine-DNA glycosylase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=mutM PE=3 SV=3 47 234 4.0E-09
sp|A5F407|FPG_VIBC3 Formamidopyrimidine-DNA glycosylase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=mutM PE=3 SV=1 47 234 4.0E-09
sp|A7MQ97|FPG_CROS8 Formamidopyrimidine-DNA glycosylase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=mutM PE=3 SV=1 1 230 5.0E-09
sp|Q3BM92|FPG_XANC5 Formamidopyrimidine-DNA glycosylase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=mutM PE=3 SV=3 1 234 5.0E-09
sp|A6T2R7|FPG_JANMA Formamidopyrimidine-DNA glycosylase OS=Janthinobacterium sp. (strain Marseille) GN=mutM PE=3 SV=1 1 294 5.0E-09
sp|P55825|FPG_MYCGE Formamidopyrimidine-DNA glycosylase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=mutM PE=3 SV=3 1 239 5.0E-09
sp|A5UI87|FPG_HAEIG Formamidopyrimidine-DNA glycosylase OS=Haemophilus influenzae (strain PittGG) GN=mutM PE=3 SV=1 1 294 6.0E-09
sp|Q1GN82|FPG_SPHAL Formamidopyrimidine-DNA glycosylase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=mutM PE=3 SV=1 1 256 6.0E-09
sp|Q0S2E0|FPG_RHOJR Formamidopyrimidine-DNA glycosylase OS=Rhodococcus jostii (strain RHA1) GN=mutM PE=3 SV=1 1 239 6.0E-09
sp|Q479M6|FPG_DECAR Formamidopyrimidine-DNA glycosylase OS=Dechloromonas aromatica (strain RCB) GN=mutM PE=3 SV=3 1 227 7.0E-09
sp|A5CX90|FPG_VESOH Formamidopyrimidine-DNA glycosylase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=mutM PE=3 SV=1 1 246 7.0E-09
sp|Q4FUU7|FPG_PSYA2 Formamidopyrimidine-DNA glycosylase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=mutM PE=3 SV=3 1 297 7.0E-09
sp|Q13EN7|FPG_RHOPS Formamidopyrimidine-DNA glycosylase OS=Rhodopseudomonas palustris (strain BisB5) GN=mutM PE=3 SV=1 1 219 7.0E-09
sp|A9MKN9|FPG_SALAR Formamidopyrimidine-DNA glycosylase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=mutM PE=3 SV=1 1 230 8.0E-09
sp|A5VG06|FPG_SPHWW Formamidopyrimidine-DNA glycosylase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=mutM PE=3 SV=1 1 294 8.0E-09
sp|B2FU49|FPG_STRMK Formamidopyrimidine-DNA glycosylase OS=Stenotrophomonas maltophilia (strain K279a) GN=mutM PE=3 SV=1 1 236 9.0E-09
sp|B4F0X6|FPG_PROMH Formamidopyrimidine-DNA glycosylase OS=Proteus mirabilis (strain HI4320) GN=mutM PE=3 SV=1 1 230 1.0E-08
sp|A8GLE2|FPG_SERP5 Formamidopyrimidine-DNA glycosylase OS=Serratia proteamaculans (strain 568) GN=mutM PE=3 SV=1 1 294 1.0E-08
sp|B0UUX0|FPG_HISS2 Formamidopyrimidine-DNA glycosylase OS=Histophilus somni (strain 2336) GN=mutM PE=3 SV=1 1 294 1.0E-08
sp|Q0I0X6|FPG_HAES1 Formamidopyrimidine-DNA glycosylase OS=Haemophilus somnus (strain 129Pt) GN=mutM PE=3 SV=1 1 294 1.0E-08
sp|A5G7Q9|FPG_GEOUR Formamidopyrimidine-DNA glycosylase OS=Geobacter uraniireducens (strain Rf4) GN=mutM PE=3 SV=1 1 236 1.0E-08
sp|Q08079|FPG_SYNP6 Formamidopyrimidine-DNA glycosylase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=mutM PE=3 SV=4 1 293 1.0E-08
sp|Q4QLW2|FPG_HAEI8 Formamidopyrimidine-DNA glycosylase OS=Haemophilus influenzae (strain 86-028NP) GN=mutM PE=3 SV=3 1 294 1.0E-08
sp|Q21XW7|FPG_RHOFT Formamidopyrimidine-DNA glycosylase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=mutM PE=3 SV=1 1 294 1.0E-08
sp|P57014|FPG_NEIMA Formamidopyrimidine-DNA glycosylase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=mutM PE=3 SV=3 1 294 1.0E-08
sp|A4Y028|FPG_PSEMY Formamidopyrimidine-DNA glycosylase OS=Pseudomonas mendocina (strain ymp) GN=mutM PE=3 SV=1 1 294 1.0E-08
sp|Q5GS47|FPG_WOLTR Formamidopyrimidine-DNA glycosylase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=mutM PE=3 SV=3 1 227 1.0E-08
sp|A4W514|FPG_ENT38 Formamidopyrimidine-DNA glycosylase OS=Enterobacter sp. (strain 638) GN=mutM PE=3 SV=1 1 230 2.0E-08
sp|C6DIB8|FPG_PECCP Formamidopyrimidine-DNA glycosylase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mutM PE=3 SV=1 1 234 2.0E-08
sp|Q3SLR9|FPG_THIDA Formamidopyrimidine-DNA glycosylase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=mutM PE=3 SV=3 1 236 2.0E-08
sp|A9KW47|FPG_SHEB9 Formamidopyrimidine-DNA glycosylase OS=Shewanella baltica (strain OS195) GN=mutM PE=3 SV=1 1 234 3.0E-08
sp|B8EDQ9|FPG_SHEB2 Formamidopyrimidine-DNA glycosylase OS=Shewanella baltica (strain OS223) GN=mutM PE=3 SV=1 1 234 3.0E-08
sp|Q6DAV4|FPG_PECAS Formamidopyrimidine-DNA glycosylase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mutM PE=3 SV=3 1 234 3.0E-08
sp|B2VF70|FPG_ERWT9 Formamidopyrimidine-DNA glycosylase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=mutM PE=3 SV=1 1 230 3.0E-08
sp|P44948|FPG_HAEIN Formamidopyrimidine-DNA glycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=mutM PE=3 SV=3 1 294 4.0E-08
sp|B3PZ93|FPG_RHIE6 Formamidopyrimidine-DNA glycosylase OS=Rhizobium etli (strain CIAT 652) GN=mutM PE=3 SV=1 1 294 4.0E-08
sp|A9I6Y3|FPG_BORPD Formamidopyrimidine-DNA glycosylase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=mutM PE=3 SV=1 1 294 4.0E-08
sp|A6WUE9|FPG_SHEB8 Formamidopyrimidine-DNA glycosylase OS=Shewanella baltica (strain OS185) GN=mutM PE=3 SV=1 1 259 4.0E-08
sp|A3CYP7|FPG_SHEB5 Formamidopyrimidine-DNA glycosylase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=mutM PE=3 SV=1 1 259 4.0E-08
sp|Q8PEQ4|FPG_XANAC Formamidopyrimidine-DNA glycosylase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=mutM PE=3 SV=3 1 234 4.0E-08
sp|A5UDC3|FPG_HAEIE Formamidopyrimidine-DNA glycosylase OS=Haemophilus influenzae (strain PittEE) GN=mutM PE=3 SV=1 1 294 4.0E-08
sp|B1ZGU8|FPG_METPB Formamidopyrimidine-DNA glycosylase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=mutM PE=3 SV=1 1 217 4.0E-08
sp|A6UFF8|FPG_SINMW Formamidopyrimidine-DNA glycosylase OS=Sinorhizobium medicae (strain WSM419) GN=mutM PE=3 SV=1 1 294 4.0E-08
sp|Q0HDC3|FPG_SHESM Formamidopyrimidine-DNA glycosylase OS=Shewanella sp. (strain MR-4) GN=mutM PE=3 SV=1 1 234 5.0E-08
sp|A0L2N2|FPG_SHESA Formamidopyrimidine-DNA glycosylase OS=Shewanella sp. (strain ANA-3) GN=mutM PE=3 SV=1 1 234 5.0E-08
sp|Q0HPK4|FPG_SHESR Formamidopyrimidine-DNA glycosylase OS=Shewanella sp. (strain MR-7) GN=mutM PE=3 SV=1 1 234 5.0E-08
sp|Q2KDA9|FPG_RHIEC Formamidopyrimidine-DNA glycosylase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=mutM PE=3 SV=1 1 294 5.0E-08
sp|Q8Z2H2|FPG_SALTI Formamidopyrimidine-DNA glycosylase OS=Salmonella typhi GN=mutM PE=3 SV=3 1 230 6.0E-08
sp|B4TZX7|FPG_SALSV Formamidopyrimidine-DNA glycosylase OS=Salmonella schwarzengrund (strain CVM19633) GN=mutM PE=3 SV=1 1 230 6.0E-08
sp|B5BI09|FPG_SALPK Formamidopyrimidine-DNA glycosylase OS=Salmonella paratyphi A (strain AKU_12601) GN=mutM PE=3 SV=1 1 230 6.0E-08
sp|Q5PC09|FPG_SALPA Formamidopyrimidine-DNA glycosylase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mutM PE=3 SV=3 1 230 6.0E-08
sp|B5RGF2|FPG_SALG2 Formamidopyrimidine-DNA glycosylase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=mutM PE=3 SV=1 1 230 6.0E-08
sp|B5R5F9|FPG_SALEP Formamidopyrimidine-DNA glycosylase OS=Salmonella enteritidis PT4 (strain P125109) GN=mutM PE=3 SV=1 1 230 6.0E-08
sp|Q4ZM34|FPG_PSEU2 Formamidopyrimidine-DNA glycosylase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=mutM PE=3 SV=3 1 294 6.0E-08
sp|A9MVN0|FPG_SALPB Formamidopyrimidine-DNA glycosylase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mutM PE=3 SV=1 1 230 7.0E-08
sp|Q28JI5|FPG_JANSC Formamidopyrimidine-DNA glycosylase OS=Jannaschia sp. (strain CCS1) GN=mutM PE=3 SV=1 1 247 7.0E-08
sp|B3PG51|FPG_CELJU Formamidopyrimidine-DNA glycosylase OS=Cellvibrio japonicus (strain Ueda107) GN=mutM PE=3 SV=1 1 236 8.0E-08
sp|B5EXE0|FPG_SALA4 Formamidopyrimidine-DNA glycosylase OS=Salmonella agona (strain SL483) GN=mutM PE=3 SV=1 1 230 8.0E-08
sp|Q48CK1|FPG_PSE14 Formamidopyrimidine-DNA glycosylase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=mutM PE=3 SV=3 1 294 9.0E-08
sp|C0Q1W8|FPG_SALPC Formamidopyrimidine-DNA glycosylase OS=Salmonella paratyphi C (strain RKS4594) GN=mutM PE=3 SV=1 1 230 9.0E-08
sp|Q57IA7|FPG_SALCH Formamidopyrimidine-DNA glycosylase OS=Salmonella choleraesuis (strain SC-B67) GN=mutM PE=3 SV=3 1 230 9.0E-08
sp|Q2J2I0|FPG_RHOP2 Formamidopyrimidine-DNA glycosylase OS=Rhodopseudomonas palustris (strain HaA2) GN=mutM PE=3 SV=1 1 219 9.0E-08
sp|B5FM59|FPG_SALDC Formamidopyrimidine-DNA glycosylase OS=Salmonella dublin (strain CT_02021853) GN=mutM PE=3 SV=1 1 230 1.0E-07
sp|Q07UF4|FPG_RHOP5 Formamidopyrimidine-DNA glycosylase OS=Rhodopseudomonas palustris (strain BisA53) GN=mutM PE=3 SV=1 1 294 1.0E-07
sp|Q5E8M1|FPG_VIBF1 Formamidopyrimidine-DNA glycosylase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=mutM PE=3 SV=3 1 260 1.0E-07
sp|O54326|FPG_SALTY Formamidopyrimidine-DNA glycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mutM PE=3 SV=3 1 230 1.0E-07
sp|B4T9C0|FPG_SALHS Formamidopyrimidine-DNA glycosylase OS=Salmonella heidelberg (strain SL476) GN=mutM PE=3 SV=1 1 230 1.0E-07
sp|A8ARM2|FPG_CITK8 Formamidopyrimidine-DNA glycosylase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mutM PE=3 SV=1 1 230 1.0E-07
sp|A7MSN3|FPG_VIBCB Formamidopyrimidine-DNA glycosylase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=mutM PE=3 SV=1 47 234 1.0E-07
sp|Q88AH6|FPG_PSESM Formamidopyrimidine-DNA glycosylase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=mutM PE=3 SV=3 1 294 1.0E-07
sp|A4G916|FPG_HERAR Formamidopyrimidine-DNA glycosylase OS=Herminiimonas arsenicoxydans GN=mutM PE=3 SV=1 1 294 2.0E-07
sp|B4SXD7|FPG_SALNS Formamidopyrimidine-DNA glycosylase OS=Salmonella newport (strain SL254) GN=mutM PE=3 SV=1 1 230 2.0E-07
sp|B5FFG1|FPG_VIBFM Formamidopyrimidine-DNA glycosylase OS=Vibrio fischeri (strain MJ11) GN=mutM PE=3 SV=1 1 234 2.0E-07
sp|A6W7S6|FPG_KINRD Formamidopyrimidine-DNA glycosylase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=mutM PE=3 SV=1 1 207 2.0E-07
sp|Q31EB2|FPG_THICR Formamidopyrimidine-DNA glycosylase OS=Thiomicrospira crunogena (strain XCL-2) GN=mutM PE=3 SV=1 1 234 2.0E-07
sp|A1JHR7|FPG_YERE8 Formamidopyrimidine-DNA glycosylase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mutM PE=3 SV=1 1 230 3.0E-07
sp|Q4K4A5|FPG_PSEF5 Formamidopyrimidine-DNA glycosylase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=mutM PE=3 SV=3 1 293 3.0E-07
sp|A0L837|FPG_MAGMM Formamidopyrimidine-DNA glycosylase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=mutM PE=3 SV=1 1 294 3.0E-07
sp|Q5H667|FPG_XANOR Formamidopyrimidine-DNA glycosylase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=mutM PE=3 SV=3 1 234 4.0E-07
sp|B2STU3|FPG_XANOP Formamidopyrimidine-DNA glycosylase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=mutM PE=3 SV=1 1 234 4.0E-07
sp|Q2P8V2|FPG_XANOM Formamidopyrimidine-DNA glycosylase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=mutM PE=3 SV=1 1 234 4.0E-07
sp|Q3K566|FPG_PSEPF Formamidopyrimidine-DNA glycosylase OS=Pseudomonas fluorescens (strain Pf0-1) GN=mutM PE=3 SV=3 1 235 8.0E-07
sp|A1SR12|FPG_PSYIN Formamidopyrimidine-DNA glycosylase OS=Psychromonas ingrahamii (strain 37) GN=mutM PE=3 SV=1 1 293 9.0E-07
sp|B7NPE1|FPG_ECO7I Formamidopyrimidine-DNA glycosylase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mutM PE=3 SV=1 1 230 1.0E-06
sp|Q329M2|FPG_SHIDS Formamidopyrimidine-DNA glycosylase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=mutM PE=3 SV=3 1 230 1.0E-06
sp|Q8FC87|FPG_ECOL6 Formamidopyrimidine-DNA glycosylase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mutM PE=3 SV=3 1 230 1.0E-06
sp|A4TSD4|FPG_YERPP Formamidopyrimidine-DNA glycosylase OS=Yersinia pestis (strain Pestoides F) GN=mutM PE=3 SV=1 1 219 1.0E-06
sp|B1JQX0|FPG_YERPY Formamidopyrimidine-DNA glycosylase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mutM PE=3 SV=1 1 219 2.0E-06
sp|Q66GD3|FPG_YERPS Formamidopyrimidine-DNA glycosylase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mutM PE=3 SV=3 1 219 2.0E-06
sp|Q1CD05|FPG_YERPN Formamidopyrimidine-DNA glycosylase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mutM PE=3 SV=1 1 219 2.0E-06
sp|A9R677|FPG_YERPG Formamidopyrimidine-DNA glycosylase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mutM PE=3 SV=1 1 219 2.0E-06
sp|Q8ZJP0|FPG_YERPE Formamidopyrimidine-DNA glycosylase OS=Yersinia pestis GN=mutM PE=3 SV=3 1 219 2.0E-06
sp|B2JYN6|FPG_YERPB Formamidopyrimidine-DNA glycosylase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mutM PE=3 SV=1 1 219 2.0E-06
sp|Q1C270|FPG_YERPA Formamidopyrimidine-DNA glycosylase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mutM PE=3 SV=1 1 219 2.0E-06
sp|A7FCT7|FPG_YERP3 Formamidopyrimidine-DNA glycosylase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mutM PE=3 SV=1 1 219 2.0E-06
sp|B0BU16|FPG_ACTPJ Formamidopyrimidine-DNA glycosylase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=mutM PE=3 SV=1 1 234 2.0E-06
sp|P05523|FPG_ECOLI Formamidopyrimidine-DNA glycosylase OS=Escherichia coli (strain K12) GN=mutM PE=1 SV=3 1 230 2.0E-06
sp|A8A697|FPG_ECOHS Formamidopyrimidine-DNA glycosylase OS=Escherichia coli O9:H4 (strain HS) GN=mutM PE=3 SV=1 1 230 2.0E-06
sp|B1X969|FPG_ECODH Formamidopyrimidine-DNA glycosylase OS=Escherichia coli (strain K12 / DH10B) GN=mutM PE=3 SV=1 1 230 2.0E-06
sp|C4ZXM7|FPG_ECOBW Formamidopyrimidine-DNA glycosylase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mutM PE=3 SV=1 1 230 2.0E-06
sp|Q3YVZ7|FPG_SHISS Formamidopyrimidine-DNA glycosylase OS=Shigella sonnei (strain Ss046) GN=mutM PE=3 SV=3 1 230 2.0E-06
sp|P64149|FPG_SHIFL Formamidopyrimidine-DNA glycosylase OS=Shigella flexneri GN=mutM PE=3 SV=3 1 230 2.0E-06
sp|Q0SYG3|FPG_SHIF8 Formamidopyrimidine-DNA glycosylase OS=Shigella flexneri serotype 5b (strain 8401) GN=mutM PE=3 SV=1 1 230 2.0E-06
sp|Q31UZ1|FPG_SHIBS Formamidopyrimidine-DNA glycosylase OS=Shigella boydii serotype 4 (strain Sb227) GN=mutM PE=3 SV=3 1 230 2.0E-06
sp|B2TTU9|FPG_SHIB3 Formamidopyrimidine-DNA glycosylase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mutM PE=3 SV=1 1 230 2.0E-06
sp|B7LVJ6|FPG_ESCF3 Formamidopyrimidine-DNA glycosylase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mutM PE=3 SV=1 1 230 2.0E-06
sp|Q1R4V8|FPG_ECOUT Formamidopyrimidine-DNA glycosylase OS=Escherichia coli (strain UTI89 / UPEC) GN=mutM PE=3 SV=1 1 230 2.0E-06
sp|B1LK72|FPG_ECOSM Formamidopyrimidine-DNA glycosylase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mutM PE=3 SV=1 1 230 2.0E-06
sp|B6I3L2|FPG_ECOSE Formamidopyrimidine-DNA glycosylase OS=Escherichia coli (strain SE11) GN=mutM PE=3 SV=1 1 230 2.0E-06
sp|B7NET9|FPG_ECOLU Formamidopyrimidine-DNA glycosylase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mutM PE=3 SV=1 1 230 2.0E-06
sp|B1IZF8|FPG_ECOLC Formamidopyrimidine-DNA glycosylase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mutM PE=3 SV=1 1 230 2.0E-06
sp|A1AHG8|FPG_ECOK1 Formamidopyrimidine-DNA glycosylase OS=Escherichia coli O1:K1 / APEC GN=mutM PE=3 SV=1 1 230 2.0E-06
sp|B7M4B9|FPG_ECO8A Formamidopyrimidine-DNA glycosylase OS=Escherichia coli O8 (strain IAI1) GN=mutM PE=3 SV=1 1 230 2.0E-06
sp|B7N2X1|FPG_ECO81 Formamidopyrimidine-DNA glycosylase OS=Escherichia coli O81 (strain ED1a) GN=mutM PE=3 SV=1 1 230 2.0E-06
sp|B5YWD3|FPG_ECO5E Formamidopyrimidine-DNA glycosylase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mutM PE=3 SV=1 1 230 2.0E-06
sp|P64148|FPG_ECO57 Formamidopyrimidine-DNA glycosylase OS=Escherichia coli O157:H7 GN=mutM PE=3 SV=3 1 230 2.0E-06
sp|B7MFJ6|FPG_ECO45 Formamidopyrimidine-DNA glycosylase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mutM PE=3 SV=1 1 230 2.0E-06
sp|B7ULJ0|FPG_ECO27 Formamidopyrimidine-DNA glycosylase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mutM PE=3 SV=1 1 230 2.0E-06
sp|A7ZTI6|FPG_ECO24 Formamidopyrimidine-DNA glycosylase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mutM PE=3 SV=1 1 230 2.0E-06
sp|A1VKP2|FPG_POLNA Formamidopyrimidine-DNA glycosylase OS=Polaromonas naphthalenivorans (strain CJ2) GN=mutM PE=3 SV=1 1 294 2.0E-06
sp|B7L758|FPG_ECO55 Formamidopyrimidine-DNA glycosylase OS=Escherichia coli (strain 55989 / EAEC) GN=mutM PE=3 SV=1 1 230 2.0E-06
sp|Q87T81|FPG_VIBPA Formamidopyrimidine-DNA glycosylase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=mutM PE=3 SV=3 1 294 2.0E-06
sp|Q8VW76|FPG_PHODP Formamidopyrimidine-DNA glycosylase OS=Photobacterium damsela subsp. piscicida GN=mutM PE=3 SV=3 1 294 3.0E-06
sp|Q0TBH4|FPG_ECOL5 Formamidopyrimidine-DNA glycosylase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mutM PE=3 SV=1 1 230 3.0E-06
sp|A4VRM9|FPG_PSEU5 Formamidopyrimidine-DNA glycosylase OS=Pseudomonas stutzeri (strain A1501) GN=mutM PE=3 SV=1 1 235 4.0E-06
sp|Q8DDY4|FPG_VIBVU Formamidopyrimidine-DNA glycosylase OS=Vibrio vulnificus (strain CMCP6) GN=mutM PE=3 SV=3 1 293 5.0E-06
sp|Q2KYB7|FPG_BORA1 Formamidopyrimidine-DNA glycosylase OS=Bordetella avium (strain 197N) GN=mutM PE=3 SV=1 1 227 9.0E-06
sp|Q7MPS3|FPG_VIBVY Formamidopyrimidine-DNA glycosylase OS=Vibrio vulnificus (strain YJ016) GN=mutM PE=3 SV=3 1 234 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0006284 base-excision repair Yes
GO:0003684 damaged DNA binding Yes
GO:0008270 zinc ion binding Yes
GO:0019104 DNA N-glycosylase activity Yes
GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity Yes
GO:0016799 hydrolase activity, hydrolyzing N-glycosyl compounds Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0046872 metal ion binding No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044238 primary metabolic process No
GO:0006950 response to stress No
GO:0033554 cellular response to stress No
GO:0005488 binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016787 hydrolase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0051716 cellular response to stimulus No
GO:0090304 nucleic acid metabolic process No
GO:0050896 response to stimulus No
GO:0046483 heterocycle metabolic process No
GO:0003676 nucleic acid binding No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0003677 DNA binding No
GO:0006281 DNA repair No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0044237 cellular metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0046914 transition metal ion binding No
GO:0071704 organic substance metabolic process No
GO:0140097 catalytic activity, acting on DNA No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0009987 cellular process No
GO:0097159 organic cyclic compound binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006259 DNA metabolic process No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|009050
MPELPEVERATRLLNALGADKKITKVETADDTIVYSGVTSTEFAACLTGRKVIRAHRYGKVFFMELNGDGKHPVM
HFGMTGMLHVKGQSPTHYREAPSDTTVSEWPPRWMKFILHLTNPKNGQTTEIAFRDARRLGRIRLCASPRTEPPI
SELGFDPLLSMPTFSEFLTLFRKRRGIAIKVLLLDQTFSAGVGNWVADEVLYHARIHPEQRCNTLSQEQLQALHE
KITYVCETATSVDADDSQFPDNWLFKHRWGKGNKKRKHSALTLPSGEPATIEWVTVGGRTSAYVPELQKLVAPSG
RDNQSTAQNLPLKSKRRNISQTCDEEAKPSESVIIRGSTRHSVSTRLRARTKREDGNNG*
Coding >Agabi119p4|009050
ATGCCTGAATTACCAGAAGTGGAACGAGCGACACGGTTGCTTAACGCACTTGGCGCTGACAAGAAGATTACTAAA
GTGGAGACGGCGGATGACACTATCGTGTATTCTGGCGTTACTTCTACTGAGTTCGCTGCATGCCTGACTGGCCGA
AAAGTAATTCGGGCTCATAGATATGGAAAGGTTTTCTTCATGGAACTCAACGGTGATGGAAAACACCCAGTCATG
CACTTCGGTATGACAGGAATGCTCCATGTCAAGGGTCAGTCGCCTACACACTATCGCGAAGCACCTTCGGATACA
ACTGTCTCCGAATGGCCCCCGAGGTGGATGAAGTTCATTTTACATCTTACAAATCCTAAAAACGGTCAGACTACA
GAAATCGCATTCCGGGATGCTCGGAGATTGGGTCGTATCCGTTTGTGCGCTTCTCCACGTACCGAACCACCGATC
TCGGAACTGGGTTTTGATCCTTTGCTCTCTATGCCGACGTTTTCAGAATTCTTGACTCTCTTCCGCAAGCGAAGG
GGCATTGCCATCAAAGTTCTACTTTTAGATCAGACTTTCAGTGCGGGGGTTGGCAATTGGGTTGCCGATGAGGTG
TTATATCATGCACGAATACATCCGGAACAAAGGTGTAACACGCTTTCGCAAGAACAGCTTCAGGCTTTACACGAG
AAGATCACATATGTATGCGAGACGGCGACTTCAGTAGACGCCGACGATAGCCAATTCCCTGATAATTGGCTCTTT
AAACATCGATGGGGGAAAGGAAACAAGAAAAGGAAACACTCGGCTTTAACTTTGCCTTCTGGTGAGCCGGCTACC
ATAGAATGGGTTACCGTCGGCGGTCGCACGTCAGCATATGTCCCGGAACTGCAGAAGCTTGTAGCCCCTTCCGGC
CGAGATAATCAGTCAACGGCACAAAATTTACCGTTAAAATCAAAAAGGCGCAACATCTCCCAGACCTGCGACGAG
GAAGCAAAGCCTTCAGAATCGGTGATAATTCGCGGGTCAACGAGGCATTCTGTTTCGACCCGTCTGCGAGCACGA
ACCAAGCGTGAAGATGGTAATAATGGTTAA
Transcript >Agabi119p4|009050
ATGCCTGAATTACCAGAAGTGGAACGAGCGACACGGTTGCTTAACGCACTTGGCGCTGACAAGAAGATTACTAAA
GTGGAGACGGCGGATGACACTATCGTGTATTCTGGCGTTACTTCTACTGAGTTCGCTGCATGCCTGACTGGCCGA
AAAGTAATTCGGGCTCATAGATATGGAAAGGTTTTCTTCATGGAACTCAACGGTGATGGAAAACACCCAGTCATG
CACTTCGGTATGACAGGAATGCTCCATGTCAAGGGTCAGTCGCCTACACACTATCGCGAAGCACCTTCGGATACA
ACTGTCTCCGAATGGCCCCCGAGGTGGATGAAGTTCATTTTACATCTTACAAATCCTAAAAACGGTCAGACTACA
GAAATCGCATTCCGGGATGCTCGGAGATTGGGTCGTATCCGTTTGTGCGCTTCTCCACGTACCGAACCACCGATC
TCGGAACTGGGTTTTGATCCTTTGCTCTCTATGCCGACGTTTTCAGAATTCTTGACTCTCTTCCGCAAGCGAAGG
GGCATTGCCATCAAAGTTCTACTTTTAGATCAGACTTTCAGTGCGGGGGTTGGCAATTGGGTTGCCGATGAGGTG
TTATATCATGCACGAATACATCCGGAACAAAGGTGTAACACGCTTTCGCAAGAACAGCTTCAGGCTTTACACGAG
AAGATCACATATGTATGCGAGACGGCGACTTCAGTAGACGCCGACGATAGCCAATTCCCTGATAATTGGCTCTTT
AAACATCGATGGGGGAAAGGAAACAAGAAAAGGAAACACTCGGCTTTAACTTTGCCTTCTGGTGAGCCGGCTACC
ATAGAATGGGTTACCGTCGGCGGTCGCACGTCAGCATATGTCCCGGAACTGCAGAAGCTTGTAGCCCCTTCCGGC
CGAGATAATCAGTCAACGGCACAAAATTTACCGTTAAAATCAAAAAGGCGCAACATCTCCCAGACCTGCGACGAG
GAAGCAAAGCCTTCAGAATCGGTGATAATTCGCGGGTCAACGAGGCATTCTGTTTCGACCCGTCTGCGAGCACGA
ACCAAGCGTGAAGATGGTAATAATGGTTAA
Gene >Agabi119p4|009050
ATGCCTGAATTACCAGGTAGGAAAATTCCGTTTTTTCAGATGGAAAAACGATTGACTCGGGTCGTTGTAGAAGTG
GAACGAGCGACACGGTTGCTTAACGCACTTGGCGCTGACAAGAAGATTACTAAAGTGGAGACGGCGGATGACACT
ATCGTGTATTCTGGCGTTACTTCTACTGAGTTCGTGAGTCGAGGTCACTTCACAGCGAAGTTTCAAGATGATATT
CTTCTAGGCTGCATGCCTGACTGGCCGAAAAGTAATTCGGGCTCATAGATATGGTCAGCCCATTAATCCATTTCA
CCGTCAGCACTATGACCTTGGCTTGCCTGCTAGGAAAGGTTTTCTTCATGGAACTCAACGGTGATGGAAAACACC
CAGTCATGCACTTCGGTATGACAGGAATGCTCCATGCATGTATAGAATCATAGGTTTTGCCGTCTAAAATTGACT
TACGACTCTTCGTGTGCAGGTCAAGGGTCAGTCGCCTACACACTATCGCGAAGCACCTTCGGATACAACTGTCTC
CGAATGGCCCCCGAGGTGGATGAAGGTGCTCACGACGCTTTGAATCAGTGTGTTATCCAACTGAACCACAACTTG
ATAGTTCATTTTACATCTTACAAATCCTAAAAACGGTCAGACTACAGAAATCGCATTCCGGGATGCTCGGAGATT
GGGTCGTATCCGTTTGTGCGCTTCTCCACGTACCGAACCACCGATCTCGGAACTGGGTTTTGATCCTTTGCTCTC
TATGCCGACGTTTTCAGAATTCTTGACTCTCTTCCGCAAGCGAAGGGGCATTGCCATCAAAGTTCTACTTTTAGA
TCAGACTTTCAGTGCGGGGGTTGGCAATTGGGTTGCCGGTATGAACTTTCACCAGATTCAGCACTTCATCTTCGC
ACTCATGGAAGTACTTTTTAGATGAGGTGTTATATCATGCACGAATACATCCGGAACAAAGGTGTAACACGCTTT
CGCAAGAACAGCTTCAGGCTTTACACGAGAAGATCACATATGTATGCGAGACGGCGACTTCAGTAGACGCCGACG
ATAGCCAATTCCCTGATAATTGGCTCTTTAAACATCGATGGGTAGGTTTTCTTTTTCTGACTCGTAAACTTCGCA
GTCGCCTCATCGAAGGCCAGGGGAAAGGAAACAAGAAAAGGAAACACTCGGCTTTAACTTTGGTAAGTAAGATAA
TATTGTATATATTACGTTTTCATATGCTGATTATTTTCAGCCTTCTGGTGAGCCGGCTACCATAGAATGGGTTAC
CGTCGGCGGTCGCACGTCAGCATATGTCCCGGAACTGCAGAAGCTTGTAGCCCCTTCCGGCCGAGATAATCAGGT
GATAACGTACGCGCATTTATTCGCTGGCATTTTTTTGACTATCCTCTTGAGTCAACGGCACAAAATTTACCGTTA
AAATCAAAAAGGCGCAACATCTCCCAGACCTGCGACGAGGAAGCAAAGCCTTCAGAATCGGTGATAATTCGCGGG
TCAACGAGGCATTCTGTTTCGACCCGTCTGCGAGCACGAACCAAGCGTGAAGATGGTAATAATGGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail