Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|009010
Gene name
Locationscaffold_01a:2106856..2107327
Strand+
Gene length (bp)471
Transcript length (bp)420
Coding sequence length (bp)420
Protein length (aa) 140

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05047 L51_S25_CI-B8 Mitochondrial ribosomal protein L51 / S25 / CI-B8 domain 1.1E-08 42 90

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UUC8|RM51_SCHPO 54S ribosomal protein L51, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl51 PE=3 SV=1 11 130 2.0E-20
sp|Q06090|RM51_YEAST 54S ribosomal protein L51, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL51 PE=1 SV=1 15 134 3.0E-15
sp|Q758S3|RM51_ASHGO 54S ribosomal protein L51, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRPL51 PE=3 SV=1 15 135 2.0E-14
sp|Q95KE5|RM43_BOVIN 39S ribosomal protein L43, mitochondrial OS=Bos taurus GN=MRPL43 PE=2 SV=2 15 129 3.0E-07
sp|Q99N89|RM43_MOUSE 39S ribosomal protein L43, mitochondrial OS=Mus musculus GN=Mrpl43 PE=1 SV=1 15 130 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|009010
MQPLLRAALRSRPANGHTTFLPQIRKLVFEYCDKWPSSHNTRTFLCTRLQDLARENPHLELVVKQRNHKEPIVRG
FYVNNRDKVVPLNSLEVTAIQQKIRLLLDASGAKIKPLKRRPVESTTESPRGIWSGLHADRPIL*
Coding >Agabi119p4|009010
ATGCAGCCCCTCCTCCGCGCCGCCCTCCGCTCAAGGCCCGCCAACGGCCACACCACTTTCCTACCCCAGATCAGG
AAACTCGTCTTTGAGTATTGCGACAAGTGGCCCTCCTCCCACAACACCCGCACCTTTCTCTGCACCCGCCTCCAG
GACCTTGCCCGCGAAAATCCCCATCTCGAGCTCGTCGTCAAACAGCGCAATCACAAGGAGCCCATCGTCCGCGGC
TTCTATGTCAACAACCGCGATAAAGTCGTCCCCCTCAACAGTCTAGAAGTCACTGCAATCCAACAAAAAATTCGC
CTCTTACTCGACGCGTCGGGCGCAAAAATTAAACCCCTCAAGCGCAGACCCGTAGAGAGCACTACAGAATCCCCC
AGAGGCATATGGAGTGGTCTCCACGCCGACCGGCCTATTCTATGA
Transcript >Agabi119p4|009010
ATGCAGCCCCTCCTCCGCGCCGCCCTCCGCTCAAGGCCCGCCAACGGCCACACCACTTTCCTACCCCAGATCAGG
AAACTCGTCTTTGAGTATTGCGACAAGTGGCCCTCCTCCCACAACACCCGCACCTTTCTCTGCACCCGCCTCCAG
GACCTTGCCCGCGAAAATCCCCATCTCGAGCTCGTCGTCAAACAGCGCAATCACAAGGAGCCCATCGTCCGCGGC
TTCTATGTCAACAACCGCGATAAAGTCGTCCCCCTCAACAGTCTAGAAGTCACTGCAATCCAACAAAAAATTCGC
CTCTTACTCGACGCGTCGGGCGCAAAAATTAAACCCCTCAAGCGCAGACCCGTAGAGAGCACTACAGAATCCCCC
AGAGGCATATGGAGTGGTCTCCACGCCGACCGGCCTATTCTATGA
Gene >Agabi119p4|009010
ATGCAGCCCCTCCTCCGCGCCGCCCTCCGCTCAAGGCCCGCCAACGGCCACACCACTTTCCTACCCCAGATCAGG
AAACTCGTCTTTGAGTATTGCGACAAGTGGCCCTCCTCCCACAACACCCGCACCTTTCTCTGCACCCGCCTCCAG
GACCTTGCCCGCGAAAATCCCCATCTCGAGCTCGTCGTCAAACAGCGCAATCACAAGGAGCCCATCGTCCGCGGC
TTCTATGGCGCGTACTTTTCATTTGTTGCACATATCATCACGCTCATCCCCGCCTCAGTCAACAACCGCGATAAA
GTCGTCCCCCTCAACAGTCTAGAAGTCACTGCAATCCAACAAAAAATTCGCCTCTTACTCGACGCGTCGGGCGCA
AAAATTAAACCCCTCAAGCGCAGACCCGTAGAGAGCACTACAGAATCCCCCAGAGGCATATGGAGTGGTCTCCAC
GCCGACCGGCCTATTCTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail