Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|008820
Gene name
Locationscaffold_01a:2057581..2059616
Strand+
Gene length (bp)2035
Transcript length (bp)1761
Coding sequence length (bp)1761
Protein length (aa) 587

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04051 TRAPP Transport protein particle (TRAPP) component 1.0E-39 76 231
PF01180 DHO_dh Dihydroorotate dehydrogenase 3.0E-15 273 581

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7N9|TRS31_SCHPO Transport protein particle subunit trs31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trs31 PE=3 SV=1 40 235 3.0E-58
sp|Q54YG5|TPPC5_DICDI Trafficking protein particle complex subunit 5 OS=Dictyostelium discoideum GN=trappc5 PE=3 SV=1 57 231 3.0E-44
sp|Q8IUR0|TPPC5_HUMAN Trafficking protein particle complex subunit 5 OS=Homo sapiens GN=TRAPPC5 PE=1 SV=1 58 234 5.0E-38
sp|Q9CQA1|TPPC5_MOUSE Trafficking protein particle complex subunit 5 OS=Mus musculus GN=Trappc5 PE=1 SV=1 58 234 8.0E-38
sp|Q2NL13|TPPC5_BOVIN Trafficking protein particle complex subunit 5 OS=Bos taurus GN=TRAPPC5 PE=2 SV=1 58 234 8.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7N9|TRS31_SCHPO Transport protein particle subunit trs31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trs31 PE=3 SV=1 40 235 3.0E-58
sp|Q54YG5|TPPC5_DICDI Trafficking protein particle complex subunit 5 OS=Dictyostelium discoideum GN=trappc5 PE=3 SV=1 57 231 3.0E-44
sp|Q8IUR0|TPPC5_HUMAN Trafficking protein particle complex subunit 5 OS=Homo sapiens GN=TRAPPC5 PE=1 SV=1 58 234 5.0E-38
sp|Q9CQA1|TPPC5_MOUSE Trafficking protein particle complex subunit 5 OS=Mus musculus GN=Trappc5 PE=1 SV=1 58 234 8.0E-38
sp|Q2NL13|TPPC5_BOVIN Trafficking protein particle complex subunit 5 OS=Bos taurus GN=TRAPPC5 PE=2 SV=1 58 234 8.0E-38
sp|Q5F359|TPPC5_CHICK Trafficking protein particle complex subunit 5 OS=Gallus gallus GN=TRAPPC5 PE=2 SV=1 53 233 2.0E-34
sp|P15847|TPPC5_PLAFA Trafficking protein particle complex subunit 5 OS=Plasmodium falciparum PE=3 SV=1 60 231 8.0E-22
sp|Q7KQM2|TPPC5_PLAF7 Trafficking protein particle complex subunit 5 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0358 PE=3 SV=1 60 231 8.0E-22
sp|Q03337|TRS31_YEAST Trafficking protein particle complex subunit 31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRS31 PE=1 SV=1 19 233 2.0E-21
sp|A2RDV3|PYRDA_STRPG Putative dihydroorotate dehydrogenase A (fumarate) OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=pyrD PE=3 SV=1 261 581 1.0E-18
sp|Q8P0C0|PYRDA_STRP8 Putative dihydroorotate dehydrogenase A (fumarate) OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=pyrD PE=3 SV=1 261 581 3.0E-18
sp|Q99Z28|PYRDA_STRP1 Putative dihydroorotate dehydrogenase A (fumarate) OS=Streptococcus pyogenes serotype M1 GN=pyrD PE=3 SV=1 261 581 6.0E-18
sp|P0DD67|PYRDA_STRPQ Putative dihydroorotate dehydrogenase A (fumarate) OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=pyrD PE=3 SV=1 261 581 6.0E-18
sp|P0DD66|PYRDA_STRP3 Putative dihydroorotate dehydrogenase A (fumarate) OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=pyrD PE=3 SV=1 261 581 6.0E-18
sp|C0MCW6|PYRDA_STRS7 Putative dihydroorotate dehydrogenase A (fumarate) OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=pyrD PE=3 SV=1 261 581 1.0E-17
sp|C0M8R7|PYRDA_STRE4 Putative dihydroorotate dehydrogenase A (fumarate) OS=Streptococcus equi subsp. equi (strain 4047) GN=pyrD PE=3 SV=1 261 581 7.0E-17
sp|Q7Z892|PYRD1_LACK1 Dihydroorotate dehydrogenase (fumarate) OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=URA1 PE=1 SV=1 260 583 2.0E-15
sp|Q7Z893|PYRD_SACMI Dihydroorotate dehydrogenase (fumarate) OS=Saccharomyces mikatae GN=URA1 PE=3 SV=1 260 581 1.0E-14
sp|Q9CFC9|PYRDA_LACLA Dihydroorotate dehydrogenase A (fumarate) OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pyrDA PE=3 SV=1 260 581 5.0E-14
sp|A2RJT9|PYRDA_LACLM Dihydroorotate dehydrogenase A (fumarate) OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=pyrDA PE=1 SV=1 260 581 2.0E-13
sp|Q53ZE5|PYRDA_LACLC Dihydroorotate dehydrogenase A (fumarate) OS=Lactococcus lactis subsp. cremoris GN=pyrDA PE=3 SV=1 260 581 2.0E-13
sp|Q9X9S0|PYRDA_STRPN Probable dihydroorotate dehydrogenase A (fumarate) OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pyrDA PE=1 SV=2 382 585 2.0E-13
sp|Q57U83|PYRD_TRYB2 Dihydroorotate dehydrogenase (fumarate) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb927.5.3830 PE=1 SV=1 246 584 4.0E-13
sp|Q6V3X0|PYRD_NAUCC Dihydroorotate dehydrogenase (fumarate) OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=URA1 PE=3 SV=1 260 584 6.0E-13
sp|B9DUS7|PYRDA_STRU0 Putative dihydroorotate dehydrogenase A (fumarate) OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=pyrD PE=3 SV=1 261 580 1.0E-12
sp|Q8DQG9|PYRDA_STRR6 Probable dihydroorotate dehydrogenase A (fumarate) OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pyrDA PE=3 SV=1 382 585 1.0E-12
sp|P28272|PYRD_YEAST Dihydroorotate dehydrogenase (fumarate) OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA1 PE=1 SV=1 260 581 2.0E-12
sp|Q8E155|PYRDA_STRA5 Putative dihydroorotate dehydrogenase A (fumarate) OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=pyrD PE=3 SV=1 261 584 3.0E-12
sp|Q8E6L0|PYRDA_STRA3 Putative dihydroorotate dehydrogenase A (fumarate) OS=Streptococcus agalactiae serotype III (strain NEM316) GN=pyrD PE=3 SV=1 261 584 3.0E-12
sp|Q3K2G4|PYRDA_STRA1 Putative dihydroorotate dehydrogenase A (fumarate) OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=pyrD PE=3 SV=1 261 584 3.0E-12
sp|Q7Z891|PYRD_SACPA Dihydroorotate dehydrogenase (fumarate) OS=Saccharomyces paradoxus GN=URA1 PE=3 SV=1 260 581 4.0E-12
sp|Q4D3W2|PYRD_TRYCC Dihydroorotate dehydrogenase (fumarate) OS=Trypanosoma cruzi (strain CL Brener) GN=pyr4 PE=1 SV=1 246 580 1.0E-11
sp|Q8SU25|TRS31_ENCCU Putative trafficking protein particle complex subunit TRS31 OS=Encephalitozoon cuniculi (strain GB-M1) GN=TRS31 PE=1 SV=1 70 231 5.0E-11
sp|Q7Z894|PYRD_SACBA Dihydroorotate dehydrogenase (fumarate) OS=Saccharomyces bayanus GN=URA1 PE=3 SV=1 260 581 1.0E-10
sp|P59626|PYRDA_ENTFA Probable dihydroorotate dehydrogenase A (fumarate) OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=pyrDA PE=3 SV=1 386 585 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005737 cytoplasm Yes
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors Yes
GO:0016491 oxidoreductase activity No
GO:0003824 catalytic activity No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|008820
MAYSQPHPRLSLLSNSSQSSVDQFSPTSSSTRFSVPPTPSIHSTLGSAKPPSGPRPNIYDRNLNKTRTSEVSASA
FTFLFSEIVQYTQKRVGGINDLERRLNTLGYRIGSRVLELMAWRAESSSKAPKREIRLVPALMVIHTQVWKAVYG
KAADAIEKSVENADEYMIIDNDPPIERNISVPRDMGGLSCSSFTAGVVEAVLDGLGFPARVTAHGTPTTQHPCRT
TILIKLEKSAGNKVQRTSKTLGLMVHINSIHISPPLLNSSCAWSSDFAQLKALYDSPYTGAITTRTATLSGYKEN
DTHTFAFTKTSISSINSFGYSPHPFPQYLAWIEELLATATKYKPIIVSMTSDIDDAASFTTMLDQLQNLRKKLGD
QTDEGARIAVELNTSCPNIQNSTPPGYDIESLNPLLEVLCDAYAKDPTLTIGLKLPPLVHEQQFHSILDRIQSLT
SQITLDNHSVGSVISFLTCTNTLGNTLLFPDQITLSSSPSSNNHSTTFALPTVLGGLAGEALHPLALGNVYRFSN
LLKESNKRPSSPLSKIKIIGVGGITSKEARRRMEAAGAGVVACATLFGKEGITAFEILSSN*
Coding >Agabi119p4|008820
ATGGCCTACTCCCAACCACATCCCCGGCTCTCCCTCCTTTCCAATTCCTCCCAGTCCTCCGTCGACCAGTTCTCG
CCCACCTCTTCCTCCACCCGCTTCTCAGTCCCTCCGACGCCCTCTATCCACAGCACTCTCGGCAGCGCCAAACCC
CCTTCAGGACCTCGCCCGAACATCTATGACAGGAACTTGAACAAGACCCGAACAAGCGAGGTTTCTGCCTCTGCA
TTCACTTTCCTGTTCTCGGAAATTGTCCAATACACCCAAAAACGTGTCGGTGGCATCAATGACCTCGAAAGAAGG
CTCAACACCCTAGGATATCGCATTGGCTCCCGTGTCCTCGAGCTTATGGCCTGGCGAGCAGAATCGTCTTCCAAG
GCACCTAAGCGCGAGATCCGACTAGTCCCCGCCCTGATGGTAATACATACTCAAGTCTGGAAGGCTGTCTATGGG
AAAGCAGCAGATGCAATCGAGAAAAGCGTGGAGAATGCCGATGAATATATGATCATTGACAATGACCCACCCATT
GAAAGGAACATCTCTGTTCCTCGTGACATGGGAGGCTTAAGTTGTTCTTCCTTCACCGCCGGAGTTGTTGAAGCC
GTTCTTGACGGCCTTGGTTTCCCGGCACGAGTGACTGCACACGGCACACCAACAACCCAACACCCTTGCCGAACG
ACTATACTTATCAAGCTAGAAAAATCTGCTGGAAACAAAGTCCAACGCACCTCAAAGACCTTAGGCCTCATGGTT
CACATCAATTCCATTCACATTTCTCCTCCCCTCCTAAACTCTTCTTGTGCCTGGTCTTCTGACTTTGCCCAGCTC
AAGGCTTTATATGATTCGCCCTACACCGGCGCCATCACCACCCGCACGGCTACTCTAAGCGGATACAAAGAAAAT
GACACCCACACTTTCGCTTTTACAAAAACTTCCATTTCCTCGATTAACTCCTTCGGGTATTCCCCACACCCGTTT
CCCCAATACCTCGCTTGGATCGAAGAGCTCTTGGCAACAGCAACCAAGTATAAACCCATCATTGTCAGCATGACC
AGCGATATCGATGACGCTGCGTCCTTTACTACCATGCTTGACCAGCTACAGAACCTCCGGAAGAAACTGGGGGAT
CAAACGGATGAAGGTGCTCGGATCGCAGTAGAACTCAACACATCTTGCCCAAACATCCAAAATAGTACCCCGCCT
GGGTACGACATCGAGTCACTTAATCCGCTTCTCGAAGTCCTGTGTGATGCCTATGCCAAGGATCCCACCCTTACC
ATTGGCCTCAAACTCCCTCCCCTTGTTCATGAACAGCAATTCCATTCTATTCTTGATCGGATCCAGTCCCTGACT
TCCCAGATCACCCTTGACAATCACTCCGTGGGCTCAGTCATTTCATTTTTGACATGCACCAATACCCTCGGAAAT
ACCCTTCTATTCCCCGATCAAATCACATTGTCTTCATCCCCATCATCAAATAATCATTCCACGACTTTTGCGCTG
CCCACCGTATTGGGTGGCCTCGCGGGAGAGGCGTTGCATCCGCTAGCGTTGGGAAACGTGTATCGATTCTCAAAT
TTACTCAAAGAGTCGAACAAAAGGCCATCATCACCTCTATCTAAAATAAAAATCATTGGAGTCGGAGGTATCACT
TCCAAGGAAGCAAGGAGAAGAATGGAAGCGGCTGGTGCCGGCGTGGTTGCTTGCGCTACTTTATTCGGCAAAGAA
GGTATAACAGCATTTGAGATATTGAGCTCAAATTAG
Transcript >Agabi119p4|008820
ATGGCCTACTCCCAACCACATCCCCGGCTCTCCCTCCTTTCCAATTCCTCCCAGTCCTCCGTCGACCAGTTCTCG
CCCACCTCTTCCTCCACCCGCTTCTCAGTCCCTCCGACGCCCTCTATCCACAGCACTCTCGGCAGCGCCAAACCC
CCTTCAGGACCTCGCCCGAACATCTATGACAGGAACTTGAACAAGACCCGAACAAGCGAGGTTTCTGCCTCTGCA
TTCACTTTCCTGTTCTCGGAAATTGTCCAATACACCCAAAAACGTGTCGGTGGCATCAATGACCTCGAAAGAAGG
CTCAACACCCTAGGATATCGCATTGGCTCCCGTGTCCTCGAGCTTATGGCCTGGCGAGCAGAATCGTCTTCCAAG
GCACCTAAGCGCGAGATCCGACTAGTCCCCGCCCTGATGGTAATACATACTCAAGTCTGGAAGGCTGTCTATGGG
AAAGCAGCAGATGCAATCGAGAAAAGCGTGGAGAATGCCGATGAATATATGATCATTGACAATGACCCACCCATT
GAAAGGAACATCTCTGTTCCTCGTGACATGGGAGGCTTAAGTTGTTCTTCCTTCACCGCCGGAGTTGTTGAAGCC
GTTCTTGACGGCCTTGGTTTCCCGGCACGAGTGACTGCACACGGCACACCAACAACCCAACACCCTTGCCGAACG
ACTATACTTATCAAGCTAGAAAAATCTGCTGGAAACAAAGTCCAACGCACCTCAAAGACCTTAGGCCTCATGGTT
CACATCAATTCCATTCACATTTCTCCTCCCCTCCTAAACTCTTCTTGTGCCTGGTCTTCTGACTTTGCCCAGCTC
AAGGCTTTATATGATTCGCCCTACACCGGCGCCATCACCACCCGCACGGCTACTCTAAGCGGATACAAAGAAAAT
GACACCCACACTTTCGCTTTTACAAAAACTTCCATTTCCTCGATTAACTCCTTCGGGTATTCCCCACACCCGTTT
CCCCAATACCTCGCTTGGATCGAAGAGCTCTTGGCAACAGCAACCAAGTATAAACCCATCATTGTCAGCATGACC
AGCGATATCGATGACGCTGCGTCCTTTACTACCATGCTTGACCAGCTACAGAACCTCCGGAAGAAACTGGGGGAT
CAAACGGATGAAGGTGCTCGGATCGCAGTAGAACTCAACACATCTTGCCCAAACATCCAAAATAGTACCCCGCCT
GGGTACGACATCGAGTCACTTAATCCGCTTCTCGAAGTCCTGTGTGATGCCTATGCCAAGGATCCCACCCTTACC
ATTGGCCTCAAACTCCCTCCCCTTGTTCATGAACAGCAATTCCATTCTATTCTTGATCGGATCCAGTCCCTGACT
TCCCAGATCACCCTTGACAATCACTCCGTGGGCTCAGTCATTTCATTTTTGACATGCACCAATACCCTCGGAAAT
ACCCTTCTATTCCCCGATCAAATCACATTGTCTTCATCCCCATCATCAAATAATCATTCCACGACTTTTGCGCTG
CCCACCGTATTGGGTGGCCTCGCGGGAGAGGCGTTGCATCCGCTAGCGTTGGGAAACGTGTATCGATTCTCAAAT
TTACTCAAAGAGTCGAACAAAAGGCCATCATCACCTCTATCTAAAATAAAAATCATTGGAGTCGGAGGTATCACT
TCCAAGGAAGCAAGGAGAAGAATGGAAGCGGCTGGTGCCGGCGTGGTTGCTTGCGCTACTTTATTCGGCAAAGAA
GGTATAACAGCATTTGAGATATTGAGCTCAAATTAG
Gene >Agabi119p4|008820
ATGGCCTACTCCCAACCACATCCCCGGCTCTCCCTCCTTTCCAATTCCTCCCAGTCCTCCGTCGACCAGTTCTCG
CCCACCTCTTCCTCCACCCGCTTCTCAGTCCCTCCGACGCCCTCTATCCACAGCACTCTCGGCAGCGCCAAACCC
CCTTCAGGACCTCGCCCGAACATCTATGACAGGAACTTGAACAAGACCCGAACAAGCGAGGTTTCTGCCTCTGCA
TTCACTTTCCTGTTCTCGGAAATTGTCCAATACACCCAAAAACGTGTCGGTGGCATCAATGACCTCGAAAGAAGG
TATCTCATTCCCTTACCACTCTCACGCGTCCTCATGTCAATCTCAGGCTCAACACCCTAGGATATCGCATTGGCT
CCCGTGTCCTCGAGCTTATGGCCTGGCGAGCAGAATCGTCTTCCAAGGCACCTAAGCGCGAGATCCGACTAGTCC
CCGCCCTGATGGTAATACATACTCAAGTCTGGAAGGCTGTCTATGGGAAAGCAGCAGATGCAATCGAGAAAAGCG
TGGAGAATGCCGATGAATGTGAGGATGCTGATGACCCCAATTGTCTTGCCCCACACCTAACTCCGTCTATCACAG
ATATGATCATTGACAATGACCCACCCATTGAAAGGAACATCTCTGTTCCTCGTGACATGGGAGGCTTAAGTTGTT
CTTCCTTCACCGCCGGAGTTGTTGAAGCCGTTCTTGACGGCCTTGGTTTCGTATGTTGGTCCTTCTACTAGTAGT
GTTGAGACGCTTACGCTTCCATCAGCCGGCACGAGTGACTGCACACGGCACACCAACAACCCAACACCCTTGCCG
AACGACTATACTTATCAAGCTAGAAAAATCTGTATTAGAACGAGAAGAGATGCTAAAATAATGATGACATTGTAC
TGTTCGGGGTCCTTGACATGCACCTGAAAGGCTGGAAACAAAGTCCAACGCACCTCAAAGACCTTAGGCCTCATG
GTTCACATCAATTCCATTCACATTTCTCCTCCCCTCCTAAACTCTTCTTGTGCCTGGTCTTCTGACTTTGCCCAG
CTCAAGGCTTTATATGATTCGCCCTACACCGGCGCCATCACCACCCGCACGGCTACTCTAAGCGGATACAAAGAA
AATGACACCCACACTGTTCGTCGTCCTGCCGATTACTTTCCTTGTACTTAATCCAATTCAGTTCGCTTTTACAAA
AACTTCCATTTCCTCGATTAACTCCTTCGGGTATTCCCCACACCCGTTTCCCCAATACCTCGCTTGGATCGAAGA
GCTCTTGGCAACAGCAACCAAGTATAAACCCATCATTGTCAGCATGACCAGCGATATCGATGACGCTGCGTCCTT
TACTACCATGCTTGACCAGCTACAGAACCTCCGGAAGAAACTGGGGGATCAAACGGATGAAGGTGCTCGGATCGC
AGTAGAACTCAACACATCTTGCCCAAACATCCAAAATAGTACCCCGCCTGGGTACGACATCGAGTCACTTAATCC
GCTTCTCGAAGTCCTGTGTGATGCCTATGCCAAGGATCCCACCCTTACCATTGGCCTCAAACTCCCTCCCCTTGT
TCATGAACAGCAATTCCATTCTATTCTTGATCGGATCCAGTCCCTGACTTCCCAGATCACCCTTGACAATCACTC
CGTGGGCTCAGTCATTTCATTTTTGACATGCACCAATACCCTCGGAAATACCCTTCTATTCCCCGATCAAATCAC
ATTGTCTTCATCCCCATCATCAAATAATCATTCCACGACTTTTGCGCTGCCCACCGTATTGGGTGGCCTCGCGGG
AGAGGCGTTGCATCCGCTAGCGTTGGGAAACGTGTATCGATTCTCAAATTTACTCAAAGAGTCGAACAAAAGGCC
ATCATCACCTCTATCTAAAATAAAAATCATTGGAGTCGGAGGTATCACTTCCAAGGAAGCAAGGAGAAGAATGGA
AGCGGCTGGTGCCGGCGTGGTTGCTTGCGCTACTTTATTCGGCAAAGAAGGTATAACAGCATTTGAGATATTGAG
CTCAAATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail