Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|008740
Gene name
Locationscaffold_01a:2040350..2043320
Strand+
Gene length (bp)2970
Transcript length (bp)2490
Coding sequence length (bp)2490
Protein length (aa) 830

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08712 Nfu_N Scaffold protein Nfu/NifU N terminal 1.7E-28 113 199
PF01106 NifU NifU-like domain 1.1E-27 230 297
PF00649 Copper-fist Copper fist DNA binding domain 1.9E-20 371 409

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUB8|YH9J_SCHPO NifU-like protein C1709.19c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1709.19c PE=3 SV=1 82 318 1.0E-69
sp|B4M375|NFU1_DROVI NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Drosophila virilis GN=GJ19011 PE=3 SV=1 35 323 2.0E-69
sp|Q9C8J2|NIFU5_ARATH NifU-like protein 5, mitochondrial OS=Arabidopsis thaliana GN=NIFU5 PE=2 SV=1 109 305 1.0E-67
sp|Q9LIG6|NIFU4_ARATH NifU-like protein 4, mitochondrial OS=Arabidopsis thaliana GN=NIFU4 PE=2 SV=1 109 305 1.0E-67
sp|B4PZ52|NFU1_DROYA NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Drosophila yakuba GN=GE15286 PE=3 SV=1 95 319 1.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUB8|YH9J_SCHPO NifU-like protein C1709.19c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1709.19c PE=3 SV=1 82 318 1.0E-69
sp|B4M375|NFU1_DROVI NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Drosophila virilis GN=GJ19011 PE=3 SV=1 35 323 2.0E-69
sp|Q9C8J2|NIFU5_ARATH NifU-like protein 5, mitochondrial OS=Arabidopsis thaliana GN=NIFU5 PE=2 SV=1 109 305 1.0E-67
sp|Q9LIG6|NIFU4_ARATH NifU-like protein 4, mitochondrial OS=Arabidopsis thaliana GN=NIFU4 PE=2 SV=1 109 305 1.0E-67
sp|B4PZ52|NFU1_DROYA NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Drosophila yakuba GN=GE15286 PE=3 SV=1 95 319 1.0E-66
sp|B4JWR9|NFU1_DROGR NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Drosophila grimshawi GN=GH17809 PE=3 SV=1 109 324 2.0E-66
sp|B4NE93|NFU1_DROWI NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Drosophila willistoni GN=GK25604 PE=3 SV=1 109 323 4.0E-66
sp|B3NYF7|NFU1_DROER NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Drosophila erecta GN=GG17526 PE=3 SV=1 43 319 6.0E-66
sp|B4H303|NFU1_DROPE NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Drosophila persimilis GN=GL13432 PE=3 SV=1 109 322 2.0E-65
sp|B5DKJ8|NFU1_DROPS NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Drosophila pseudoobscura pseudoobscura GN=GA22888 PE=3 SV=1 109 322 5.0E-65
sp|B4IMF6|NFU1_DROSE NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Drosophila sechellia GN=GM13534 PE=3 SV=1 97 319 2.0E-64
sp|B4R3T1|NFU1_DROSI NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Drosophila simulans GN=GD15490 PE=3 SV=1 96 319 3.0E-64
sp|Q8SY96|NFU1_DROME NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Drosophila melanogaster GN=CG32500 PE=2 SV=1 100 319 4.0E-64
sp|B3MRT7|NFU1_DROAN NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Drosophila ananassae GN=GF20932 PE=3 SV=1 109 323 3.0E-63
sp|Q9QZ23|NFU1_MOUSE NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Mus musculus GN=Nfu1 PE=1 SV=2 93 304 2.0E-58
sp|Q9UMS0|NFU1_HUMAN NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Homo sapiens GN=NFU1 PE=1 SV=2 108 305 1.0E-57
sp|P32860|NFU1_YEAST NifU-like protein, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NFU1 PE=1 SV=2 109 319 1.0E-45
sp|Q09728|CUF1_SCHPO Metal-binding regulatory protein cuf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cuf1 PE=1 SV=1 370 433 5.0E-17
sp|P45815|CRF1_YARLI Copper resistance protein CRF1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CRF1 PE=3 SV=1 370 431 7.0E-16
sp|Q12753|HAA1_YEAST Transcriptional activator HAA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAA1 PE=1 SV=1 370 431 1.0E-13
sp|Q93W20|NIFU2_ARATH NifU-like protein 2, chloroplastic OS=Arabidopsis thaliana GN=NIFU2 PE=1 SV=1 193 320 7.0E-13
sp|P15315|CUP2_YEAST Transcriptional activator protein CUP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CUP2 PE=1 SV=1 370 437 1.0E-12
sp|P41772|AMT1_CANGA Metal-activated transcriptional activator protein AMT1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=AMT1 PE=1 SV=1 370 431 4.0E-12
sp|O94588|CUF2_SCHPO Copper-binding regulatory protein cuf2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cuf2 PE=2 SV=1 370 434 7.0E-12
sp|Q84LK7|NIFU1_ORYSJ NifU-like protein 1, chloroplastic OS=Oryza sativa subsp. japonica GN=NIFU1 PE=1 SV=1 226 310 2.0E-10
sp|O32119|YUTI_BACSU Putative nitrogen fixation protein YutI OS=Bacillus subtilis (strain 168) GN=yutI PE=3 SV=1 222 286 3.0E-10
sp|Q056Z1|NFUA_BUCCC Fe/S biogenesis protein NfuA OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=nfuA PE=3 SV=1 230 299 5.0E-10
sp|C5BJC0|NFUA_TERTT Fe/S biogenesis protein NfuA OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=nfuA PE=3 SV=1 230 305 1.0E-09
sp|Q9I2P8|NFUA_PSEAE Fe/S biogenesis protein NfuA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nfuA PE=3 SV=1 219 305 1.0E-09
sp|Q02KZ2|NFUA_PSEAB Fe/S biogenesis protein NfuA OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=nfuA PE=3 SV=1 219 305 1.0E-09
sp|B7VB28|NFUA_PSEA8 Fe/S biogenesis protein NfuA OS=Pseudomonas aeruginosa (strain LESB58) GN=nfuA PE=3 SV=1 219 305 1.0E-09
sp|A6V6X0|NFUA_PSEA7 Fe/S biogenesis protein NfuA OS=Pseudomonas aeruginosa (strain PA7) GN=nfuA PE=3 SV=1 219 305 1.0E-09
sp|P33179|NIFU_ANASL Nitrogen fixation protein NifU (Fragment) OS=Anabaena sp. (strain L31) GN=nifU PE=3 SV=1 222 290 3.0E-09
sp|Q84RQ7|NIFU3_ARATH NifU-like protein 3, chloroplastic OS=Arabidopsis thaliana GN=NIFU3 PE=2 SV=1 238 324 3.0E-09
sp|Q00241|NIFU_LEPBY Nitrogen fixation protein NifU (Fragment) OS=Leptolyngbya boryana GN=nifU PE=3 SV=1 222 299 4.0E-09
sp|P20628|NIFU_NOSS1 Nitrogen fixation protein NifU OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=nifU PE=3 SV=1 222 290 7.0E-09
sp|Q43885|NIFU_TRIAZ Nitrogen fixation protein NifU OS=Trichormus azollae GN=nifU PE=3 SV=1 222 290 7.0E-09
sp|C1DLW0|NFUA_AZOVD Fe/S biogenesis protein NfuA OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=nfuA PE=3 SV=1 219 304 7.0E-09
sp|A4WFK2|NFUA_ENT38 Fe/S biogenesis protein NfuA OS=Enterobacter sp. (strain 638) GN=nfuA PE=3 SV=1 217 303 1.0E-08
sp|A6TF37|NFUA_KLEP7 Fe/S biogenesis protein NfuA OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=nfuA PE=3 SV=1 217 303 2.0E-08
sp|B5XTS2|NFUA_KLEP3 Fe/S biogenesis protein NfuA OS=Klebsiella pneumoniae (strain 342) GN=nfuA PE=3 SV=1 217 303 2.0E-08
sp|Q3YWL1|NFUA_SHISS Fe/S biogenesis protein NfuA OS=Shigella sonnei (strain Ss046) GN=nfuA PE=3 SV=1 218 303 2.0E-08
sp|P63023|NFUA_SHIFL Fe/S biogenesis protein NfuA OS=Shigella flexneri GN=nfuA PE=3 SV=1 218 303 2.0E-08
sp|Q0SZQ1|NFUA_SHIF8 Fe/S biogenesis protein NfuA OS=Shigella flexneri serotype 5b (strain 8401) GN=nfuA PE=3 SV=1 218 303 2.0E-08
sp|Q32AM7|NFUA_SHIDS Fe/S biogenesis protein NfuA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=nfuA PE=3 SV=1 218 303 2.0E-08
sp|Q31VL8|NFUA_SHIBS Fe/S biogenesis protein NfuA OS=Shigella boydii serotype 4 (strain Sb227) GN=nfuA PE=3 SV=1 218 303 2.0E-08
sp|B2U3M4|NFUA_SHIB3 Fe/S biogenesis protein NfuA OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=nfuA PE=3 SV=1 218 303 2.0E-08
sp|B7LSB7|NFUA_ESCF3 Fe/S biogenesis protein NfuA OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=nfuA PE=3 SV=1 218 303 2.0E-08
sp|Q1R5M0|NFUA_ECOUT Fe/S biogenesis protein NfuA OS=Escherichia coli (strain UTI89 / UPEC) GN=nfuA PE=3 SV=1 218 303 2.0E-08
sp|B1LHL4|NFUA_ECOSM Fe/S biogenesis protein NfuA OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=nfuA PE=3 SV=1 218 303 2.0E-08
sp|B6I2X8|NFUA_ECOSE Fe/S biogenesis protein NfuA OS=Escherichia coli (strain SE11) GN=nfuA PE=3 SV=1 218 303 2.0E-08
sp|B7NE19|NFUA_ECOLU Fe/S biogenesis protein NfuA OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=nfuA PE=3 SV=1 218 303 2.0E-08
sp|P63020|NFUA_ECOLI Fe/S biogenesis protein NfuA OS=Escherichia coli (strain K12) GN=nfuA PE=1 SV=1 218 303 2.0E-08
sp|B1IP51|NFUA_ECOLC Fe/S biogenesis protein NfuA OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=nfuA PE=3 SV=1 218 303 2.0E-08
sp|P63021|NFUA_ECOL6 Fe/S biogenesis protein NfuA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nfuA PE=3 SV=1 218 303 2.0E-08
sp|Q0TC53|NFUA_ECOL5 Fe/S biogenesis protein NfuA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=nfuA PE=3 SV=1 218 303 2.0E-08
sp|A1AGT8|NFUA_ECOK1 Fe/S biogenesis protein NfuA OS=Escherichia coli O1:K1 / APEC GN=nfuA PE=3 SV=1 218 303 2.0E-08
sp|A8A5M2|NFUA_ECOHS Fe/S biogenesis protein NfuA OS=Escherichia coli O9:H4 (strain HS) GN=nfuA PE=3 SV=1 218 303 2.0E-08
sp|B1X760|NFUA_ECODH Fe/S biogenesis protein NfuA OS=Escherichia coli (strain K12 / DH10B) GN=nfuA PE=3 SV=1 218 303 2.0E-08
sp|C4ZVW3|NFUA_ECOBW Fe/S biogenesis protein NfuA OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=nfuA PE=3 SV=1 218 303 2.0E-08
sp|B7M1X0|NFUA_ECO8A Fe/S biogenesis protein NfuA OS=Escherichia coli O8 (strain IAI1) GN=nfuA PE=3 SV=1 218 303 2.0E-08
sp|B7N147|NFUA_ECO81 Fe/S biogenesis protein NfuA OS=Escherichia coli O81 (strain ED1a) GN=nfuA PE=3 SV=1 218 303 2.0E-08
sp|B5YTW5|NFUA_ECO5E Fe/S biogenesis protein NfuA OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=nfuA PE=3 SV=1 218 303 2.0E-08
sp|P63022|NFUA_ECO57 Fe/S biogenesis protein NfuA OS=Escherichia coli O157:H7 GN=nfuA PE=3 SV=1 218 303 2.0E-08
sp|B7L4U4|NFUA_ECO55 Fe/S biogenesis protein NfuA OS=Escherichia coli (strain 55989 / EAEC) GN=nfuA PE=3 SV=1 218 303 2.0E-08
sp|B7MDP0|NFUA_ECO45 Fe/S biogenesis protein NfuA OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=nfuA PE=3 SV=1 218 303 2.0E-08
sp|B7UKB9|NFUA_ECO27 Fe/S biogenesis protein NfuA OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=nfuA PE=3 SV=1 218 303 2.0E-08
sp|A7ZSU3|NFUA_ECO24 Fe/S biogenesis protein NfuA OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=nfuA PE=3 SV=1 218 303 2.0E-08
sp|Q93W77|NIFU1_ARATH NifU-like protein 1, chloroplastic OS=Arabidopsis thaliana GN=NIFU1 PE=1 SV=1 232 303 2.0E-08
sp|Q5QZC8|NFUA_IDILO Fe/S biogenesis protein NfuA OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=nfuA PE=3 SV=1 223 303 4.0E-08
sp|Q7N9W2|NFUA_PHOLL Fe/S biogenesis protein NfuA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=nfuA PE=3 SV=1 217 303 5.0E-08
sp|B7NMH9|NFUA_ECO7I Fe/S biogenesis protein NfuA OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=nfuA PE=3 SV=1 218 303 1.0E-07
sp|B8CUY8|NFUA_SHEPW Fe/S biogenesis protein NfuA OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=nfuA PE=3 SV=1 217 303 2.0E-07
sp|A3Q930|NFUA_SHELP Fe/S biogenesis protein NfuA OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=nfuA PE=3 SV=1 217 303 2.0E-07
sp|Q3BSV3|NFUA_XANC5 Fe/S biogenesis protein NfuA OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=nfuA PE=3 SV=1 224 302 2.0E-07
sp|Q9CKP9|NFUA_PASMU Fe/S biogenesis protein NfuA OS=Pasteurella multocida (strain Pm70) GN=nfuA PE=3 SV=1 163 303 2.0E-07
sp|A8AQW7|NFUA_CITK8 Fe/S biogenesis protein NfuA OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=nfuA PE=3 SV=1 218 303 2.0E-07
sp|B2VJW0|NFUA_ERWT9 Fe/S biogenesis protein NfuA OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=nfuA PE=3 SV=1 217 303 2.0E-07
sp|B2STN5|NFUA_XANOP Fe/S biogenesis protein NfuA OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=nfuA PE=3 SV=1 224 302 2.0E-07
sp|Q2P1A3|NFUA_XANOM Fe/S biogenesis protein NfuA OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=nfuA PE=3 SV=1 224 302 3.0E-07
sp|B2FM87|NFUA_STRMK Fe/S biogenesis protein NfuA OS=Stenotrophomonas maltophilia (strain K279a) GN=nfuA PE=3 SV=1 211 303 3.0E-07
sp|A7ME80|NFUA_CROS8 Fe/S biogenesis protein NfuA OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=nfuA PE=3 SV=1 218 303 3.0E-07
sp|A8GKT7|NFUA_SERP5 Fe/S biogenesis protein NfuA OS=Serratia proteamaculans (strain 568) GN=nfuA PE=3 SV=1 217 303 3.0E-07
sp|A9MMB3|NFUA_SALAR Fe/S biogenesis protein NfuA OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=nfuA PE=3 SV=1 218 303 3.0E-07
sp|C4LA10|NFUA_TOLAT Fe/S biogenesis protein NfuA OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=nfuA PE=3 SV=1 217 291 4.0E-07
sp|Q6CZL7|NFUA_PECAS Fe/S biogenesis protein NfuA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=nfuA PE=3 SV=1 217 303 4.0E-07
sp|C4K405|NFUA_HAMD5 Fe/S biogenesis protein NfuA OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=nfuA PE=3 SV=1 223 303 4.0E-07
sp|C6DH68|NFUA_PECCP Fe/S biogenesis protein NfuA OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=nfuA PE=3 SV=1 217 303 4.0E-07
sp|B4SPV3|NFUA_STRM5 Fe/S biogenesis protein NfuA OS=Stenotrophomonas maltophilia (strain R551-3) GN=nfuA PE=3 SV=1 227 303 4.0E-07
sp|A5UGU4|NFUA_HAEIG Fe/S biogenesis protein NfuA OS=Haemophilus influenzae (strain PittGG) GN=nfuA PE=3 SV=1 163 303 5.0E-07
sp|A5UA56|NFUA_HAEIE Fe/S biogenesis protein NfuA OS=Haemophilus influenzae (strain PittEE) GN=nfuA PE=3 SV=1 163 303 5.0E-07
sp|Q4QNB2|NFUA_HAEI8 Fe/S biogenesis protein NfuA OS=Haemophilus influenzae (strain 86-028NP) GN=nfuA PE=3 SV=1 163 303 5.0E-07
sp|P31774|NFUA_HAEIN Fe/S biogenesis protein NfuA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=nfuA PE=1 SV=2 163 303 5.0E-07
sp|A8H9T3|NFUA_SHEPA Fe/S biogenesis protein NfuA OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=nfuA PE=3 SV=1 217 303 5.0E-07
sp|B4EZM8|NFUA_PROMH Fe/S biogenesis protein NfuA OS=Proteus mirabilis (strain HI4320) GN=nfuA PE=3 SV=1 223 303 6.0E-07
sp|Q12IC3|NFUA_SHEDO Fe/S biogenesis protein NfuA OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=nfuA PE=3 SV=1 217 303 6.0E-07
sp|Q8PKQ2|NFUA_XANAC Fe/S biogenesis protein NfuA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=nfuA PE=3 SV=1 224 302 6.0E-07
sp|A1JSF6|NFUA_YERE8 Fe/S biogenesis protein NfuA OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=nfuA PE=3 SV=1 217 303 7.0E-07
sp|Q8Z223|NFUA_SALTI Fe/S biogenesis protein NfuA OS=Salmonella typhi GN=nfuA PE=3 SV=1 218 303 7.0E-07
sp|Q089F8|NFUA_SHEFN Fe/S biogenesis protein NfuA OS=Shewanella frigidimarina (strain NCIMB 400) GN=nfuA PE=3 SV=1 217 303 7.0E-07
sp|A1RE77|NFUA_SHESW Fe/S biogenesis protein NfuA OS=Shewanella sp. (strain W3-18-1) GN=nfuA PE=3 SV=1 217 303 7.0E-07
sp|A4YC18|NFUA_SHEPC Fe/S biogenesis protein NfuA OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=nfuA PE=3 SV=1 217 303 7.0E-07
sp|Q8ZLI7|NFUA_SALTY Fe/S biogenesis protein NfuA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nfuA PE=3 SV=1 218 303 7.0E-07
sp|B4TY71|NFUA_SALSV Fe/S biogenesis protein NfuA OS=Salmonella schwarzengrund (strain CVM19633) GN=nfuA PE=3 SV=1 218 303 7.0E-07
sp|B5BHG9|NFUA_SALPK Fe/S biogenesis protein NfuA OS=Salmonella paratyphi A (strain AKU_12601) GN=nfuA PE=3 SV=1 218 303 7.0E-07
sp|C0Q0I7|NFUA_SALPC Fe/S biogenesis protein NfuA OS=Salmonella paratyphi C (strain RKS4594) GN=nfuA PE=3 SV=1 218 303 7.0E-07
sp|A9MTT1|NFUA_SALPB Fe/S biogenesis protein NfuA OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=nfuA PE=3 SV=1 218 303 7.0E-07
sp|Q5PLY6|NFUA_SALPA Fe/S biogenesis protein NfuA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=nfuA PE=3 SV=1 218 303 7.0E-07
sp|B4SVL5|NFUA_SALNS Fe/S biogenesis protein NfuA OS=Salmonella newport (strain SL254) GN=nfuA PE=3 SV=1 218 303 7.0E-07
sp|B4TKT8|NFUA_SALHS Fe/S biogenesis protein NfuA OS=Salmonella heidelberg (strain SL476) GN=nfuA PE=3 SV=1 218 303 7.0E-07
sp|B5R7K3|NFUA_SALG2 Fe/S biogenesis protein NfuA OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=nfuA PE=3 SV=1 218 303 7.0E-07
sp|B5R371|NFUA_SALEP Fe/S biogenesis protein NfuA OS=Salmonella enteritidis PT4 (strain P125109) GN=nfuA PE=3 SV=1 218 303 7.0E-07
sp|B5FKD2|NFUA_SALDC Fe/S biogenesis protein NfuA OS=Salmonella dublin (strain CT_02021853) GN=nfuA PE=3 SV=1 218 303 7.0E-07
sp|Q57IW3|NFUA_SALCH Fe/S biogenesis protein NfuA OS=Salmonella choleraesuis (strain SC-B67) GN=nfuA PE=3 SV=1 218 303 7.0E-07
sp|B5F8M8|NFUA_SALA4 Fe/S biogenesis protein NfuA OS=Salmonella agona (strain SL483) GN=nfuA PE=3 SV=1 218 303 7.0E-07
sp|Q6LVQ9|NFUA_PHOPR Fe/S biogenesis protein NfuA OS=Photobacterium profundum GN=nfuA PE=3 SV=1 223 302 7.0E-07
sp|A9KUY3|NFUA_SHEB9 Fe/S biogenesis protein NfuA OS=Shewanella baltica (strain OS195) GN=nfuA PE=3 SV=1 217 303 8.0E-07
sp|A6WU19|NFUA_SHEB8 Fe/S biogenesis protein NfuA OS=Shewanella baltica (strain OS185) GN=nfuA PE=3 SV=1 217 303 8.0E-07
sp|A3CYW3|NFUA_SHEB5 Fe/S biogenesis protein NfuA OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=nfuA PE=3 SV=1 217 303 8.0E-07
sp|B8ECN4|NFUA_SHEB2 Fe/S biogenesis protein NfuA OS=Shewanella baltica (strain OS223) GN=nfuA PE=3 SV=1 217 303 8.0E-07
sp|B1JHZ3|NFUA_YERPY Fe/S biogenesis protein NfuA OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=nfuA PE=3 SV=1 217 303 8.0E-07
sp|Q664J6|NFUA_YERPS Fe/S biogenesis protein NfuA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=nfuA PE=3 SV=1 217 303 8.0E-07
sp|A4TGR7|NFUA_YERPP Fe/S biogenesis protein NfuA OS=Yersinia pestis (strain Pestoides F) GN=nfuA PE=3 SV=1 217 303 8.0E-07
sp|Q1CCL5|NFUA_YERPN Fe/S biogenesis protein NfuA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=nfuA PE=3 SV=1 217 303 8.0E-07
sp|A9R4D2|NFUA_YERPG Fe/S biogenesis protein NfuA OS=Yersinia pestis bv. Antiqua (strain Angola) GN=nfuA PE=3 SV=1 217 303 8.0E-07
sp|Q8ZJI0|NFUA_YERPE Fe/S biogenesis protein NfuA OS=Yersinia pestis GN=nfuA PE=3 SV=1 217 303 8.0E-07
sp|B2K5V9|NFUA_YERPB Fe/S biogenesis protein NfuA OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=nfuA PE=3 SV=1 217 303 8.0E-07
sp|Q1C2L8|NFUA_YERPA Fe/S biogenesis protein NfuA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=nfuA PE=3 SV=1 217 303 8.0E-07
sp|A7FNW0|NFUA_YERP3 Fe/S biogenesis protein NfuA OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=nfuA PE=3 SV=1 217 303 8.0E-07
sp|A5CX22|NFUA_VESOH Fe/S biogenesis protein NfuA OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=nfuA PE=3 SV=1 191 304 9.0E-07
sp|Q5AFK0|MAC1_CANAL Metal-binding activator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MAC1 PE=2 SV=1 370 408 9.0E-07
sp|Q0HPU8|NFUA_SHESR Fe/S biogenesis protein NfuA OS=Shewanella sp. (strain MR-7) GN=nfuA PE=3 SV=1 217 303 1.0E-06
sp|C5BGT5|NFUA_EDWI9 Fe/S biogenesis protein NfuA OS=Edwardsiella ictaluri (strain 93-146) GN=nfuA PE=3 SV=1 218 303 1.0E-06
sp|B0RTH4|NFUA_XANCB Fe/S biogenesis protein NfuA OS=Xanthomonas campestris pv. campestris (strain B100) GN=nfuA PE=3 SV=1 224 302 1.0E-06
sp|A1AW72|NFUA_RUTMC Fe/S biogenesis protein NfuA OS=Ruthia magnifica subsp. Calyptogena magnifica GN=nfuA PE=3 SV=1 230 304 1.0E-06
sp|B1KM47|NFUA_SHEWM Fe/S biogenesis protein NfuA OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=nfuA PE=3 SV=1 217 303 1.0E-06
sp|Q8P8Z9|NFUA_XANCP Fe/S biogenesis protein NfuA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=nfuA PE=3 SV=1 224 302 1.0E-06
sp|Q4UUW4|NFUA_XANC8 Fe/S biogenesis protein NfuA OS=Xanthomonas campestris pv. campestris (strain 8004) GN=nfuA PE=3 SV=1 224 302 1.0E-06
sp|B4S1U9|NFUA_ALTMD Fe/S biogenesis protein NfuA OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=nfuA1 PE=3 SV=1 131 303 1.0E-06
sp|Q8E8P2|NFUA_SHEON Fe/S biogenesis protein NfuA OS=Shewanella oneidensis (strain MR-1) GN=nfuA PE=3 SV=1 223 303 1.0E-06
sp|Q4KAH1|NFUA_PSEF5 Fe/S biogenesis protein NfuA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=nfuA PE=3 SV=1 219 302 2.0E-06
sp|A5F4R9|NFUA_VIBC3 Fe/S biogenesis protein NfuA OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=nfuA PE=3 SV=1 217 298 2.0E-06
sp|C3LSE7|NFUA_VIBCM Fe/S biogenesis protein NfuA OS=Vibrio cholerae serotype O1 (strain M66-2) GN=nfuA PE=3 SV=1 217 298 2.0E-06
sp|Q9KNL2|NFUA_VIBCH Fe/S biogenesis protein NfuA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=nfuA PE=3 SV=1 217 298 2.0E-06
sp|B0TNS0|NFUA_SHEHH Fe/S biogenesis protein NfuA OS=Shewanella halifaxensis (strain HAW-EB4) GN=nfuA PE=3 SV=1 217 303 2.0E-06
sp|P35192|MAC1_YEAST Metal-binding activator 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAC1 PE=1 SV=2 370 408 2.0E-06
sp|Q0HDK0|NFUA_SHESM Fe/S biogenesis protein NfuA OS=Shewanella sp. (strain MR-4) GN=nfuA PE=3 SV=1 217 303 2.0E-06
sp|A0L2F1|NFUA_SHESA Fe/S biogenesis protein NfuA OS=Shewanella sp. (strain ANA-3) GN=nfuA PE=3 SV=1 217 303 2.0E-06
sp|Q3KBL2|NFUA_PSEPF Fe/S biogenesis protein NfuA OS=Pseudomonas fluorescens (strain Pf0-1) GN=nfuA PE=3 SV=1 219 302 2.0E-06
sp|A7MST1|NFUA_VIBCB Fe/S biogenesis protein NfuA OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=nfuA PE=3 SV=1 217 303 2.0E-06
sp|Q65QC1|NFUA_MANSM Fe/S biogenesis protein NfuA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=nfuA PE=3 SV=1 163 303 2.0E-06
sp|B0U5V3|NFUA_XYLFM Fe/S biogenesis protein NfuA OS=Xylella fastidiosa (strain M12) GN=nfuA PE=3 SV=1 210 302 3.0E-06
sp|Q3IJQ5|NFUA_PSEHT Fe/S biogenesis protein NfuA OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=nfuA PE=3 SV=1 223 303 3.0E-06
sp|A1SBE8|NFUA_SHEAM Fe/S biogenesis protein NfuA OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=nfuA PE=3 SV=1 217 303 3.0E-06
sp|Q2NQH5|NFUA_SODGM Fe/S biogenesis protein NfuA OS=Sodalis glossinidius (strain morsitans) GN=nfuA PE=3 SV=1 217 303 3.0E-06
sp|Q87A52|NFUA_XYLFT Fe/S biogenesis protein NfuA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=nfuA PE=3 SV=1 210 302 4.0E-06
sp|B2I9W5|NFUA_XYLF2 Fe/S biogenesis protein NfuA OS=Xylella fastidiosa (strain M23) GN=nfuA PE=3 SV=1 210 302 4.0E-06
sp|Q9PAB5|NFUA_XYLFA Fe/S biogenesis protein NfuA OS=Xylella fastidiosa (strain 9a5c) GN=nfuA PE=3 SV=2 210 302 4.0E-06
sp|Q7VNV0|NFUA_HAEDU Fe/S biogenesis protein NfuA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=nfuA PE=3 SV=1 218 303 4.0E-06
sp|C3K9S0|NFUA_PSEFS Fe/S biogenesis protein NfuA OS=Pseudomonas fluorescens (strain SBW25) GN=nfuA PE=3 SV=1 220 302 6.0E-06
sp|Q87TC4|NFUA_VIBPA Fe/S biogenesis protein NfuA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=nfuA PE=3 SV=1 217 303 7.0E-06
sp|Q1LSZ3|NFUA_BAUCH Fe/S biogenesis protein NfuA OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=nfuA PE=3 SV=1 213 299 7.0E-06
sp|Q6FDB8|NFUA_ACIAD Fe/S biogenesis protein NfuA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=nfuA PE=3 SV=1 199 309 8.0E-06
sp|Q88KB2|NFUA_PSEPK Fe/S biogenesis protein NfuA OS=Pseudomonas putida (strain KT2440) GN=nfuA PE=3 SV=1 219 305 8.0E-06
sp|A5W5N3|NFUA_PSEP1 Fe/S biogenesis protein NfuA OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=nfuA PE=3 SV=1 219 305 8.0E-06
sp|B0KKI2|NFUA_PSEPG Fe/S biogenesis protein NfuA OS=Pseudomonas putida (strain GB-1) GN=nfuA PE=3 SV=1 219 302 9.0E-06
sp|B1J6F5|NFUA_PSEPW Fe/S biogenesis protein NfuA OS=Pseudomonas putida (strain W619) GN=nfuA PE=3 SV=1 219 302 9.0E-06
sp|Q8D2Q3|NFUA_WIGBR Fe/S biogenesis protein NfuA OS=Wigglesworthia glossinidia brevipalpis GN=nfuA PE=3 SV=2 217 302 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005507 copper ion binding Yes
GO:0003700 DNA-binding transcription factor activity Yes
GO:0051536 iron-sulfur cluster binding Yes
GO:0016226 iron-sulfur cluster assembly Yes
GO:0005506 iron ion binding Yes
GO:0003677 DNA binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0022607 cellular component assembly No
GO:0043169 cation binding No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0031163 metallo-sulfur cluster assembly No
GO:0065007 biological regulation No
GO:0071840 cellular component organization or biogenesis No
GO:0009889 regulation of biosynthetic process No
GO:0005488 binding No
GO:0031323 regulation of cellular metabolic process No
GO:0019222 regulation of metabolic process No
GO:0140110 transcription regulator activity No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0008152 metabolic process No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0080090 regulation of primary metabolic process No
GO:0010468 regulation of gene expression No
GO:0016043 cellular component organization No
GO:0008150 biological_process No
GO:0051540 metal cluster binding No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0046914 transition metal ion binding No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0050789 regulation of biological process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0043167 ion binding No
GO:0044237 cellular metabolic process No
GO:0050794 regulation of cellular process No
GO:0006790 sulfur compound metabolic process No
GO:0009987 cellular process No
GO:0051252 regulation of RNA metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|008740
MARREEGKEWERKEEEEAEEDIHWSEREAASLSSSRILRVAAMSAFLHRIVASNPLRSHARNAVFRAARPFSASC
TCLAPPRSSLASATSIPRWRQRNSLAVRTPAHVRSMFIQTETTPNEDSLKFIPGTTVMGDGTAEFLDTRSALASP
LAIRLFGVEGVNGVFYGPDFVTVSKDSENTWAVVKPEIYAILMEHFSSGQALFRSEEDREAAGPQDLKILDTDSD
TVAMIKELLETRVRPAIMEDGGDIEFRGFDEDGVVKLKLKGSCRGCSSSTVTLKSGIERMLTHYIPEVKSVQEVL
DQEDEIALEEFQKLEQKLEHKDSGMARYIIFDIVIQLRPIGSHPVKGLEGWEDRATCLISTPSAACLLSMVYVNS
KKFACESCIKGHRSSSCHHSDRPLFEIKKKGRPVSQCERCRELRQSKRVHSKCTCGPRPDPASRGEVLASTTSKS
RRYIPIIPALPNGLRDVLAASHIRTSLPADSRQRVDTLLNPCSCKSVWRCDCRRSQLHDDSDPVDSVTPAHQAPT
HVHASRIALMPPPHPTAKTAPSNGVPSPSGSTKPHVSQSFNVRQIYNKQTNHHHNIDPPSCCSPSPILELPPIQS
SPESSSSPTVNAIPDFGFMPPMSTIASLAGSGCTCGVQCTCPGCVEHRGPEYAAKDLNNCCADGQCQTCIDNESG
HALQCSTSPLSSLPAAATSPSVVSSSLDFINKTTSLHRFFERAAALPAPPPHRRLGNGVQLDPRDVAYGFEKVPS
VNLPKLCCGGKCSCPENRCVCGTSCGGCCLDVDFSMTTDDSVTDTIMESPLESADAAKASSSVDNNPVAPDKNCC
CRIP*
Coding >Agabi119p4|008740
ATGGCGAGAAGAGAAGAAGGCAAGGAGTGGGAGCGGAAGGAGGAGGAGGAGGCAGAGGAGGACATTCATTGGAGT
GAAAGAGAGGCCGCGTCTTTGTCATCCTCGCGCATCCTCCGAGTCGCTGCCATGTCCGCTTTTCTTCACAGGATC
GTCGCTTCAAATCCACTCCGGTCGCACGCTAGAAACGCAGTTTTCAGAGCTGCCAGGCCTTTTTCTGCGAGTTGC
ACTTGTCTGGCCCCGCCCCGGAGCTCACTCGCCTCTGCTACCTCAATTCCCCGATGGCGTCAGCGGAACAGCTTA
GCTGTACGAACGCCTGCCCATGTCCGATCCATGTTTATCCAGACAGAAACGACACCAAATGAGGATTCTCTCAAA
TTCATCCCCGGGACAACCGTCATGGGCGATGGTACCGCAGAATTTCTAGACACCCGCAGTGCCCTAGCGTCTCCC
CTCGCAATTCGCTTATTCGGTGTTGAAGGTGTTAATGGCGTATTCTACGGTCCCGACTTTGTTACAGTCTCAAAA
GATTCGGAAAATACATGGGCAGTCGTCAAGCCTGAAATTTATGCCATTCTCATGGAGCACTTCTCCTCCGGTCAA
GCCCTGTTCCGTAGCGAAGAAGACAGAGAAGCTGCTGGACCCCAGGATCTCAAAATTCTAGATACGGATTCCGAC
ACGGTGGCCATGATCAAAGAACTGCTAGAGACAAGAGTACGGCCGGCCATTATGGAAGACGGCGGAGATATTGAG
TTTAGAGGATTCGATGAGGATGGGGTTGTCAAGCTCAAGCTCAAGGGAAGCTGCAGAGGCTGTTCATCAAGCACA
GTCACCCTCAAAAGCGGTATCGAGCGTATGCTCACGCACTATATTCCGGAAGTCAAGAGTGTGCAAGAGGTTCTA
GACCAAGAAGATGAAATCGCCCTCGAAGAATTCCAAAAGTTGGAGCAAAAATTGGAGCATAAGGATTCTGGAATG
GCCCGATACATAATTTTCGATATTGTCATACAATTACGCCCTATTGGCAGCCATCCTGTGAAGGGCCTCGAAGGG
TGGGAAGACAGAGCGACCTGCCTGATTTCCACCCCCTCCGCCGCATGTCTCCTGAGCATGGTCTACGTGAACAGC
AAGAAATTCGCCTGCGAATCCTGTATCAAAGGCCACCGCTCTTCATCTTGCCATCATAGTGACCGCCCCCTCTTC
GAAATCAAAAAGAAAGGACGTCCAGTGTCCCAATGCGAAAGATGCAGGGAGCTGCGACAGTCCAAAAGAGTCCAC
TCGAAGTGTACTTGTGGCCCCAGACCCGATCCCGCTAGTCGTGGAGAGGTTCTGGCATCTACCACCTCGAAATCC
CGCAGATACATCCCAATCATTCCGGCCTTACCGAATGGTCTACGAGACGTTTTAGCCGCATCACATATTCGCACG
TCGCTTCCCGCGGACTCGAGGCAACGAGTGGACACTCTCCTGAACCCATGCAGCTGCAAGAGCGTCTGGAGATGC
GACTGTCGACGGAGTCAGTTACACGACGATTCTGATCCGGTGGACTCTGTGACACCTGCTCATCAAGCTCCAACC
CACGTTCATGCCTCAAGAATAGCTTTGATGCCTCCTCCACATCCCACCGCCAAAACTGCTCCCTCGAATGGAGTA
CCCTCACCTTCCGGATCTACCAAGCCCCACGTATCTCAATCATTCAACGTACGGCAGATTTACAACAAACAGACA
AACCACCACCATAACATTGATCCACCTTCCTGTTGTTCTCCGAGTCCAATCTTAGAACTTCCGCCTATCCAATCT
TCCCCCGAGTCATCGTCATCCCCAACGGTGAATGCCATTCCCGACTTTGGGTTCATGCCCCCAATGAGTACTATT
GCTTCCCTAGCCGGTTCTGGATGTACTTGCGGAGTTCAATGTACTTGCCCTGGCTGTGTAGAACACAGAGGACCT
GAATATGCTGCGAAAGATTTAAACAATTGCTGTGCGGACGGCCAATGTCAAACATGTATCGATAACGAATCGGGA
CATGCGCTTCAATGCAGTACTTCTCCCCTATCATCGCTCCCAGCTGCCGCGACGTCACCGTCAGTAGTATCATCA
TCTCTGGACTTTATCAATAAGACTACGTCCCTTCATCGATTTTTTGAGCGTGCGGCTGCACTGCCAGCACCTCCA
CCTCACCGTCGACTCGGTAATGGAGTTCAACTCGATCCTCGCGATGTTGCATATGGTTTTGAAAAGGTACCTTCC
GTCAATTTACCAAAATTGTGCTGTGGAGGGAAATGTAGCTGTCCTGAAAATCGGTGTGTGTGTGGTACCTCGTGT
GGGGGCTGTTGTTTGGATGTGGATTTCTCTATGACCACCGATGACTCTGTTACCGATACGATAATGGAGTCGCCC
CTTGAAAGTGCTGATGCCGCTAAAGCGTCATCTTCAGTTGATAACAATCCTGTAGCGCCGGACAAGAATTGTTGT
TGTCGAATTCCGTAG
Transcript >Agabi119p4|008740
ATGGCGAGAAGAGAAGAAGGCAAGGAGTGGGAGCGGAAGGAGGAGGAGGAGGCAGAGGAGGACATTCATTGGAGT
GAAAGAGAGGCCGCGTCTTTGTCATCCTCGCGCATCCTCCGAGTCGCTGCCATGTCCGCTTTTCTTCACAGGATC
GTCGCTTCAAATCCACTCCGGTCGCACGCTAGAAACGCAGTTTTCAGAGCTGCCAGGCCTTTTTCTGCGAGTTGC
ACTTGTCTGGCCCCGCCCCGGAGCTCACTCGCCTCTGCTACCTCAATTCCCCGATGGCGTCAGCGGAACAGCTTA
GCTGTACGAACGCCTGCCCATGTCCGATCCATGTTTATCCAGACAGAAACGACACCAAATGAGGATTCTCTCAAA
TTCATCCCCGGGACAACCGTCATGGGCGATGGTACCGCAGAATTTCTAGACACCCGCAGTGCCCTAGCGTCTCCC
CTCGCAATTCGCTTATTCGGTGTTGAAGGTGTTAATGGCGTATTCTACGGTCCCGACTTTGTTACAGTCTCAAAA
GATTCGGAAAATACATGGGCAGTCGTCAAGCCTGAAATTTATGCCATTCTCATGGAGCACTTCTCCTCCGGTCAA
GCCCTGTTCCGTAGCGAAGAAGACAGAGAAGCTGCTGGACCCCAGGATCTCAAAATTCTAGATACGGATTCCGAC
ACGGTGGCCATGATCAAAGAACTGCTAGAGACAAGAGTACGGCCGGCCATTATGGAAGACGGCGGAGATATTGAG
TTTAGAGGATTCGATGAGGATGGGGTTGTCAAGCTCAAGCTCAAGGGAAGCTGCAGAGGCTGTTCATCAAGCACA
GTCACCCTCAAAAGCGGTATCGAGCGTATGCTCACGCACTATATTCCGGAAGTCAAGAGTGTGCAAGAGGTTCTA
GACCAAGAAGATGAAATCGCCCTCGAAGAATTCCAAAAGTTGGAGCAAAAATTGGAGCATAAGGATTCTGGAATG
GCCCGATACATAATTTTCGATATTGTCATACAATTACGCCCTATTGGCAGCCATCCTGTGAAGGGCCTCGAAGGG
TGGGAAGACAGAGCGACCTGCCTGATTTCCACCCCCTCCGCCGCATGTCTCCTGAGCATGGTCTACGTGAACAGC
AAGAAATTCGCCTGCGAATCCTGTATCAAAGGCCACCGCTCTTCATCTTGCCATCATAGTGACCGCCCCCTCTTC
GAAATCAAAAAGAAAGGACGTCCAGTGTCCCAATGCGAAAGATGCAGGGAGCTGCGACAGTCCAAAAGAGTCCAC
TCGAAGTGTACTTGTGGCCCCAGACCCGATCCCGCTAGTCGTGGAGAGGTTCTGGCATCTACCACCTCGAAATCC
CGCAGATACATCCCAATCATTCCGGCCTTACCGAATGGTCTACGAGACGTTTTAGCCGCATCACATATTCGCACG
TCGCTTCCCGCGGACTCGAGGCAACGAGTGGACACTCTCCTGAACCCATGCAGCTGCAAGAGCGTCTGGAGATGC
GACTGTCGACGGAGTCAGTTACACGACGATTCTGATCCGGTGGACTCTGTGACACCTGCTCATCAAGCTCCAACC
CACGTTCATGCCTCAAGAATAGCTTTGATGCCTCCTCCACATCCCACCGCCAAAACTGCTCCCTCGAATGGAGTA
CCCTCACCTTCCGGATCTACCAAGCCCCACGTATCTCAATCATTCAACGTACGGCAGATTTACAACAAACAGACA
AACCACCACCATAACATTGATCCACCTTCCTGTTGTTCTCCGAGTCCAATCTTAGAACTTCCGCCTATCCAATCT
TCCCCCGAGTCATCGTCATCCCCAACGGTGAATGCCATTCCCGACTTTGGGTTCATGCCCCCAATGAGTACTATT
GCTTCCCTAGCCGGTTCTGGATGTACTTGCGGAGTTCAATGTACTTGCCCTGGCTGTGTAGAACACAGAGGACCT
GAATATGCTGCGAAAGATTTAAACAATTGCTGTGCGGACGGCCAATGTCAAACATGTATCGATAACGAATCGGGA
CATGCGCTTCAATGCAGTACTTCTCCCCTATCATCGCTCCCAGCTGCCGCGACGTCACCGTCAGTAGTATCATCA
TCTCTGGACTTTATCAATAAGACTACGTCCCTTCATCGATTTTTTGAGCGTGCGGCTGCACTGCCAGCACCTCCA
CCTCACCGTCGACTCGGTAATGGAGTTCAACTCGATCCTCGCGATGTTGCATATGGTTTTGAAAAGGTACCTTCC
GTCAATTTACCAAAATTGTGCTGTGGAGGGAAATGTAGCTGTCCTGAAAATCGGTGTGTGTGTGGTACCTCGTGT
GGGGGCTGTTGTTTGGATGTGGATTTCTCTATGACCACCGATGACTCTGTTACCGATACGATAATGGAGTCGCCC
CTTGAAAGTGCTGATGCCGCTAAAGCGTCATCTTCAGTTGATAACAATCCTGTAGCGCCGGACAAGAATTGTTGT
TGTCGAATTCCGTAG
Gene >Agabi119p4|008740
ATGGCGAGAAGAGAAGAAGGCAAGGAGTGGGAGCGGAAGGAGGAGGAGGAGGCAGAGGAGGACATTCATTGGAGT
GAAAGAGAGGCCGCGTCTTTGTCATCCTCGCGCATCCTCCGAGTCGCTGCCATGTCCGCTTTTCTTCACAGGATC
GTCGCTTCAAATCCACTCCGGTCGCACGCTAGAAACGCAGTTTTCAGAGCTGCCAGGCCTTTTTCTGCGAGTTGC
ACTTGTCTGGCCCCGCCCCGGAGCTCACTCGCCTCTGCTACCTCAATTCCCCGATGGCGTCAGCGGAACAGCTTA
GCTGTACGAACGCCTGCCCATGGTATGCTGCCATATCTTGTCCACAATGATACCTAACTCATTCATCTAGTCCGA
TCCATGTTTATCCAGACAGAAACGACACCAAATGAGGATTCTCTCAAATTCATCCCCGGGACAACCGTCATGGGC
GATGGTACCGCAGAATTTCTAGACACCCGCAGTGCCCTAGCGTCTCCCCTCGCAATTCGCTTATTCGGTGTTGAA
GGTGTTAATGGCGTATTCTACGGTCCCGACTTTGTTACAGTCTCAAAAGATTCGGAAAATACATGGGCAGTCGTC
AAGCCTGAAATTTATGCCATTCTCATGGAGCACTTCTCCTCCGGTCAAGCCCTGTTCCGTAGCGAAGAAGACAGA
GAAGCTGCTGGACCCCAGGATCTCAAAATTCTAGATACGGATTCCGACACGGTGGCCATGATCAAAGAACTGCTA
GAGACAAGAGTACGGCCGGCCATTATGGAAGACGGCGGAGATATTGAGTTTAGAGGATTCGATGAGGATGGGGTT
GTCAAGCTCAAGCTCAAGGGAAGCTGCAGAGGCTGTTCATCAAGCACAGTCACCCTCAAAAGCGGTATCGAGCGT
ATGCTCACGCACTATATTCCGGAAGTCAAGAGTGTGCAAGAGGTGAGAGGGTTGTTGGCATGGCGTGTAACTTGA
ATGAGTAATTTTCCATAGGTTCTAGACCAAGAAGATGAAATCGCCCTCGAAGAATTCCAAAAGTTGGAGCAAAAA
TTGGAGCATAAGGATTCTGGGTGAGTAACTTTCTTTGAAGTTTTTGTATTTGTGGCGCTCATAACAATACAGAAT
GGCCCGATACATGTCTGTATAGCTTTCCAGCGACCTGCTTGCGTAGATCCGAGTCCTCACATTATGTAGACATGC
ATTTTTACAATAGAATTTTCGATATTGTCATACAATTACGCCCTATTGGCAGCCATCCTGTGAAGGGCCTCGAAG
GGTGGGAAGACAGAGCGACCTGGTCAAGTGATCGAATCTTATAAATTCCACTGCATGCGTGTCTGCCGATAGCCT
GATTTCCACCCCCTCCGCCGCATGTCTCCTGAGCATGGTACAACCAGTCTCCGCTTTTCTCATTGACACCACTCA
TGCCTCTTCTCCTAGGTCTACGTGAACAGCAAGAAATTCGCCTGGTAATTTCAGACTCAATCTGTAGATCTCAAT
ATTAATCCTCAACTGCAGCGAATCCTGTATCAAAGGCCACCGCTCTTCATCTTGCCATCATAGTGACCGCCCCCT
CTTCGAAATCAAAAAGAAAGGACGTCCAGTGTCCCAATGCGAAAGATGCAGGGAGCTGCGACAGTCCAAAAGAGT
CCACTCGAAGTGTACTTGTGGCCCCAGACCCGATCCCGCTAGTCGTGGAGAGGTTCTGGCATCTACCACCTCGAA
ATGTATGTCATTTCGAGCTCGCATAGTGGGTCTCACGATAACGTTCTCTCCAGCCCGCAGATACATCCCAATCAT
TCCGGCCTTACCGAATGGTCTACGAGACGTTTTAGCCGCATCACATATTCGCACGTCGCTTCCCGCGGACTCGAG
GCAACGAGGTAATTGAATGATAAACTCTACGCGTTCTATAAGCTCATGCTTGAATTAGTGGACACTCTCCTGAAC
CCATGCAGCTGCAAGAGCGTCTGGAGATGCGACTGTCGACGGAGTCAGTTACACGACGATTCTGATCCGGTGGAC
TCTGTGACACCTGCTCATCAAGCTCCAACCCACGTTCATGCCTCAAGAATAGCTTTGATGCCTCCTCCACATCCC
ACCGCCAAAACTGCTCCCTCGAATGGAGTACCCTCACCTTCCGGATCTACCAAGCCCCACGTATCTCAATCATTC
AACGTACGGCAGATTTACAACAAACAGACAAACCACCACCATAACATTGATCCACCTTCCTGTTGTTCTCCGAGT
CCAATCTTAGAACTTCCGCCTATCCAATCTTCCCCCGAGTCATCGTCATCCCCAACGGTGAATGCCATTCCCGAC
TTTGGGTTCATGCCCCCAATGAGTACTATTGCTTCCCTAGCCGGTTCTGGATGTACTTGCGGAGTTCAATGTACT
TGCCCTGGCTGTGTAGAACACAGAGGACCTGAATATGCTGCGAAAGATTTAAACAATTGCTGTGCGGACGGCCAA
TGTCAAACATGTATCGATAACGAATCGGGACATGCGCTTCAATGCAGTACTTCTCCCCTATCATCGCTCCCAGCT
GCCGCGACGTCACCGTCAGTAGTATCATCATCTCTGGACTTTATCAATAAGACTACGTCCCTTCATCGATTTTTT
GAGCGTGCGGCTGCACTGCCAGCACCTCCACCTCACCGTCGACTCGGTAATGGAGTTCAACTCGATCCTCGCGAT
GTTGCATATGGTTTTGAAAAGGTACCTTCCGTCAATTTACCAAAATTGTGCTGTGGAGGGAAATGTAGCTGTCCT
GAAAATCGGTGTGTGTGTGGTACCTCGTGTGGGGGCTGTTGTTTGGATGTGGATTTCTCTATGACCACCGATGAC
TCTGTTACCGATACGATAATGGAGTCGCCCCTTGAAAGTGCTGATGCCGCTAAAGCGTCATCTTCAGTTGATAAC
AATCCTGTAGCGCCGGACAAGAATTGTTGTTGTCGAATTCCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail