Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|008670
Gene name
Locationscaffold_01a:2022496..2027934
Strand+
Gene length (bp)5438
Transcript length (bp)4650
Coding sequence length (bp)4650
Protein length (aa) 1550

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00521 DNA_topoisoIV DNA gyrase/topoisomerase IV, subunit A 4.1E-121 771 1218
PF16898 TOPRIM_C C-terminal associated domain of TOPRIM 4.5E-49 643 769
PF00204 DNA_gyraseB DNA gyrase B 4.1E-28 332 498
PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 5.2E-13 145 290
PF01751 Toprim Toprim domain 6.1E-07 529 627

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P08096|TOP2_SCHPO DNA topoisomerase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=top2 PE=1 SV=2 98 1443 0.0E+00
sp|Q9Y8G8|TOP2_PENCH DNA topoisomerase 2 OS=Penicillium chrysogenum GN=TOP2 PE=3 SV=1 51 1251 0.0E+00
sp|Q01879|TOP2_PICGU DNA topoisomerase 2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TOP2 PE=3 SV=3 95 1254 0.0E+00
sp|O93794|TOP2_CANGA DNA topoisomerase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TOP2 PE=3 SV=2 88 1226 0.0E+00
sp|P87078|TOP2_CANAX DNA topoisomerase 2 OS=Candida albicans GN=TOP2 PE=3 SV=1 90 1254 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P08096|TOP2_SCHPO DNA topoisomerase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=top2 PE=1 SV=2 98 1443 0.0E+00
sp|Q9Y8G8|TOP2_PENCH DNA topoisomerase 2 OS=Penicillium chrysogenum GN=TOP2 PE=3 SV=1 51 1251 0.0E+00
sp|Q01879|TOP2_PICGU DNA topoisomerase 2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TOP2 PE=3 SV=3 95 1254 0.0E+00
sp|O93794|TOP2_CANGA DNA topoisomerase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TOP2 PE=3 SV=2 88 1226 0.0E+00
sp|P87078|TOP2_CANAX DNA topoisomerase 2 OS=Candida albicans GN=TOP2 PE=3 SV=1 90 1254 0.0E+00
sp|P06786|TOP2_YEAST DNA topoisomerase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOP2 PE=1 SV=2 93 1234 0.0E+00
sp|O24308|TOP2_PEA DNA topoisomerase 2 OS=Pisum sativum GN=TOP2 PE=2 SV=1 92 1220 0.0E+00
sp|O42130|TOP2A_CHICK DNA topoisomerase 2-alpha OS=Gallus gallus GN=TOP2A PE=2 SV=2 84 1223 0.0E+00
sp|O16140|TOP2_BOMMO DNA topoisomerase 2 OS=Bombyx mori GN=TOP2 PE=2 SV=1 90 1315 0.0E+00
sp|Q01320|TOP2A_MOUSE DNA topoisomerase 2-alpha OS=Mus musculus GN=Top2a PE=1 SV=2 90 1225 0.0E+00
sp|P41515|TOP2A_CRIGR DNA topoisomerase 2-alpha OS=Cricetulus griseus GN=TOP2A PE=1 SV=1 90 1225 0.0E+00
sp|P11388|TOP2A_HUMAN DNA topoisomerase 2-alpha OS=Homo sapiens GN=TOP2A PE=1 SV=3 90 1225 0.0E+00
sp|O46374|TOP2A_PIG DNA topoisomerase 2-alpha OS=Sus scrofa GN=TOP2A PE=2 SV=1 83 1225 0.0E+00
sp|P41516|TOP2A_RAT DNA topoisomerase 2-alpha OS=Rattus norvegicus GN=Top2a PE=2 SV=1 90 1225 0.0E+00
sp|Q02880|TOP2B_HUMAN DNA topoisomerase 2-beta OS=Homo sapiens GN=TOP2B PE=1 SV=3 82 1223 0.0E+00
sp|O42131|TOP2B_CHICK DNA topoisomerase 2-beta OS=Gallus gallus GN=TOP2B PE=2 SV=1 82 1255 0.0E+00
sp|Q64399|TOP2B_CRILO DNA topoisomerase 2-beta OS=Cricetulus longicaudatus GN=TOP2B PE=2 SV=1 82 1223 0.0E+00
sp|Q64511|TOP2B_MOUSE DNA topoisomerase 2-beta OS=Mus musculus GN=Top2b PE=1 SV=2 82 1223 0.0E+00
sp|P15348|TOP2_DROME DNA topoisomerase 2 OS=Drosophila melanogaster GN=Top2 PE=1 SV=1 89 1272 0.0E+00
sp|Q23670|TOP2_CAEEL Probable DNA topoisomerase 2 OS=Caenorhabditis elegans GN=K12D12.1 PE=3 SV=2 64 1223 0.0E+00
sp|P41001|TOP2_PLAFK DNA topoisomerase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=TOP2 PE=3 SV=1 88 1218 0.0E+00
sp|Q55BP5|TOP2_DICDI Probable DNA topoisomerase 2 OS=Dictyostelium discoideum GN=top2 PE=3 SV=1 3 1250 0.0E+00
sp|P90520|TOP2M_DICDI DNA topoisomerase 2, mitochondrial OS=Dictyostelium discoideum GN=top2mt PE=2 SV=2 70 1220 0.0E+00
sp|P34534|TOP2M_CAEEL Putative DNA topoisomerase 2, mitochondrial OS=Caenorhabditis elegans GN=R05D3.12 PE=3 SV=5 98 1218 0.0E+00
sp|Q5UQE6|TOP2_MIMIV DNA topoisomerase 2 OS=Acanthamoeba polyphaga mimivirus GN=TOP2 PE=3 SV=1 92 1004 0.0E+00
sp|P12531|TOP2_TRYBB DNA topoisomerase 2 OS=Trypanosoma brucei brucei GN=TOP2 PE=3 SV=1 98 1220 0.0E+00
sp|P30190|TOP2_TRYCR DNA topoisomerase 2 OS=Trypanosoma cruzi GN=TOP2 PE=3 SV=1 98 1220 0.0E+00
sp|Q9QSK1|TOP2_IIV6 DNA topoisomerase 2 OS=Invertebrate iridescent virus 6 GN=TOP2 PE=3 SV=1 98 1217 0.0E+00
sp|O61078|TOP2_LEICH DNA topoisomerase 2 OS=Leishmania chagasi GN=TOP2 PE=3 SV=2 93 1220 0.0E+00
sp|P27570|TOP2_CRIFA DNA topoisomerase 2 OS=Crithidia fasciculata GN=TOP2 PE=3 SV=1 98 1220 0.0E+00
sp|Q196X4|TOP2_IIV3 DNA topoisomerase 2 OS=Invertebrate iridescent virus 3 GN=IIV3-086L PE=3 SV=1 96 1217 6.0E-168
sp|P0C9C2|TOP2_ASFK5 DNA topoisomerase 2 OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-124 PE=3 SV=1 120 1090 2.0E-78
sp|P0C9C0|TOP2_ASFP4 DNA topoisomerase 2 OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=Pret-124 PE=3 SV=1 120 1090 2.0E-77
sp|P0C9C1|TOP2_ASFWA DNA topoisomerase 2 OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-122 PE=3 SV=1 120 1090 2.0E-76
sp|P34203|TOP2_ASFM2 DNA topoisomerase 2 OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-120 PE=3 SV=1 120 1090 5.0E-76
sp|Q00942|TOP2_ASFB7 DNA topoisomerase 2 OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=TOP PE=3 SV=1 120 1090 1.0E-75
sp|O67137|GYRB_AQUAE DNA gyrase subunit B OS=Aquifex aeolicus (strain VF5) GN=gyrB PE=3 SV=1 84 670 2.0E-42
sp|P77993|GYRB_THEMA DNA gyrase subunit B OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=gyrB PE=3 SV=2 91 690 2.0E-41
sp|P94604|GYRB_CLOAB DNA gyrase subunit B OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=gyrB PE=3 SV=2 105 690 6.0E-40
sp|Q9PKK3|GYRB_CHLMU DNA gyrase subunit B OS=Chlamydia muridarum (strain MoPn / Nigg) GN=gyrB PE=3 SV=1 90 670 6.0E-39
sp|O84193|GYRB_CHLTR DNA gyrase subunit B OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=gyrB PE=3 SV=1 90 670 1.0E-38
sp|P47720|GYRB_MYCGA DNA gyrase subunit B OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=gyrB PE=3 SV=2 107 692 4.0E-38
sp|Q9Z8R3|GYRB_CHLPN DNA gyrase subunit B OS=Chlamydia pneumoniae GN=gyrB PE=3 SV=1 99 709 5.0E-38
sp|P43703|PARE_HAEIN DNA topoisomerase 4 subunit B OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=parE PE=3 SV=1 178 736 2.0E-37
sp|P94281|PARE_BARBK DNA topoisomerase 4 subunit B OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=parE PE=3 SV=1 127 653 8.0E-37
sp|O29720|GYRB_ARCFU DNA gyrase subunit B OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=gyrB PE=3 SV=2 88 690 1.0E-36
sp|P20083|PARE_ECOLI DNA topoisomerase 4 subunit B OS=Escherichia coli (strain K12) GN=parE PE=1 SV=3 178 737 1.0E-35
sp|P0A2I5|PARE_SALTY DNA topoisomerase 4 subunit B OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=parE PE=3 SV=1 178 737 1.0E-35
sp|P0A2I6|PARE_SALTI DNA topoisomerase 4 subunit B OS=Salmonella typhi GN=parE PE=3 SV=1 178 737 1.0E-35
sp|P50028|GYRB_MYCCT DNA gyrase subunit B OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=gyrB PE=3 SV=2 101 690 2.0E-35
sp|O87667|GYRB_CAMJE DNA gyrase subunit B OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=gyrB PE=3 SV=2 105 704 3.0E-35
sp|P55992|GYRB_HELPY DNA gyrase subunit B OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=gyrB PE=3 SV=1 143 635 4.0E-35
sp|Q9ZLX3|GYRB_HELPJ DNA gyrase subunit B OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=gyrB PE=3 SV=1 143 654 6.0E-35
sp|P78016|PARE_MYCPN DNA topoisomerase 4 subunit B OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=parE PE=3 SV=1 109 690 7.0E-35
sp|P09176|TOPL_BPT4 DNA topoisomerase large subunit OS=Enterobacteria phage T4 GN=39 PE=1 SV=2 101 588 9.0E-35
sp|P05652|GYRB_BACSU DNA gyrase subunit B OS=Bacillus subtilis (strain 168) GN=gyrB PE=3 SV=1 105 690 1.0E-34
sp|Q5NBJ3|GYRB_ORYSJ DNA gyrase subunit B, chloroplastic/mitochondrial OS=Oryza sativa subsp. japonica GN=GYRB PE=2 SV=1 81 687 1.0E-34
sp|P34031|GYRB_SPICI DNA gyrase subunit B OS=Spiroplasma citri GN=gyrB PE=3 SV=1 95 635 2.0E-34
sp|P47249|GYRB_MYCGE DNA gyrase subunit B OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=gyrB PE=3 SV=1 95 687 2.0E-34
sp|Q9HUJ8|PARE_PSEAE DNA topoisomerase 4 subunit B OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=parE PE=3 SV=1 149 735 3.0E-34
sp|O50627|GYRB_BACHD DNA gyrase subunit B OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=gyrB PE=3 SV=1 105 690 3.0E-34
sp|P22447|GYRB_MYCPN DNA gyrase subunit B OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=gyrB PE=1 SV=1 105 737 4.0E-34
sp|Q9I7C2|GYRB_PSEAE DNA gyrase subunit B OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gyrB PE=3 SV=1 88 657 4.0E-33
sp|P57126|GYRB_BUCAI DNA gyrase subunit B OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=gyrB PE=3 SV=1 109 634 5.0E-33
sp|P13364|GYRB_PSEPU DNA gyrase subunit B OS=Pseudomonas putida GN=gyrB PE=3 SV=2 88 657 6.0E-33
sp|Q59192|PARE_BACSU DNA topoisomerase 4 subunit B OS=Bacillus subtilis (strain 168) GN=parE PE=3 SV=2 101 690 1.0E-32
sp|O08399|GYRB_TREPA DNA gyrase subunit B OS=Treponema pallidum (strain Nichols) GN=gyrB PE=1 SV=1 95 687 2.0E-32
sp|P47445|PARE_MYCGE DNA topoisomerase 4 subunit B OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=parE PE=3 SV=1 109 735 2.0E-32
sp|Q92H87|GYRB_RICCN DNA gyrase subunit B OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=gyrB PE=3 SV=1 105 634 3.0E-32
sp|Q9KVX3|GYRB_VIBCH DNA gyrase subunit B OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=gyrB PE=3 SV=1 145 657 3.0E-32
sp|Q1RHT8|GYRB_RICBR DNA gyrase subunit B OS=Rickettsia bellii (strain RML369-C) GN=gyrB PE=3 SV=1 105 634 8.0E-32
sp|P29435|GYRB_BUCAP DNA gyrase subunit B OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=gyrB PE=3 SV=3 109 657 1.0E-31
sp|P33769|GYRB_BORBU DNA gyrase subunit B OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=gyrB PE=3 SV=4 94 690 1.0E-31
sp|O51859|GYRB_VIBPA DNA gyrase subunit B OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=gyrB PE=3 SV=2 145 657 2.0E-31
sp|O87545|GYRB_TREDE DNA gyrase subunit B OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=gyrB PE=3 SV=1 88 687 3.0E-31
sp|P07065|TOP5_BPT4 DNA topoisomerase medium subunit OS=Enterobacteria phage T4 GN=52 PE=3 SV=2 757 1138 1.0E-30
sp|O54479|PARE_CAUCR DNA topoisomerase 4 subunit B OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=parE PE=3 SV=2 101 687 2.0E-30
sp|Q68WF6|GYRB_RICTY DNA gyrase subunit B OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=gyrB PE=3 SV=1 105 634 2.0E-30
sp|Q4UKX5|GYRB_RICFE DNA gyrase subunit B OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=gyrB PE=3 SV=1 105 634 2.0E-30
sp|Q8CSN9|PARE_STAES DNA topoisomerase 4 subunit B OS=Staphylococcus epidermidis (strain ATCC 12228) GN=parE PE=3 SV=2 105 690 3.0E-30
sp|Q5HPI6|PARE_STAEQ DNA topoisomerase 4 subunit B OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=parE PE=3 SV=2 105 690 3.0E-30
sp|Q5YLB4|GYRB_NICBE DNA gyrase subunit B, chloroplastic/mitochondrial OS=Nicotiana benthamiana GN=GYRB PE=2 SV=1 95 687 3.0E-30
sp|P0AES8|GYRB_SHIFL DNA gyrase subunit B OS=Shigella flexneri GN=gyrB PE=3 SV=2 145 657 3.0E-30
sp|P0AES6|GYRB_ECOLI DNA gyrase subunit B OS=Escherichia coli (strain K12) GN=gyrB PE=1 SV=2 145 657 3.0E-30
sp|P0AES7|GYRB_ECO57 DNA gyrase subunit B OS=Escherichia coli O157:H7 GN=gyrB PE=3 SV=2 145 657 3.0E-30
sp|Q9ZCX2|GYRB_RICPR DNA gyrase subunit B OS=Rickettsia prowazekii (strain Madrid E) GN=gyrB PE=3 SV=1 105 634 4.0E-30
sp|Q9X3Y6|GYRB_BACAN DNA gyrase subunit B OS=Bacillus anthracis GN=gyrB PE=3 SV=2 105 690 4.0E-30
sp|Q68XE1|PARE_RICTY DNA topoisomerase 4 subunit B OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=parE PE=3 SV=1 149 700 4.0E-30
sp|Q94BZ7|GYRBM_ARATH DNA gyrase subunit B, mitochondrial OS=Arabidopsis thaliana GN=GYRBM PE=2 SV=1 89 687 6.0E-30
sp|Q9ZAQ6|GYRB_MYCAT DNA gyrase subunit B OS=Mycoplasma arthritidis GN=gyrB PE=3 SV=1 88 687 7.0E-30
sp|P43701|GYRB_HAEIN DNA gyrase subunit B OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gyrB PE=3 SV=1 145 670 2.0E-29
sp|Q89B37|GYRB_BUCBP DNA gyrase subunit B OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=gyrB PE=3 SV=1 109 635 2.0E-29
sp|P0DG05|GYRB_STRPQ DNA gyrase subunit B OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=gyrB PE=3 SV=1 145 635 2.0E-29
sp|P0DG04|GYRB_STRP3 DNA gyrase subunit B OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=gyrB PE=3 SV=1 145 635 2.0E-29
sp|Q9ZFK1|GYRB_BORHE DNA gyrase subunit B OS=Borrelia hermsii GN=gyrB PE=3 SV=1 94 690 2.0E-29
sp|P22118|GYRB_NEIGO DNA gyrase subunit B OS=Neisseria gonorrhoeae GN=gyrB PE=3 SV=2 105 670 2.0E-29
sp|Q92IW1|PARE_RICCN DNA topoisomerase 4 subunit B OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=parE PE=3 SV=1 149 737 3.0E-29
sp|P0A2I3|GYRB_SALTY DNA gyrase subunit B OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gyrB PE=3 SV=2 145 657 4.0E-29
sp|P0A2I4|GYRB_SALTI DNA gyrase subunit B OS=Salmonella typhi GN=gyrB PE=3 SV=2 145 657 4.0E-29
sp|P21558|GYRB_HALL2 DNA gyrase subunit B OS=Haloferax lucentense (strain DSM 14919 / JCM 9276 / NCIMB 13854 / Aa 2.2) GN=gyrB PE=1 SV=2 105 690 4.0E-29
sp|P43053|GYRB_MYCHP DNA gyrase subunit B OS=Mycoplasma hominis (strain ATCC 23114 / NBRC 14850 / NCTC 10111 / PG21) GN=gyrB PE=3 SV=2 101 687 5.0E-29
sp|Q9SS38|GYRBP_ARATH DNA gyrase subunit B, chloroplastic OS=Arabidopsis thaliana GN=GYRBC PE=2 SV=3 80 687 6.0E-29
sp|D4GZ01|GYRB_HALVD DNA gyrase subunit B OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=gyrB PE=1 SV=1 105 690 8.0E-29
sp|Q9ZDU7|PARE_RICPR DNA topoisomerase 4 subunit B OS=Rickettsia prowazekii (strain Madrid E) GN=parE PE=3 SV=1 149 700 1.0E-28
sp|Q6G9K5|PARE_STAAS DNA topoisomerase 4 subunit B OS=Staphylococcus aureus (strain MSSA476) GN=parE PE=3 SV=2 105 690 4.0E-28
sp|P66939|PARE_STAAN DNA topoisomerase 4 subunit B OS=Staphylococcus aureus (strain N315) GN=parE PE=1 SV=1 105 690 4.0E-28
sp|P66938|PARE_STAAM DNA topoisomerase 4 subunit B OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=parE PE=3 SV=1 105 690 4.0E-28
sp|P0A0K9|PARE_STAAW DNA topoisomerase 4 subunit B OS=Staphylococcus aureus (strain MW2) GN=parE PE=3 SV=1 105 690 4.0E-28
sp|P0C1S7|PARE_STAAU DNA topoisomerase 4 subunit B OS=Staphylococcus aureus GN=parE PE=3 SV=1 105 690 4.0E-28
sp|Q5HG65|PARE_STAAC DNA topoisomerase 4 subunit B OS=Staphylococcus aureus (strain COL) GN=parE PE=3 SV=2 105 690 4.0E-28
sp|Q2FYS5|PARE_STAA8 DNA topoisomerase 4 subunit B OS=Staphylococcus aureus (strain NCTC 8325) GN=parE PE=3 SV=1 105 690 4.0E-28
sp|Q6GH51|PARE_STAAR DNA topoisomerase 4 subunit B OS=Staphylococcus aureus (strain MRSA252) GN=parE PE=3 SV=2 105 690 6.0E-28
sp|Q4UKT4|PARE_RICFE DNA topoisomerase 4 subunit B OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=parE PE=3 SV=1 149 700 2.0E-27
sp|P0A0K7|GYRB_STAAW DNA gyrase subunit B OS=Staphylococcus aureus (strain MW2) GN=gyrB PE=3 SV=2 105 690 4.0E-27
sp|P0A0K8|GYRB_STAAU DNA gyrase subunit B OS=Staphylococcus aureus GN=gyrB PE=1 SV=2 105 690 4.0E-27
sp|Q6GD85|GYRB_STAAS DNA gyrase subunit B OS=Staphylococcus aureus (strain MSSA476) GN=gyrB PE=3 SV=3 105 690 4.0E-27
sp|Q2FKQ1|GYRB_STAA3 DNA gyrase subunit B OS=Staphylococcus aureus (strain USA300) GN=gyrB PE=3 SV=3 105 690 4.0E-27
sp|P66937|GYRB_STAAN DNA gyrase subunit B OS=Staphylococcus aureus (strain N315) GN=gyrB PE=1 SV=2 105 690 4.0E-27
sp|P66936|GYRB_STAAM DNA gyrase subunit B OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=gyrB PE=3 SV=2 105 690 4.0E-27
sp|Q6GKU0|GYRB_STAAR DNA gyrase subunit B OS=Staphylococcus aureus (strain MRSA252) GN=gyrB PE=1 SV=3 105 690 6.0E-27
sp|Q5HJZ1|GYRB_STAAC DNA gyrase subunit B OS=Staphylococcus aureus (strain COL) GN=gyrB PE=3 SV=3 109 690 7.0E-27
sp|Q59961|PARE_STRPN DNA topoisomerase 4 subunit B OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=parE PE=1 SV=3 88 658 1.0E-26
sp|Q1RK03|PARE_RICBR DNA topoisomerase 4 subunit B OS=Rickettsia bellii (strain RML369-C) GN=parE PE=3 SV=1 90 635 2.0E-26
sp|Q8P1M4|GYRB_STRP8 DNA gyrase subunit B OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=gyrB PE=3 SV=1 145 635 6.0E-26
sp|Q5XD05|GYRB_STRP6 DNA gyrase subunit B OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=gyrB PE=3 SV=1 145 635 6.0E-26
sp|P35886|GYRB_STRCO DNA gyrase subunit B OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=gyrB PE=3 SV=1 80 635 7.0E-26
sp|Q9A0L0|GYRB_STRP1 DNA gyrase subunit B OS=Streptococcus pyogenes serotype M1 GN=gyrB PE=3 SV=1 145 635 8.0E-26
sp|P0C559|GYRB_MYCSM DNA gyrase subunit B OS=Mycobacterium smegmatis GN=gyrB PE=1 SV=1 95 618 1.0E-25
sp|A0QNE0|GYRB_MYCS2 DNA gyrase subunit B OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=gyrB PE=1 SV=1 95 618 1.0E-25
sp|Q9LCK0|GYRB_CYTAU DNA gyrase subunit B (Fragment) OS=Cytophaga aurantiaca GN=gyrB PE=3 SV=1 217 634 3.0E-25
sp|Q59526|PARE_MYCGA DNA topoisomerase 4 subunit B OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=parE PE=3 SV=2 105 690 4.0E-25
sp|P0A4M0|GYRB_STRR6 DNA gyrase subunit B OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=gyrB PE=3 SV=1 145 691 5.0E-25
sp|P0A4L9|GYRB_STRPN DNA gyrase subunit B OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=gyrB PE=3 SV=1 145 691 5.0E-25
sp|Q8CQK4|GYRB_STAES DNA gyrase subunit B OS=Staphylococcus epidermidis (strain ATCC 12228) GN=gyrB PE=3 SV=1 105 690 6.0E-25
sp|Q5HK03|GYRB_STAEQ DNA gyrase subunit B OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=gyrB PE=3 SV=1 105 690 6.0E-25
sp|Q9LCK1|GYRB_CYTHU DNA gyrase subunit B (Fragment) OS=Cytophaga hutchinsonii GN=gyrB PE=3 SV=1 217 634 1.0E-24
sp|P0CAX1|GYRB_CAUCR DNA gyrase subunit B OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=gyrB PE=3 SV=1 107 657 2.0E-24
sp|B8GXQ0|GYRB_CAUCN DNA gyrase subunit B OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=gyrB PE=3 SV=1 107 657 2.0E-24
sp|P9WG45|GYRB_MYCTU DNA gyrase subunit B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=gyrB PE=1 SV=1 95 618 2.0E-24
sp|P9WG44|GYRB_MYCTO DNA gyrase subunit B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=gyrB PE=3 SV=1 95 618 2.0E-24
sp|A5TY73|GYRB_MYCTA DNA gyrase subunit B OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=gyrB PE=3 SV=2 95 618 2.0E-24
sp|P50075|GYRBS_STRNV DNA gyrase subunit B, novobiocin-sensitive OS=Streptomyces niveus GN=gyrBS PE=3 SV=1 99 635 4.0E-24
sp|O33367|GYRB_MYXXA DNA gyrase subunit B OS=Myxococcus xanthus GN=gyrB PE=3 SV=1 95 624 7.0E-24
sp|Q59533|GYRB_MYCLE DNA gyrase subunit B OS=Mycobacterium leprae (strain TN) GN=gyrB PE=3 SV=2 95 618 2.0E-23
sp|Q9L7L3|GYRB_MYCPA DNA gyrase subunit B OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=gyrB PE=3 SV=1 99 618 5.0E-23
sp|Q9FAX1|GYRB_FLEEL DNA gyrase subunit B (Fragment) OS=Flexibacter elegans GN=gyrB PE=3 SV=1 217 657 3.0E-22
sp|P50074|GYRBR_STRNV DNA gyrase subunit B, novobiocin-resistant OS=Streptomyces niveus GN=gyrBR PE=2 SV=1 99 635 5.0E-22
sp|Q9FAX2|GYRB_CHIJA DNA gyrase subunit B (Fragment) OS=Chitinophaga japonensis GN=gyrB PE=3 SV=1 217 635 2.0E-21
sp|Q59189|PARE_BORBU DNA topoisomerase 4 subunit B OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=parE PE=3 SV=2 101 687 2.0E-19
sp|A0QPN1|TOPOM_MYCS2 Topoisomerase subunit TopoM OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=topoM PE=1 SV=1 740 1201 6.0E-19
sp|O67108|GYRA_AQUAE DNA gyrase subunit A OS=Aquifex aeolicus (strain VF5) GN=gyrA PE=1 SV=1 746 1117 2.0E-18
sp|Q5UQE6|TOP2_MIMIV DNA topoisomerase 2 OS=Acanthamoeba polyphaga mimivirus GN=TOP2 PE=3 SV=1 1011 1219 2.0E-16
sp|Q9X3Y3|GYRB_BACCE DNA gyrase subunit B (Fragment) OS=Bacillus cereus GN=gyrB PE=3 SV=1 216 614 9.0E-16
sp|P77966|GYRB_SYNY3 DNA gyrase subunit B OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gyrB PE=3 SV=1 549 687 3.0E-15
sp|Q9X3Y5|GYRB_BACMY DNA gyrase subunit B (Fragment) OS=Bacillus mycoides GN=gyrB PE=3 SV=1 216 614 4.0E-15
sp|P73077|PARC_SYNY3 DNA topoisomerase 4 subunit A OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=parC PE=3 SV=2 771 1111 2.0E-13
sp|D5ECW5|GYRA_AMICL DNA gyrase subunit A OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1) GN=gyrA PE=3 SV=1 751 1093 3.0E-13
sp|Q9PKK4|GYRA_CHLMU DNA gyrase subunit A OS=Chlamydia muridarum (strain MoPn / Nigg) GN=gyrA PE=3 SV=1 747 1093 7.0E-13
sp|O51396|GYRA_BORBU DNA gyrase subunit A OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=gyrA PE=1 SV=1 771 1029 8.0E-13
sp|C5CHA8|GYRA_KOSOT DNA gyrase subunit A OS=Kosmotoga olearia (strain TBF 19.5.1) GN=gyrA PE=3 SV=1 749 1117 2.0E-12
sp|P34030|GYRA_SPICI DNA gyrase subunit A (Fragment) OS=Spiroplasma citri GN=gyrA PE=3 SV=1 771 934 3.0E-12
sp|O54478|PARC_CAUCR DNA topoisomerase 4 subunit A OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=parC PE=3 SV=2 752 938 6.0E-12
sp|Q44272|GYRB2_ACILW DNA gyrase subunit B (Fragment) OS=Acinetobacter lwoffii GN=gyrB PE=3 SV=2 218 607 8.0E-12
sp|Q44088|GYRB1_ACILW DNA gyrase subunit B (Fragment) OS=Acinetobacter lwoffii GN=gyrB PE=3 SV=2 218 607 8.0E-12
sp|O84192|GYRA_CHLTR DNA gyrase subunit A OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=gyrA PE=3 SV=1 747 1093 2.0E-11
sp|O51066|PARC_BORBU DNA topoisomerase 4 subunit A OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=parC PE=3 SV=1 771 1014 2.0E-11
sp|Q9Z8R4|GYRA_CHLPN DNA gyrase subunit A OS=Chlamydia pneumoniae GN=gyrA PE=3 SV=2 764 1093 2.0E-11
sp|P47719|GYRA_MYCGA DNA gyrase subunit A OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=gyrA PE=3 SV=2 771 952 3.0E-11
sp|Q1RGX8|PARC_RICBR DNA topoisomerase 4 subunit A OS=Rickettsia bellii (strain RML369-C) GN=parC PE=3 SV=1 748 926 5.0E-11
sp|A0QPN2|TOPON_MYCS2 Topoisomerase subunit TopoN OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=topoN PE=1 SV=2 386 701 7.0E-11
sp|Q92JH0|PARC_RICCN DNA topoisomerase 4 subunit A OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=parC PE=3 SV=1 748 939 8.0E-11
sp|Q5YLB5|GYRA_NICBE DNA gyrase subunit A, chloroplastic/mitochondrial OS=Nicotiana benthamiana GN=GYRA PE=2 SV=1 771 1100 1.0E-10
sp|P43700|GYRA_HAEIN DNA gyrase subunit A OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gyrA PE=3 SV=1 771 926 1.0E-10
sp|P0C0R0|GYRA_STAES DNA gyrase subunit A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=gyrA PE=3 SV=1 771 937 1.0E-10
sp|Q5HK04|GYRA_STAEQ DNA gyrase subunit A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=gyrA PE=3 SV=1 771 937 1.0E-10
sp|O83051|GYRA_TREPA DNA gyrase subunit A OS=Treponema pallidum (strain Nichols) GN=gyrA PE=3 SV=1 757 926 1.0E-10
sp|P47446|PARC_MYCGE DNA topoisomerase 4 subunit A OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=parC PE=3 SV=1 771 1027 1.0E-10
sp|P48374|PARC_NEIGO DNA topoisomerase 4 subunit A OS=Neisseria gonorrhoeae GN=parC PE=3 SV=1 771 926 1.0E-10
sp|P94605|GYRA_CLOAB DNA gyrase subunit A OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=gyrA PE=3 SV=2 771 947 2.0E-10
sp|P41080|GYRA_RICPR DNA gyrase subunit A OS=Rickettsia prowazekii (strain Madrid E) GN=gyrA PE=3 SV=1 771 932 2.0E-10
sp|Q4UKM1|GYRA_RICFE DNA gyrase subunit A OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=gyrA PE=3 SV=1 771 932 2.0E-10
sp|B2S0D7|GYRA_BORHD DNA gyrase subunit A OS=Borrelia hermsii (strain HS1 / DAH) GN=gyrA PE=3 SV=1 771 939 2.0E-10
sp|Q7XZF7|GYRA_ORYSJ Probable DNA gyrase subunit A, chloroplastic/mitochondrial OS=Oryza sativa subsp. japonica GN=GYRA PE=2 SV=2 771 942 2.0E-10
sp|P20831|GYRA_STAAU DNA gyrase subunit A OS=Staphylococcus aureus GN=gyrA PE=1 SV=3 771 937 2.0E-10
sp|Q99XG5|GYRA_STAAN DNA gyrase subunit A OS=Staphylococcus aureus (strain N315) GN=gyrA PE=1 SV=1 771 937 2.0E-10
sp|Q68XU1|PARC_RICTY DNA topoisomerase 4 subunit A OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=parC PE=3 SV=1 748 926 2.0E-10
sp|Q8NKW8|GYRA_STAAW DNA gyrase subunit A OS=Staphylococcus aureus (strain MW2) GN=gyrA PE=3 SV=1 771 937 2.0E-10
sp|Q6GD84|GYRA_STAAS DNA gyrase subunit A OS=Staphylococcus aureus (strain MSSA476) GN=gyrA PE=3 SV=1 771 937 2.0E-10
sp|Q2G2Q0|GYRA_STAA8 DNA gyrase subunit A OS=Staphylococcus aureus (strain NCTC 8325) GN=gyrA PE=1 SV=1 771 937 2.0E-10
sp|Q9ZE79|PARC_RICPR DNA topoisomerase 4 subunit A OS=Rickettsia prowazekii (strain Madrid E) GN=parC PE=3 SV=1 748 926 2.0E-10
sp|Q5HJZ0|GYRA_STAAC DNA gyrase subunit A OS=Staphylococcus aureus (strain COL) GN=gyrA PE=3 SV=1 771 937 2.0E-10
sp|Q03470|GYRA_CAMJE DNA gyrase subunit A OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=gyrA PE=3 SV=1 745 1065 2.0E-10
sp|Q68XG2|GYRA_RICTY DNA gyrase subunit A OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=gyrA PE=3 SV=1 771 932 2.0E-10
sp|O33926|GYRA_THEMA DNA gyrase subunit A OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=gyrA PE=3 SV=2 752 926 3.0E-10
sp|Q18GY3|GYRA_HALWD DNA gyrase subunit A OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=gyrA PE=3 SV=1 771 1029 3.0E-10
sp|Q44274|GYRB_ACIGI DNA gyrase subunit B (Fragment) OS=Acinetobacter guillouiae GN=gyrB PE=3 SV=2 218 607 3.0E-10
sp|Q0BST5|GYRA_GRABC DNA gyrase subunit A OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=gyrA PE=3 SV=1 748 932 3.0E-10
sp|Q932M0|GYRA_STAAM DNA gyrase subunit A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=gyrA PE=3 SV=1 771 948 3.0E-10
sp|Q2FKQ0|GYRA_STAA3 DNA gyrase subunit A OS=Staphylococcus aureus (strain USA300) GN=gyrA PE=3 SV=1 771 937 4.0E-10
sp|Q6GKT9|GYRA_STAAR DNA gyrase subunit A OS=Staphylococcus aureus (strain MRSA252) GN=gyrA PE=3 SV=1 771 948 4.0E-10
sp|Q92IZ6|GYRA_RICCN DNA gyrase subunit A OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=gyrA PE=3 SV=1 771 932 5.0E-10
sp|Q1RID9|GYRA_RICBR DNA gyrase subunit A OS=Rickettsia bellii (strain RML369-C) GN=gyrA PE=3 SV=1 771 1100 6.0E-10
sp|Q44065|GYRB_ACIHA DNA gyrase subunit B (Fragment) OS=Acinetobacter haemolyticus GN=gyrB PE=3 SV=2 218 606 7.0E-10
sp|P77966|GYRB_SYNY3 DNA gyrase subunit B OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gyrB PE=3 SV=1 105 454 1.0E-09
sp|P75352|PARC_MYCPN DNA topoisomerase 4 subunit A OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=parC PE=3 SV=1 771 1028 1.0E-09
sp|P43702|PARC_HAEIN DNA topoisomerase 4 subunit A OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=parC PE=3 SV=1 748 926 1.0E-09
sp|D8K235|GYRA_DEHLB DNA gyrase subunit A OS=Dehalogenimonas lykanthroporepellens (strain ATCC BAA-1523 / JCM 15061 / BL-DC-9) GN=gyrA PE=3 SV=1 771 942 1.0E-09
sp|P35885|GYRA_STRCO DNA gyrase subunit A OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=gyrA PE=3 SV=2 741 926 1.0E-09
sp|Q44080|GYRB_ACIJU DNA gyrase subunit B (Fragment) OS=Acinetobacter junii GN=gyrB PE=3 SV=2 218 606 4.0E-09
sp|P48354|GYRA_MYCS2 DNA gyrase subunit A OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=gyrA PE=3 SV=1 748 1116 4.0E-09
sp|Q43907|GYRB_ACIBA DNA gyrase subunit B (Fragment) OS=Acinetobacter baumannii GN=gyrB PE=3 SV=2 218 606 6.0E-09
sp|P05653|GYRA_BACSU DNA gyrase subunit A OS=Bacillus subtilis (strain 168) GN=gyrA PE=1 SV=1 748 934 2.0E-08
sp|Q8P116|GYRA_STRP8 DNA gyrase subunit A OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=gyrA PE=3 SV=1 745 1089 2.0E-08
sp|Q44081|GYRB_ACIJO DNA gyrase subunit B (Fragment) OS=Acinetobacter johnsonii GN=gyrB PE=3 SV=2 218 607 2.0E-08
sp|P22446|GYRA_MYCPN DNA gyrase subunit A OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=gyrA PE=1 SV=2 748 939 2.0E-08
sp|P47235|GYRA_CAMFE DNA gyrase subunit A OS=Campylobacter fetus GN=gyrA PE=3 SV=1 745 972 2.0E-08
sp|Q9L7Q5|GYRA_STRP1 DNA gyrase subunit A OS=Streptococcus pyogenes serotype M1 GN=gyrA PE=3 SV=1 745 1079 2.0E-08
sp|Q5XC58|GYRA_STRP6 DNA gyrase subunit A OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=gyrA PE=3 SV=1 745 1079 2.0E-08
sp|P0DG03|GYRA_STRPQ DNA gyrase subunit A OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=gyrA PE=3 SV=1 745 1079 3.0E-08
sp|P0DG02|GYRA_STRP3 DNA gyrase subunit A OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=gyrA PE=3 SV=1 745 1079 3.0E-08
sp|P48369|GYRA_AERSA DNA gyrase subunit A OS=Aeromonas salmonicida GN=gyrA PE=3 SV=1 771 940 3.0E-08
sp|P57277|GYRA_BUCAI DNA gyrase subunit A OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=gyrA PE=3 SV=1 747 926 3.0E-08
sp|Q55738|GYRA_SYNY3 DNA gyrase subunit A OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gyrA PE=3 SV=1 771 1029 6.0E-08
sp|P35810|GYRA_FIBSS DNA gyrase subunit A OS=Fibrobacter succinogenes (strain ATCC 19169 / S85) GN=gyrA PE=3 SV=2 749 926 7.0E-08
sp|Q5XCJ9|PARC_STRP6 DNA topoisomerase 4 subunit A OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=parC PE=3 SV=2 753 939 9.0E-08
sp|P48372|GYRA_PSEAE DNA gyrase subunit A OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gyrA PE=3 SV=1 771 939 9.0E-08
sp|Q89AS3|GYRA_BUCBP DNA gyrase subunit A OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=gyrA PE=3 SV=1 771 940 1.0E-07
sp|P41513|GYRA_PECCA DNA gyrase subunit A OS=Pectobacterium carotovorum GN=gyrA PE=3 SV=1 771 961 1.0E-07
sp|P22840|GYRB_PROMI DNA gyrase subunit B (Fragment) OS=Proteus mirabilis GN=gyrB PE=3 SV=1 145 257 1.0E-07
sp|Q9CAF6|GYRA_ARATH Probable DNA gyrase subunit A, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=GYRA PE=1 SV=2 771 1096 1.0E-07
sp|Q1MQ89|GYRA_LAWIP DNA gyrase subunit A OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=gyrA PE=3 SV=1 771 926 2.0E-07
sp|Q44271|GYRB_ACIG6 DNA gyrase subunit B (Fragment) OS=Acinetobacter genomosp. 6 GN=gyrB PE=3 SV=2 218 606 2.0E-07
sp|Q9L7Q4|PARC_STRP1 DNA topoisomerase 4 subunit A OS=Streptococcus pyogenes serotype M1 GN=parC PE=3 SV=1 753 939 2.0E-07
sp|P0DG06|PARC_STRP3 DNA topoisomerase 4 subunit A OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=parC PE=3 SV=1 753 939 2.0E-07
sp|P0AFI4|PARC_SHIFL DNA topoisomerase 4 subunit A OS=Shigella flexneri GN=parC PE=3 SV=1 749 926 2.0E-07
sp|P0AFI2|PARC_ECOLI DNA topoisomerase 4 subunit A OS=Escherichia coli (strain K12) GN=parC PE=1 SV=1 749 926 2.0E-07
sp|P0AFI3|PARC_ECO57 DNA topoisomerase 4 subunit A OS=Escherichia coli O157:H7 GN=parC PE=3 SV=1 749 926 2.0E-07
sp|Q8P1B3|PARC_STRP8 DNA topoisomerase 4 subunit A OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=parC PE=3 SV=1 753 939 3.0E-07
sp|P26973|PARC_SALTY DNA topoisomerase 4 subunit A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=parC PE=3 SV=2 749 926 4.0E-07
sp|Q44270|GYRB_ACIPI DNA gyrase subunit B (Fragment) OS=Acinetobacter pittii GN=gyrB PE=3 SV=2 218 606 4.0E-07
sp|P0DG07|PARC_STRPQ DNA topoisomerase 4 subunit A OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=parC PE=3 SV=1 753 939 5.0E-07
sp|Q9HUK1|PARC_PSEAE DNA topoisomerase 4 subunit A OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=parC PE=3 SV=1 744 1116 6.0E-07
sp|P14829|GYRA_KLEOX DNA gyrase subunit A OS=Klebsiella oxytoca GN=gyrA PE=3 SV=1 771 926 7.0E-07
sp|Q45066|PARC_BACSU DNA topoisomerase 4 subunit A OS=Bacillus subtilis (strain 168) GN=parC PE=3 SV=2 739 923 7.0E-07
sp|Q5HG64|PARC_STAAC DNA topoisomerase 4 subunit A OS=Staphylococcus aureus (strain COL) GN=parC PE=3 SV=1 753 932 9.0E-07
sp|Q2FYS4|PARC_STAA8 DNA topoisomerase 4 subunit A OS=Staphylococcus aureus (strain NCTC 8325) GN=parC PE=1 SV=1 753 932 9.0E-07
sp|Q6G9K4|PARC_STAAS DNA topoisomerase 4 subunit A OS=Staphylococcus aureus (strain MSSA476) GN=parC PE=1 SV=1 753 932 9.0E-07
sp|Q93KF4|PARC_STAAN DNA topoisomerase 4 subunit A OS=Staphylococcus aureus (strain N315) GN=parC PE=1 SV=1 753 932 9.0E-07
sp|Q8NWU8|PARC_STAAW DNA topoisomerase 4 subunit A OS=Staphylococcus aureus (strain MW2) GN=parC PE=3 SV=1 753 932 1.0E-06
sp|B3PN30|GYRA_MYCA5 DNA gyrase subunit A OS=Mycoplasma arthritidis (strain 158L3-1) GN=gyrA PE=3 SV=1 771 942 1.0E-06
sp|Q8CSN8|PARC_STAES DNA topoisomerase 4 subunit A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=parC PE=3 SV=1 753 932 1.0E-06
sp|Q5HPI5|PARC_STAEQ DNA topoisomerase 4 subunit A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=parC PE=3 SV=1 753 932 1.0E-06
sp|Q6GH50|PARC_STAAR DNA topoisomerase 4 subunit A OS=Staphylococcus aureus (strain MRSA252) GN=parC PE=3 SV=1 753 932 1.0E-06
sp|P72525|PARC_STRPN DNA topoisomerase 4 subunit A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=parC PE=1 SV=3 771 932 2.0E-06
sp|Q931S2|PARC_STAAM DNA topoisomerase 4 subunit A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=parC PE=3 SV=1 753 932 2.0E-06
sp|P23992|TOPS_BPT4 DNA topoisomerase small subunit OS=Enterobacteria phage T4 GN=60 PE=1 SV=1 598 737 2.0E-06
sp|Q43947|GYRB_ACICA DNA gyrase subunit B (Fragment) OS=Acinetobacter calcoaceticus GN=gyrB PE=3 SV=2 218 606 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0003918 DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity Yes
GO:0003677 DNA binding Yes
GO:0006265 DNA topological change Yes
GO:0036094 small molecule binding No
GO:0032555 purine ribonucleotide binding No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0016853 isomerase activity No
GO:0044238 primary metabolic process No
GO:0071840 cellular component organization or biogenesis No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0006807 nitrogen compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0000166 nucleotide binding No
GO:0003676 nucleic acid binding No
GO:0051276 chromosome organization No
GO:0008152 metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0006996 organelle organization No
GO:0030554 adenyl nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0016043 cellular component organization No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0017076 purine nucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0006259 DNA metabolic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0003916 DNA topoisomerase activity No
GO:0043168 anion binding No
GO:0071704 organic substance metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0140097 catalytic activity, acting on DNA No
GO:0009987 cellular process No
GO:0140657 ATP-dependent activity No
GO:0071103 DNA conformation change No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|008670
MSSGGENFNFEDLSGSDFEEDYAPAKKRTVAKQKAAPKAAKPKASTSKAVTKPKTIKKVLVEHDENADDLDADED
ISDADASSKKSGMSKKKTVSETYTKLSQHEHILKRPDSYIGSIETITQPMWTFDAGSKRMVQRDVKYVPGFLKIV
DEILVNAADNKINDTSMDTIKVNIDVEENTISVYNNGRGIPVEIHSKEKIYIPELIFGHLLSSSNYDDDEKKLTG
GRNGYGAKLANIYSHEFTVETADKNTDQKYKQIWTENMTNCGKAKITKNSKGEEWTRITFKPDLQRFGMDSIDED
TASLLRKRVYDVAGTVRDVKVYLNDERLKIKNFKQYVEMYVDSVQAEAAEASGGAAQPKSQVIYERLSERWEIAF
TVSDGSFQHVAFANSISTIKGGTHVNYIADHLSKHIMTAVSKKNKGAPVKPFQIRNHMWLFVNALIENPMFDGQT
KETLTLPSSKFGSKPTIKEDFIKKVLKTAIVDNVLHWAKAKADQQIKKTDGSKRNRLVGLTKLSDANNAGTRLAK
DCTLILTEGDSAKALAVAGLGVVGRDYFGVFPLRGKLLNVREAKHDQIMKNEEIQNIKKILGLQHNKDYSDVSSL
RYGRLMIMADQDHDGSHIKGLLINFFDHFYPSLLKLPEFLVEFVTPIVRIIKGKHRRDFFTLPEYEKWLLEAPDA
HKWESKYYKGLGTSNDADARDYFSHMAKHMIPFAPTQHGDRDLIDLAFSKKKADDRKEWLRQFRPGTFLDHNLEE
IPYSEFINKELICFSMADNIRSIPCVADGLKPGQRKVIWSCFKRKLKKEIKVAQLVGYISEHAAYHHGEASLAQT
IINLAQDFVGSNNVNLLSPNGQYGTRDQGGKDHASPRYIFTEPKAMTRVVYHPDDDPLLKGQREDNQWIEPEFYL
PVIPLVLCNGAEGIGTGWSTNIPCFNPAVIVENIRRLMNGEEQVAMKPWWRGFKGEIIATAKHKYDVHGVIHKLD
DTTVEITELPIHRWTQNYKADLEAMIAGGENKEGVIKDYKEHHDNANVHFVISMSAKDLEKAEEQGLREFFKLTS
KLTTSNMICFDFEGKIKRYESPEQIIEDFYPVRLAYYQKRKDYLAGELQDSLDKLNNQARFVNMIVDKKLVVSGR
RKADIVADLRKLDFKPIPKVSKAKSTQQEENDEDEEQEEAGADSDFDYMLGMAIWSLTKEKIDRLLQQAGDKEAE
LLILLEKTPIDLWNKDLDDFLVEWENDCQDWEARKFAKGGKGKKKQTKLKTRKSIGGGGGNDDSDDDFRPVKAPA
RKKADDEAKKPRARKVIAAAKELFKDSGSDKDTDPKMSEGNEDLDYADFNGSGHSKASSNGRGKANGKKKEKAFE
VDEDSEEEIIKPAKSKPRTKAITTASAPEKGDDVEMERAKGKSKARGQAKAIETLELESDDDFIMTKTVVAKSKG
KRKSHDDDEDDTSPATKKKKTDITDFFGKKADARAKKSAGAVQPRKVSKSMKPASPMAKAKRANGTKKKIVIDSD
EEGDGDDAEFDDLPKPPARNAPGRGAASKRKYVELSSEEDGDDSMFVDE*
Coding >Agabi119p4|008670
ATGAGTTCGGGAGGTGAAAACTTCAATTTTGAGGATCTATCTGGCTCCGACTTTGAGGAAGACTACGCCCCTGCG
AAGAAGAGGACCGTGGCCAAGCAAAAAGCCGCCCCAAAGGCCGCGAAACCCAAGGCCTCCACCAGCAAGGCTGTG
ACCAAACCAAAGACCATTAAGAAGGTATTAGTCGAACACGACGAAAATGCAGATGATTTGGACGCGGACGAGGAT
ATTTCTGACGCGGACGCGTCTTCCAAGAAATCAGGCATGTCTAAGAAGAAGACAGTATCTGAAACCTATACCAAA
CTTTCGCAACATGAGCATATCTTGAAACGTCCTGATTCATACATTGGAAGTATCGAGACGATTACTCAACCGATG
TGGACATTCGATGCCGGCAGCAAACGAATGGTGCAACGCGATGTTAAGTATGTGCCAGGTTTCTTGAAGATTGTG
GACGAAATTCTTGTCAATGCTGCTGACAACAAGATCAACGACACCAGCATGGATACCATCAAAGTCAACATTGAC
GTCGAGGAAAACACAATTTCAGTGTACAACAATGGTCGCGGAATTCCCGTCGAGATTCACTCCAAAGAAAAAATA
TATATCCCTGAACTCATTTTCGGACATCTCCTGTCCTCTTCCAACTACGACGATGACGAGAAAAAACTCACCGGT
GGTCGTAACGGTTATGGAGCCAAACTTGCCAACATCTATTCTCACGAATTTACGGTGGAAACCGCAGACAAGAAT
ACGGACCAGAAATACAAACAGATATGGACAGAGAATATGACAAATTGTGGTAAAGCAAAGATTACAAAAAACTCC
AAGGGCGAGGAGTGGACCAGGATCACGTTCAAACCGGATTTGCAGCGGTTTGGGATGGATAGCATAGACGAGGAT
ACTGCCAGTCTCTTACGCAAGCGCGTTTACGACGTGGCTGGTACAGTCAGGGACGTTAAGGTTTACCTCAACGAC
GAGCGCCTGAAAATCAAAAACTTCAAGCAATATGTCGAAATGTATGTGGATTCTGTGCAAGCGGAGGCGGCGGAG
GCCAGTGGCGGGGCAGCCCAACCCAAGAGTCAGGTCATTTATGAGCGCCTCAGTGAGCGTTGGGAGATCGCATTT
ACGGTTTCAGATGGATCCTTCCAGCATGTCGCCTTTGCAAACTCAATATCAACAATCAAGGGCGGCACCCATGTT
AACTATATCGCGGACCATCTCTCCAAGCACATCATGACGGCCGTGAGCAAGAAGAACAAGGGTGCTCCTGTCAAA
CCATTTCAAATTCGCAATCACATGTGGTTGTTTGTCAATGCTCTGATTGAAAATCCCATGTTCGATGGCCAGACG
AAGGAGACGTTGACGCTACCTTCGTCGAAGTTCGGAAGTAAACCCACAATCAAGGAAGACTTTATCAAGAAAGTC
CTGAAAACCGCTATAGTCGACAATGTTCTGCACTGGGCTAAGGCTAAGGCAGATCAGCAGATCAAGAAAACGGAC
GGGAGCAAGCGAAACCGCCTCGTTGGATTGACTAAACTTTCCGATGCCAACAATGCGGGTACACGCCTCGCGAAG
GATTGCACTCTGATTTTGACAGAAGGTGACTCGGCCAAAGCACTTGCTGTTGCTGGGCTAGGTGTTGTTGGGCGT
GATTATTTTGGTGTTTTCCCACTTCGCGGAAAGCTTTTGAATGTACGGGAAGCGAAACATGATCAGATCATGAAG
AATGAGGAGATTCAAAATATCAAAAAAATTCTTGGCCTGCAGCATAATAAGGATTACTCTGATGTCTCGAGCCTT
CGTTATGGACGCCTCATGATAATGGCCGATCAAGATCATGATGGTTCACACATTAAAGGCCTACTCATCAATTTT
TTTGATCATTTTTACCCCTCGCTTCTGAAATTACCTGAGTTTCTTGTTGAATTCGTTACTCCCATCGTGCGGATC
ATCAAAGGAAAGCACAGGCGGGATTTCTTCACTCTACCTGAATATGAAAAATGGTTACTTGAAGCACCGGATGCG
CATAAATGGGAGTCGAAATACTACAAGGGTCTTGGAACAAGCAACGATGCAGATGCTAGGGACTACTTTAGTCAT
ATGGCGAAACACATGATTCCTTTCGCGCCAACACAACATGGCGACAGAGATCTCATTGATCTTGCCTTCAGTAAG
AAGAAAGCAGATGACCGAAAGGAATGGTTACGCCAGTTCAGACCTGGCACTTTTTTGGACCATAATCTTGAAGAA
ATCCCATATTCTGAGTTCATCAACAAGGAACTCATTTGCTTTTCGATGGCAGACAATATCCGTTCCATCCCTTGC
GTTGCTGATGGCCTGAAACCTGGTCAACGTAAAGTCATATGGTCTTGTTTCAAGCGTAAGCTCAAGAAGGAAATC
AAGGTTGCACAACTCGTTGGGTATATCTCAGAACACGCCGCATACCACCATGGCGAGGCTTCACTTGCACAAACC
ATTATCAACTTGGCGCAAGATTTTGTGGGAAGTAACAATGTCAATCTTCTCTCGCCCAACGGTCAGTACGGTACT
CGTGACCAAGGAGGGAAGGACCATGCCTCGCCCAGGTATATCTTTACAGAGCCAAAAGCAATGACGAGGGTCGTG
TATCACCCAGATGATGACCCGTTGTTGAAAGGCCAGAGGGAGGATAACCAATGGATTGAACCAGAATTCTATCTG
CCTGTCATTCCTCTCGTCTTATGCAATGGTGCTGAGGGTATTGGCACCGGCTGGAGTACGAACATCCCTTGCTTT
AATCCGGCTGTCATTGTTGAGAACATTCGTCGTCTCATGAACGGCGAGGAACAAGTCGCAATGAAGCCCTGGTGG
CGAGGGTTTAAAGGCGAGATTATAGCGACGGCGAAGCATAAGTATGATGTCCACGGAGTCATTCACAAGCTGGAT
GATACGACGGTTGAGATTACAGAGCTACCAATCCATAGATGGACACAAAATTACAAGGCAGATTTGGAGGCCATG
ATAGCTGGCGGTGAGAACAAGGAAGGGGTCATCAAGGACTACAAAGAGCACCATGACAATGCTAATGTTCATTTC
GTGATCAGTATGTCAGCCAAGGATTTGGAAAAGGCCGAGGAGCAGGGCCTTCGGGAATTCTTCAAACTCACGTCG
AAATTGACAACAAGCAATATGATTTGCTTCGACTTCGAGGGCAAGATCAAGAGGTATGAGTCACCAGAACAGATC
ATAGAGGATTTCTACCCTGTTCGACTGGCATATTATCAAAAACGCAAGGATTACCTGGCCGGAGAATTGCAAGAT
TCCCTCGACAAACTTAACAACCAAGCTCGTTTTGTAAATATGATAGTGGACAAGAAACTCGTCGTATCCGGTCGC
CGCAAAGCTGATATTGTAGCAGATCTAAGGAAGCTTGACTTCAAACCGATCCCCAAAGTATCAAAAGCCAAGAGT
ACGCAGCAAGAAGAAAATGACGAAGACGAGGAGCAAGAGGAAGCTGGCGCGGATAGTGATTTTGACTATATGCTT
GGAATGGCTATCTGGAGCTTGACCAAAGAAAAGATCGACAGATTATTACAACAAGCTGGGGACAAGGAGGCTGAG
CTGCTTATACTGCTTGAGAAAACACCGATTGACTTGTGGAACAAAGACCTTGACGACTTCTTGGTCGAGTGGGAG
AACGACTGCCAGGACTGGGAGGCTAGGAAATTTGCTAAGGGCGGCAAGGGAAAAAAGAAGCAAACAAAGCTGAAG
ACAAGGAAGTCAATTGGTGGGGGTGGGGGTAATGACGACTCGGATGACGACTTTAGACCGGTCAAGGCTCCGGCA
AGGAAAAAAGCAGATGACGAGGCAAAGAAACCGCGGGCTAGGAAGGTTATCGCTGCGGCAAAAGAATTGTTCAAG
GACTCGGGTTCCGACAAGGATACTGATCCGAAGATGAGTGAGGGCAATGAAGATCTAGATTACGCCGATTTCAAC
GGGAGTGGACACTCTAAAGCCAGCAGTAACGGGAGAGGGAAAGCAAATGGAAAGAAAAAGGAAAAGGCTTTTGAA
GTAGATGAGGATAGTGAAGAAGAAATAATCAAGCCGGCAAAATCGAAGCCACGGACTAAAGCAATCACGACCGCC
TCTGCACCAGAGAAGGGAGATGACGTCGAAATGGAGCGTGCAAAGGGGAAGTCCAAGGCTCGGGGTCAGGCAAAG
GCGATTGAAACGCTTGAACTTGAAAGTGATGACGACTTCATCATGACGAAGACAGTAGTGGCAAAATCCAAAGGC
AAGCGTAAAAGCCATGATGATGATGAAGATGATACTTCGCCAGCTACAAAGAAGAAGAAAACAGATATAACCGAC
TTCTTTGGCAAGAAGGCAGACGCCCGGGCGAAAAAAAGTGCAGGAGCTGTGCAGCCTCGGAAAGTGTCGAAGAGC
ATGAAGCCAGCCTCACCGATGGCTAAAGCGAAAAGGGCAAATGGGACAAAGAAGAAGATCGTGATAGATTCGGAC
GAGGAGGGAGACGGTGATGATGCGGAGTTTGACGATCTGCCAAAGCCACCGGCCCGCAATGCGCCCGGGCGTGGG
GCGGCATCGAAGAGGAAGTATGTGGAGCTGAGCTCGGAAGAGGATGGAGACGACAGCATGTTTGTAGACGAGTAG
Transcript >Agabi119p4|008670
ATGAGTTCGGGAGGTGAAAACTTCAATTTTGAGGATCTATCTGGCTCCGACTTTGAGGAAGACTACGCCCCTGCG
AAGAAGAGGACCGTGGCCAAGCAAAAAGCCGCCCCAAAGGCCGCGAAACCCAAGGCCTCCACCAGCAAGGCTGTG
ACCAAACCAAAGACCATTAAGAAGGTATTAGTCGAACACGACGAAAATGCAGATGATTTGGACGCGGACGAGGAT
ATTTCTGACGCGGACGCGTCTTCCAAGAAATCAGGCATGTCTAAGAAGAAGACAGTATCTGAAACCTATACCAAA
CTTTCGCAACATGAGCATATCTTGAAACGTCCTGATTCATACATTGGAAGTATCGAGACGATTACTCAACCGATG
TGGACATTCGATGCCGGCAGCAAACGAATGGTGCAACGCGATGTTAAGTATGTGCCAGGTTTCTTGAAGATTGTG
GACGAAATTCTTGTCAATGCTGCTGACAACAAGATCAACGACACCAGCATGGATACCATCAAAGTCAACATTGAC
GTCGAGGAAAACACAATTTCAGTGTACAACAATGGTCGCGGAATTCCCGTCGAGATTCACTCCAAAGAAAAAATA
TATATCCCTGAACTCATTTTCGGACATCTCCTGTCCTCTTCCAACTACGACGATGACGAGAAAAAACTCACCGGT
GGTCGTAACGGTTATGGAGCCAAACTTGCCAACATCTATTCTCACGAATTTACGGTGGAAACCGCAGACAAGAAT
ACGGACCAGAAATACAAACAGATATGGACAGAGAATATGACAAATTGTGGTAAAGCAAAGATTACAAAAAACTCC
AAGGGCGAGGAGTGGACCAGGATCACGTTCAAACCGGATTTGCAGCGGTTTGGGATGGATAGCATAGACGAGGAT
ACTGCCAGTCTCTTACGCAAGCGCGTTTACGACGTGGCTGGTACAGTCAGGGACGTTAAGGTTTACCTCAACGAC
GAGCGCCTGAAAATCAAAAACTTCAAGCAATATGTCGAAATGTATGTGGATTCTGTGCAAGCGGAGGCGGCGGAG
GCCAGTGGCGGGGCAGCCCAACCCAAGAGTCAGGTCATTTATGAGCGCCTCAGTGAGCGTTGGGAGATCGCATTT
ACGGTTTCAGATGGATCCTTCCAGCATGTCGCCTTTGCAAACTCAATATCAACAATCAAGGGCGGCACCCATGTT
AACTATATCGCGGACCATCTCTCCAAGCACATCATGACGGCCGTGAGCAAGAAGAACAAGGGTGCTCCTGTCAAA
CCATTTCAAATTCGCAATCACATGTGGTTGTTTGTCAATGCTCTGATTGAAAATCCCATGTTCGATGGCCAGACG
AAGGAGACGTTGACGCTACCTTCGTCGAAGTTCGGAAGTAAACCCACAATCAAGGAAGACTTTATCAAGAAAGTC
CTGAAAACCGCTATAGTCGACAATGTTCTGCACTGGGCTAAGGCTAAGGCAGATCAGCAGATCAAGAAAACGGAC
GGGAGCAAGCGAAACCGCCTCGTTGGATTGACTAAACTTTCCGATGCCAACAATGCGGGTACACGCCTCGCGAAG
GATTGCACTCTGATTTTGACAGAAGGTGACTCGGCCAAAGCACTTGCTGTTGCTGGGCTAGGTGTTGTTGGGCGT
GATTATTTTGGTGTTTTCCCACTTCGCGGAAAGCTTTTGAATGTACGGGAAGCGAAACATGATCAGATCATGAAG
AATGAGGAGATTCAAAATATCAAAAAAATTCTTGGCCTGCAGCATAATAAGGATTACTCTGATGTCTCGAGCCTT
CGTTATGGACGCCTCATGATAATGGCCGATCAAGATCATGATGGTTCACACATTAAAGGCCTACTCATCAATTTT
TTTGATCATTTTTACCCCTCGCTTCTGAAATTACCTGAGTTTCTTGTTGAATTCGTTACTCCCATCGTGCGGATC
ATCAAAGGAAAGCACAGGCGGGATTTCTTCACTCTACCTGAATATGAAAAATGGTTACTTGAAGCACCGGATGCG
CATAAATGGGAGTCGAAATACTACAAGGGTCTTGGAACAAGCAACGATGCAGATGCTAGGGACTACTTTAGTCAT
ATGGCGAAACACATGATTCCTTTCGCGCCAACACAACATGGCGACAGAGATCTCATTGATCTTGCCTTCAGTAAG
AAGAAAGCAGATGACCGAAAGGAATGGTTACGCCAGTTCAGACCTGGCACTTTTTTGGACCATAATCTTGAAGAA
ATCCCATATTCTGAGTTCATCAACAAGGAACTCATTTGCTTTTCGATGGCAGACAATATCCGTTCCATCCCTTGC
GTTGCTGATGGCCTGAAACCTGGTCAACGTAAAGTCATATGGTCTTGTTTCAAGCGTAAGCTCAAGAAGGAAATC
AAGGTTGCACAACTCGTTGGGTATATCTCAGAACACGCCGCATACCACCATGGCGAGGCTTCACTTGCACAAACC
ATTATCAACTTGGCGCAAGATTTTGTGGGAAGTAACAATGTCAATCTTCTCTCGCCCAACGGTCAGTACGGTACT
CGTGACCAAGGAGGGAAGGACCATGCCTCGCCCAGGTATATCTTTACAGAGCCAAAAGCAATGACGAGGGTCGTG
TATCACCCAGATGATGACCCGTTGTTGAAAGGCCAGAGGGAGGATAACCAATGGATTGAACCAGAATTCTATCTG
CCTGTCATTCCTCTCGTCTTATGCAATGGTGCTGAGGGTATTGGCACCGGCTGGAGTACGAACATCCCTTGCTTT
AATCCGGCTGTCATTGTTGAGAACATTCGTCGTCTCATGAACGGCGAGGAACAAGTCGCAATGAAGCCCTGGTGG
CGAGGGTTTAAAGGCGAGATTATAGCGACGGCGAAGCATAAGTATGATGTCCACGGAGTCATTCACAAGCTGGAT
GATACGACGGTTGAGATTACAGAGCTACCAATCCATAGATGGACACAAAATTACAAGGCAGATTTGGAGGCCATG
ATAGCTGGCGGTGAGAACAAGGAAGGGGTCATCAAGGACTACAAAGAGCACCATGACAATGCTAATGTTCATTTC
GTGATCAGTATGTCAGCCAAGGATTTGGAAAAGGCCGAGGAGCAGGGCCTTCGGGAATTCTTCAAACTCACGTCG
AAATTGACAACAAGCAATATGATTTGCTTCGACTTCGAGGGCAAGATCAAGAGGTATGAGTCACCAGAACAGATC
ATAGAGGATTTCTACCCTGTTCGACTGGCATATTATCAAAAACGCAAGGATTACCTGGCCGGAGAATTGCAAGAT
TCCCTCGACAAACTTAACAACCAAGCTCGTTTTGTAAATATGATAGTGGACAAGAAACTCGTCGTATCCGGTCGC
CGCAAAGCTGATATTGTAGCAGATCTAAGGAAGCTTGACTTCAAACCGATCCCCAAAGTATCAAAAGCCAAGAGT
ACGCAGCAAGAAGAAAATGACGAAGACGAGGAGCAAGAGGAAGCTGGCGCGGATAGTGATTTTGACTATATGCTT
GGAATGGCTATCTGGAGCTTGACCAAAGAAAAGATCGACAGATTATTACAACAAGCTGGGGACAAGGAGGCTGAG
CTGCTTATACTGCTTGAGAAAACACCGATTGACTTGTGGAACAAAGACCTTGACGACTTCTTGGTCGAGTGGGAG
AACGACTGCCAGGACTGGGAGGCTAGGAAATTTGCTAAGGGCGGCAAGGGAAAAAAGAAGCAAACAAAGCTGAAG
ACAAGGAAGTCAATTGGTGGGGGTGGGGGTAATGACGACTCGGATGACGACTTTAGACCGGTCAAGGCTCCGGCA
AGGAAAAAAGCAGATGACGAGGCAAAGAAACCGCGGGCTAGGAAGGTTATCGCTGCGGCAAAAGAATTGTTCAAG
GACTCGGGTTCCGACAAGGATACTGATCCGAAGATGAGTGAGGGCAATGAAGATCTAGATTACGCCGATTTCAAC
GGGAGTGGACACTCTAAAGCCAGCAGTAACGGGAGAGGGAAAGCAAATGGAAAGAAAAAGGAAAAGGCTTTTGAA
GTAGATGAGGATAGTGAAGAAGAAATAATCAAGCCGGCAAAATCGAAGCCACGGACTAAAGCAATCACGACCGCC
TCTGCACCAGAGAAGGGAGATGACGTCGAAATGGAGCGTGCAAAGGGGAAGTCCAAGGCTCGGGGTCAGGCAAAG
GCGATTGAAACGCTTGAACTTGAAAGTGATGACGACTTCATCATGACGAAGACAGTAGTGGCAAAATCCAAAGGC
AAGCGTAAAAGCCATGATGATGATGAAGATGATACTTCGCCAGCTACAAAGAAGAAGAAAACAGATATAACCGAC
TTCTTTGGCAAGAAGGCAGACGCCCGGGCGAAAAAAAGTGCAGGAGCTGTGCAGCCTCGGAAAGTGTCGAAGAGC
ATGAAGCCAGCCTCACCGATGGCTAAAGCGAAAAGGGCAAATGGGACAAAGAAGAAGATCGTGATAGATTCGGAC
GAGGAGGGAGACGGTGATGATGCGGAGTTTGACGATCTGCCAAAGCCACCGGCCCGCAATGCGCCCGGGCGTGGG
GCGGCATCGAAGAGGAAGTATGTGGAGCTGAGCTCGGAAGAGGATGGAGACGACAGCATGTTTGTAGACGAGTAG
Gene >Agabi119p4|008670
ATGAGTTCGGGAGGTGAAAACTTCAATTTTGAGGATCTATCTGGCTCCGACTTTGAGGAAGACTACGCCCCTGCG
AAGAAGGTAGGAGTTGAATGTTTGCATACCGTGTGTCTCTAAATACTTCAAAAGAGGACCGTGGCCAAGCAAAAA
GCCGCCCCAAAGGCCGCGAAACCCAAGGCCTCCACCAGCAAGGCTGTGACCAAACCAAAGACCATTAAGAAGGTA
TTAGTCGAACACGACGAAAATGCAGATGATTTGGACGCGGACGAGGATATTTCTGACGCGGACGCGTCTTCCAAG
AAATCAGGCATGTCTAAGAAGAAGACAGTATCTGAAACCTATACCAAAGTGTGTGATCCAAATTCGTTATCGTAT
CCAACCTCAAGATACACAATACATATAGCTTTCGCAACATGAGCATATCTTGAAACGTCCTGATTCATACATTGG
AAGTATCGAGACGATTACTCAACCGATGTGGACATTCGATGCCGGCAGCAAACGAATGGTGCAACGCGATGTTAA
GTATGTGCCAGGTTTCTTGAAGATTGTGGACGAAATTCTTGTCAATGCTGCTGACAACAAGGTGCGGATTCCTCT
TTTGAAGGTGAATTTTTTTCTTTTCGTACTCAAATTCGAGAATTAGATCAACGACACCAGCATGGATACCATCAA
AGTCAACATTGACGTCGAGGAAAACACAATTTCAGTGTACAACAATGGTCGCGGAATTCCCGTCGAGATTCACTC
CAAAGAAAAAATATATATCCCTGAACTCATTTTCGGACATCTCCTGTCCTCTTCCAACTACGACGATGACGAGAA
AAAACTCACCGGTGGTCGTAACGGTTATGGAGCCAAACTTGCCAACATCTATTCTCACGAATTTACGGTGGAAAC
CGCAGACAAGAATACGGACCAGAAATACAAACAGATATGGACAGAGAATATGACAAATTGTGGTAAAGCAAAGAT
TACAAAAAACTCCAAGGGCGAGGAGTGGACCAGGATCACGTTCAAACCGGATTTGCAGCGGTTTGGGATGGATAG
CATAGACGAGGATACTGCCAGTCTCTTACGCAAGCGCGTTTACGACGTGGCTGGTACAGTCAGGGACGTTAAGGT
TTACCTCAACGACGAGCGCCTGAAAATCAAAAACTTCAAGCAATATGTCGAAATGTATGTGGATTCTGTGCAAGC
GGAGGCGGCGGAGGCCAGTGGCGGGGCAGCCCAACCCAAGAGTCAGGTCATTTATGAGCGCCTCAGTGAGCGTTG
GGAGATCGCATTTACGGTTTCAGATGGATCCTTCCAGCATGTCGCCTTTGCAAACTCAATATCAACAATCAAGGG
CGGCACCCATGTTAACTATATCGCGGACCATCTCTCCAAGCACATCATGACGGCCGTGAGCAAGAAGAACAAGGG
TGCTCCTGTCAAACCATTTCAAATTCGCAATCACATGTGGTTGTTTGTCAATGCTCTGATTGAAAATCCCATGTT
CGATGGCCAGACGAAGGAGACGTTGACGCTACCTTCGTCGAAGTTCGGAAGTAAACCCACAATCAAGGAAGACTT
TATCAAGAAAGGTAAGAAACATATTGTCCCTGTATTTGGATATTCACTGACGTTTTAATAGTCCTGAAAACCGCT
ATAGTCGACAATGTTCTGCACTGGGCTAAGGCTAAGGCAGATCAGCAGATCAAGAAAACGGACGGGAGCAAGCGA
AACCGGTCAGTATCTCATCTCATCTTCAGCGCAATCAAAGCTCATTAAATGTGTCCAGCCTCGTTGGATTGACTA
AACTTTCCGATGCCAACAATGCGGGTACACGCCTCGCGAAGGATTGCACTCTGATTTTGACAGAAGGTGACTCGG
CCAAAGCACTTGCTGTTGCTGGGCTAGGTGTTGTTGGGCGTGATTATTTTGGTGTTTTCCCACTTCGCGGAAAGC
TTTTGAATGTACGGGAAGCGAAACATGATCAGATCATGAAGAATGAGGAGATTCAAAATATCAAAAAAATTCTTG
GCCTGCAGCATAATAAGGATTACTCTGATGTCTCGAGCCTTCGTTATGGACGCCTCATGATAATGGCCGATCAAG
TAAGTGCCTCTTCAGGTGACCTTACAGATACTTCATATTTTGTGTAGGATCATGATGGTTCACACATTAAAGGCC
TACTCATCAATTTTTTTGATCATTTTTACCCCTCGCTTCTGAAATTACCTGAGTTTCTTGTTGAATTCGTTACTC
CCATCGTGCGGGTAGGTGTGTCATATCATTAATGTGACATAGTGAGAATCAACACCCTTCTTAGATCATCAAAGG
AAAGCACAGGCGGGATTTCTTCACTCTACCTGAATATGAAAAATGGTTACTTGAAGCACCGGATGCGCATAAATG
GGAGTCGAAATACTACAAGGTTAGTGATCTCTGAGACTTCTGAGTAAAGTATCAACATTATAGTAGGGTCTTGGA
ACAAGCAACGATGCAGATGCTAGGGACTACTTTAGTCATATGGCGAAACACATGATTCCTTTCGCGCCAACACAA
CATGGCGACAGAGATCTCATTGATCTTGCCTTCAGTAAGAAGAAAGCAGATGACCGAAAGGAATGGTTACGCCAG
TTCAGAGTGCGTTAAATGGTCTCTTTATTTATTTATAAAGGCTCAGAGTCCTCGTATTATTCAGCCTGGCACTTT
TTTGGACCATAATCTTGAAGAAATCCCATATTCTGAGTTCATCAACAAGGAACTCATTTGCTTTTCGATGGCAGA
CAATATCCGTTCCATCCCTTGCGTTGCTGATGGCCTGAAACCTGGTCAACGTAAAGTCATATGGTCTTGTTTCAA
GCGTAAGCTCAAGAAGGAAATCAAGGTACGAGTAGTTCTACCTTTCTGGATGGTGACTTAACCTTTCATCTTCTA
GGTTGCACAACTCGTTGGGTATATCTCAGAACACGCCGCATACCACCATGGCGAGGCTTCACTTGCACAAACCAT
TATCAACTTGGCGCAAGATTTTGTGGGAAGTAACAATGTCAATCTTCTCTCGCCCAACGGTCAGTACGGTACTCG
TGACCAAGGAGGGAAGGACCATGCCTCGCCCAGGTATATCTTTACAGAGCCAAAAGCAATGACGAGGGTCGTGTA
TCACCCAGATGATGACCCGTTGTTGAAAGGCCAGAGGGAGGATAACCAATGGATTGAACCAGAATTCTATCTGCC
TGTCATTCCTCTCGTCTTATGCAATGGTGCTGAGGGTATTGGCACCGGTGAGTATTTGATATCATGGTTGCAATA
TTCGGAGATTCAACAATCTTAGGCTGGAGTACGAACATCCCTTGCTTTAATCCGGCTGTCATTGTTGAGAACATT
CGTCGTCTCATGAACGGCGAGGAACAAGTCGCAATGAAGCCCTGGTGGCGAGGGTTTAAAGGCGAGATTATAGCG
ACGGCGAAGCATAAGTATGATGTCCACGGAGTCATTCACAAGCTGGATGATACGACGGTTGAGATTACAGAGCTA
CCAATCCATAGATGGACACAAAATTACAAGGCAGATTTGGAGGCCATGATAGCTGGCGGTGAGAACAAGGAAGGG
GTCATCAAGGTTTGTGTTTTCGTAAGGTAATCTTGTTGGTTCAACTGATGTCGGTTGCAGGACTACAAAGAGCAC
CATGACAATGCTAATGTTCATTTCGTGATCAGTATGTCAGCCAAGGATTTGGAAAAGGCCGAGGAGCAGGGCCTT
CGGGAATTCTTCAAACTCACGTCGAAATTGACAACAAGCAATATGATTTGCTTCGACTTCGAGGGCAAGATCAAG
AGGTATGAGTCACCAGAACAGATCATAGAGGATTTCTACCCTGTTCGACTGGCATATTATCAAAAACGCAAGGTA
ACAAAAGATTTTTTCCGCTTTTCGTGAGCAGCTGTAACCGAGTCCATATATAGGATTACCTGGCCGGAGAATTGC
AAGATTCCCTCGACAAACTTAACAACCAAGCTCGTTTTGTAAATATGATAGTGGACAAGAAACTCGTCGTATCCG
GTCGCCGCAAAGCTGATATTGTAGCAGATCTAAGGAAGCTTGACTTCAAACCGATCCCCAAAGTATCAAAAGCCA
AGAGTACGCAGCAAGAAGAAAATGACGAAGACGAGGAGCAAGAGGAAGCTGGCGCGGATAGTGATTTTGACTATA
TGCTTGGAATGGCTATCTGGAGCTTGACCAAAGAAAAGATCGACAGATTATTACAACAAGCTGGGGACAAGGAGG
CTGAGCTGCTTATACTGCTTGAGAAAACACCGATTGACTTGTGGAACAAAGACCTTGACGACTTCTTGGTCGAGT
GGGAGGTACGTTTCGGCGTGAGGTTCTGAATTTGTTAACTGAGCAAAGGTTTCATAGAACGACTGCCAGGACTGG
GAGGCTAGGAAATTTGCTAAGGGCGGCAAGGGAAAAAAGAAGCAAACAAAGCTGAAGACAAGGAAGTCAATTGGT
GGGGGTGGGGGTAATGACGACTCGGATGACGACTTTAGACCGGTCAAGGCTCCGGCAAGGAAAAAAGCAGATGAC
GAGGCAAAGAAACCGCGGGCTAGGAAGGTTATCGCTGCGGCAAAAGAATTGTTCAAGGACTCGGGTTCCGACAAG
GATACTGATCCGAAGATGAGTGAGGGCAATGAAGATCTAGATTACGCCGATTTCAACGGGAGTGGACACTCTAAA
GCCAGCAGTAACGGGAGAGGGAAAGCAAATGGAAAGAAAAAGGAAAAGGCTTTTGAAGTAGATGAGGATAGTGAA
GAAGAAATAATCAAGCCGGCAAAATCGAAGCCACGGACTAAAGCAATCACGACCGCCTCTGCACCAGAGAAGGGA
GATGACGTCGAAATGGAGCGTGCAAAGGGGAAGTCCAAGGCTCGGGGTCAGGCAAAGGCGATTGAAACGCTTGAA
CTTGAAAGTGATGACGACTTCATCATGACGAAGACAGTAGTGGCAAAATCCAAAGGCAAGCGTAAAAGGTATATT
TTTCTTTTCACGCCCATTTTCGATAGTGATCTCACCGTGATTTCCTCAGCCATGATGATGATGAAGATGATACTT
CGCCAGCTACAAAGAAGAAGAAAACAGATATAACCGACTTCTTTGGCAAGAAGGCAGACGCCCGGGCGAAAAAAA
GTGCAGGAGCTGTGCAGCCTCGGAAAGTGTCGAAGAGCATGAAGCCAGCCTCACCGATGGCTAAAGCGAAAAGGG
CAAATGGGACAAAGAAGAAGATCGTGATAGATTCGGACGAGGAGGGAGACGGTGATGATGCGGAGTTTGACGATC
TGCCAAAGCCACCGGCCCGCAATGCGCCCGGGCGTGGGGCGGCATCGAAGAGGAAGTATGTGGAGCTGAGCTCGG
AAGAGGATGGAGACGACAGCATGTTTGTAGACGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail