Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|008630
Gene name
Locationscaffold_01a:2013396..2014882
Strand-
Gene length (bp)1486
Transcript length (bp)1209
Coding sequence length (bp)1209
Protein length (aa) 403

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01264 Chorismate_synt Chorismate synthase 6.3E-139 8 373

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74413|AROC_SCHPO Chorismate synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1223.14 PE=3 SV=2 1 386 0.0E+00
sp|Q12640|AROC_NEUCR Chorismate synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aro-2 PE=2 SV=2 1 388 2.0E-179
sp|P28777|AROC_YEAST Chorismate synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARO2 PE=1 SV=1 1 385 5.0E-175
sp|Q6AIP3|AROC_DESPS Chorismate synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=aroC PE=3 SV=2 2 380 5.0E-149
sp|B1ZUM3|AROC_OPITP Chorismate synthase OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=aroC PE=3 SV=1 2 378 4.0E-139
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74413|AROC_SCHPO Chorismate synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1223.14 PE=3 SV=2 1 386 0.0E+00
sp|Q12640|AROC_NEUCR Chorismate synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aro-2 PE=2 SV=2 1 388 2.0E-179
sp|P28777|AROC_YEAST Chorismate synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARO2 PE=1 SV=1 1 385 5.0E-175
sp|Q6AIP3|AROC_DESPS Chorismate synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=aroC PE=3 SV=2 2 380 5.0E-149
sp|B1ZUM3|AROC_OPITP Chorismate synthase OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=aroC PE=3 SV=1 2 378 4.0E-139
sp|B7KIU0|AROC_CYAP7 Chorismate synthase OS=Cyanothece sp. (strain PCC 7424) GN=aroC PE=3 SV=1 2 373 2.0E-135
sp|B7JVZ9|AROC_CYAP8 Chorismate synthase OS=Cyanothece sp. (strain PCC 8801) GN=aroC PE=3 SV=1 2 378 7.0E-135
sp|A5GIL9|AROC_SYNPW Chorismate synthase OS=Synechococcus sp. (strain WH7803) GN=aroC PE=3 SV=1 2 378 2.0E-134
sp|P23353|AROC_SYNY3 Chorismate synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=aroC PE=3 SV=2 2 373 2.0E-134
sp|Q31RS5|AROC_SYNE7 Chorismate synthase OS=Synechococcus elongatus (strain PCC 7942) GN=aroC PE=3 SV=1 2 378 4.0E-132
sp|B0C2W2|AROC_ACAM1 Chorismate synthase OS=Acaryochloris marina (strain MBIC 11017) GN=aroC PE=3 SV=1 2 378 4.0E-132
sp|B8HNK4|AROC_CYAP4 Chorismate synthase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=aroC PE=3 SV=1 2 378 1.0E-131
sp|A3PAU4|AROC_PROM0 Chorismate synthase OS=Prochlorococcus marinus (strain MIT 9301) GN=aroC PE=3 SV=1 2 378 2.0E-131
sp|B1XIM6|AROC_SYNP2 Chorismate synthase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=aroC PE=3 SV=1 2 373 2.0E-131
sp|P27793|AROC_CAPSE Chorismate synthase, chloroplastic OS=Capnoides sempervirens PE=1 SV=1 2 388 3.0E-131
sp|A2BUK4|AROC_PROM5 Chorismate synthase OS=Prochlorococcus marinus (strain MIT 9515) GN=aroC PE=3 SV=1 2 378 4.0E-131
sp|Q5N2I0|AROC_SYNP6 Chorismate synthase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=aroC PE=3 SV=1 2 378 5.0E-131
sp|A8G2N2|AROC_PROM2 Chorismate synthase OS=Prochlorococcus marinus (strain MIT 9215) GN=aroC PE=3 SV=1 2 378 7.0E-131
sp|Q31CV7|AROC_PROM9 Chorismate synthase OS=Prochlorococcus marinus (strain MIT 9312) GN=aroC PE=3 SV=1 2 378 1.0E-130
sp|Q8DLM1|AROC_THEEB Chorismate synthase OS=Thermosynechococcus elongatus (strain BP-1) GN=aroC PE=3 SV=1 2 378 2.0E-130
sp|Q42885|AROC2_SOLLC Chorismate synthase 2, chloroplastic OS=Solanum lycopersicum GN=CS2 PE=2 SV=1 2 391 5.0E-130
sp|B0JWQ2|AROC_MICAN Chorismate synthase OS=Microcystis aeruginosa (strain NIES-843) GN=aroC PE=3 SV=1 2 373 8.0E-130
sp|A2BP22|AROC_PROMS Chorismate synthase OS=Prochlorococcus marinus (strain AS9601) GN=aroC PE=3 SV=1 2 378 1.0E-129
sp|Q8YYP9|AROC_NOSS1 Chorismate synthase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=aroC PE=3 SV=1 2 373 1.0E-129
sp|Q3MFM3|AROC_ANAVT Chorismate synthase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=aroC PE=3 SV=1 2 373 1.0E-129
sp|Q42884|AROC1_SOLLC Chorismate synthase 1, chloroplastic OS=Solanum lycopersicum GN=CS1 PE=2 SV=1 2 378 1.0E-129
sp|Q7V364|AROC_PROMP Chorismate synthase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=aroC PE=3 SV=1 2 378 1.0E-129
sp|B1WRV7|AROC_CYAA5 Chorismate synthase OS=Cyanothece sp. (strain ATCC 51142) GN=aroC PE=3 SV=1 2 373 2.0E-129
sp|Q0ID82|AROC_SYNS3 Chorismate synthase OS=Synechococcus sp. (strain CC9311) GN=aroC PE=3 SV=1 2 378 2.0E-129
sp|P46894|AROC_PROMA Chorismate synthase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=aroC PE=3 SV=2 2 378 2.0E-129
sp|B3DXL0|AROC_METI4 Chorismate synthase OS=Methylacidiphilum infernorum (isolate V4) GN=aroC PE=3 SV=1 2 377 2.0E-129
sp|P57720|AROC_ARATH Chorismate synthase, chloroplastic OS=Arabidopsis thaliana GN=EMB1144 PE=2 SV=2 2 378 3.0E-129
sp|Q2JXD0|AROC_SYNJA Chorismate synthase OS=Synechococcus sp. (strain JA-3-3Ab) GN=aroC PE=3 SV=1 2 384 7.0E-129
sp|B2J1W7|AROC_NOSP7 Chorismate synthase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=aroC PE=3 SV=1 2 373 3.0E-128
sp|Q2JLD4|AROC_SYNJB Chorismate synthase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=aroC PE=3 SV=1 2 378 6.0E-127
sp|Q110N5|AROC_TRIEI Chorismate synthase OS=Trichodesmium erythraeum (strain IMS101) GN=aroC PE=3 SV=1 2 373 1.0E-126
sp|A9BDJ2|AROC_PROM4 Chorismate synthase OS=Prochlorococcus marinus (strain MIT 9211) GN=aroC PE=3 SV=1 2 378 4.0E-126
sp|A2C058|AROC_PROM1 Chorismate synthase OS=Prochlorococcus marinus (strain NATL1A) GN=aroC PE=3 SV=1 2 380 4.0E-126
sp|Q7V4Y9|AROC_PROMM Chorismate synthase OS=Prochlorococcus marinus (strain MIT 9313) GN=aroC PE=3 SV=1 2 378 5.0E-126
sp|A2CCA2|AROC_PROM3 Chorismate synthase OS=Prochlorococcus marinus (strain MIT 9303) GN=aroC PE=3 SV=1 2 378 5.0E-126
sp|Q46HE7|AROC_PROMT Chorismate synthase OS=Prochlorococcus marinus (strain NATL2A) GN=aroC PE=3 SV=1 2 378 1.0E-125
sp|Q11Y57|AROC_CYTH3 Chorismate synthase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=aroC PE=3 SV=1 2 377 7.0E-125
sp|Q3AMV2|AROC_SYNSC Chorismate synthase OS=Synechococcus sp. (strain CC9605) GN=aroC PE=3 SV=2 2 378 3.0E-124
sp|Q3AUR6|AROC_SYNS9 Chorismate synthase OS=Synechococcus sp. (strain CC9902) GN=aroC PE=3 SV=1 2 378 3.0E-124
sp|Q04XD2|AROC_LEPBL Chorismate synthase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=aroC PE=3 SV=1 2 377 5.0E-123
sp|Q04W40|AROC_LEPBJ Chorismate synthase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=aroC PE=3 SV=1 2 377 5.0E-123
sp|Q8F9N4|AROC_LEPIN Chorismate synthase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=aroC PE=3 SV=1 2 377 8.0E-123
sp|Q72W01|AROC_LEPIC Chorismate synthase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=aroC PE=3 SV=1 2 377 8.0E-123
sp|Q7U9F0|AROC_SYNPX Chorismate synthase OS=Synechococcus sp. (strain WH8102) GN=aroC PE=3 SV=1 2 378 1.0E-122
sp|A5GW34|AROC_SYNR3 Chorismate synthase OS=Synechococcus sp. (strain RCC307) GN=aroC PE=3 SV=1 2 378 3.0E-122
sp|A8Z5Z2|AROC_SULMW Chorismate synthase OS=Sulcia muelleri (strain GWSS) GN=aroC PE=3 SV=1 2 373 2.0E-121
sp|A6LDP9|AROC_PARD8 Chorismate synthase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=aroC PE=3 SV=1 1 380 2.0E-121
sp|A0M1V5|AROC_GRAFK Chorismate synthase OS=Gramella forsetii (strain KT0803) GN=aroC PE=3 SV=2 2 379 6.0E-120
sp|A6GXP5|AROC_FLAPJ Chorismate synthase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=aroC PE=3 SV=1 2 375 2.0E-117
sp|Q8A602|AROC_BACTN Chorismate synthase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=aroC PE=3 SV=1 1 374 2.0E-117
sp|A5FB38|AROC_FLAJ1 Chorismate synthase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=aroC PE=3 SV=1 2 375 3.0E-116
sp|Q5L9G0|AROC_BACFN Chorismate synthase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=aroC PE=3 SV=1 1 374 5.0E-114
sp|Q64PP7|AROC_BACFR Chorismate synthase OS=Bacteroides fragilis (strain YCH46) GN=aroC PE=3 SV=1 1 374 1.0E-113
sp|A6L3D0|AROC_BACV8 Chorismate synthase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=aroC PE=3 SV=1 1 374 1.0E-113
sp|B2UNJ5|AROC_AKKM8 Chorismate synthase OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=aroC PE=3 SV=1 2 379 8.0E-112
sp|A5UUN7|AROC_ROSS1 Chorismate synthase OS=Roseiflexus sp. (strain RS-1) GN=aroC PE=3 SV=1 2 382 9.0E-110
sp|B9LK59|AROC_CHLSY Chorismate synthase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=aroC PE=3 SV=1 2 375 2.0E-109
sp|A9WI34|AROC_CHLAA Chorismate synthase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=aroC PE=3 SV=1 2 375 2.0E-109
sp|B0SRH8|AROC_LEPBP Chorismate synthase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=aroC PE=3 SV=1 2 377 1.0E-108
sp|B0SHV8|AROC_LEPBA Chorismate synthase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=aroC PE=3 SV=1 2 377 1.0E-108
sp|B6YRU6|AROC_AZOPC Chorismate synthase OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=aroC PE=3 SV=1 1 373 4.0E-108
sp|A7NQM2|AROC_ROSCS Chorismate synthase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=aroC PE=3 SV=1 2 375 3.0E-107
sp|Q8DB42|AROC_VIBVU Chorismate synthase OS=Vibrio vulnificus (strain CMCP6) GN=aroC PE=3 SV=1 2 387 5.0E-107
sp|Q87MM9|AROC_VIBPA Chorismate synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=aroC PE=3 SV=1 2 373 2.0E-106
sp|Q7MIT1|AROC_VIBVY Chorismate synthase OS=Vibrio vulnificus (strain YJ016) GN=aroC PE=3 SV=2 2 387 3.0E-106
sp|B8GB37|AROC_CHLAD Chorismate synthase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=aroC PE=3 SV=1 2 383 1.0E-105
sp|A0B5I7|AROC_METTP Chorismate synthase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=aroC PE=3 SV=1 2 379 3.0E-104
sp|P39198|AROC_VIBA7 Chorismate synthase OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=aroC PE=3 SV=3 2 387 7.0E-104
sp|Q46CJ6|AROC_METBF Chorismate synthase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=aroC PE=3 SV=1 2 373 8.0E-104
sp|A7MS71|AROC_VIBCB Chorismate synthase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=aroC PE=3 SV=2 2 373 2.0E-103
sp|A9AWF4|AROC_HERA2 Chorismate synthase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=aroC PE=3 SV=1 2 379 4.0E-103
sp|Q9ZHE9|AROC_BUCAP Chorismate synthase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=aroC PE=3 SV=2 2 373 5.0E-103
sp|A1WY16|AROC_HALHL Chorismate synthase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=aroC PE=3 SV=1 2 380 2.0E-102
sp|Q65U87|AROC_MANSM Chorismate synthase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=aroC PE=3 SV=1 2 378 7.0E-102
sp|C4Z562|AROC_EUBE2 Chorismate synthase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=aroC PE=3 SV=1 2 373 7.0E-102
sp|A6VMY7|AROC_ACTSZ Chorismate synthase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=aroC PE=3 SV=1 2 373 1.0E-101
sp|B4RU03|AROC_ALTMD Chorismate synthase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=aroC PE=3 SV=1 2 381 6.0E-101
sp|Q15VM5|AROC_PSEA6 Chorismate synthase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=aroC PE=3 SV=1 2 388 1.0E-100
sp|Q31FE3|AROC_THICR Chorismate synthase OS=Thiomicrospira crunogena (strain XCL-2) GN=aroC PE=3 SV=1 2 391 1.0E-100
sp|B8D703|AROC_BUCAT Chorismate synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=aroC PE=3 SV=1 2 373 2.0E-100
sp|P57198|AROC_BUCAI Chorismate synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=aroC PE=3 SV=1 2 373 2.0E-100
sp|B8D8P9|AROC_BUCA5 Chorismate synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=aroC PE=3 SV=1 2 373 2.0E-100
sp|Q8TT87|AROC_METAC Chorismate synthase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=aroC PE=3 SV=1 2 373 2.0E-100
sp|B5EJT1|AROC_ACIF5 Chorismate synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=aroC PE=3 SV=1 2 388 1.0E-99
sp|B7JC67|AROC_ACIF2 Chorismate synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=aroC PE=3 SV=1 2 388 1.0E-99
sp|Q6LNN4|AROC_PHOPR Chorismate synthase OS=Photobacterium profundum GN=aroC PE=3 SV=1 2 373 3.0E-99
sp|A6VXI7|AROC_MARMS Chorismate synthase OS=Marinomonas sp. (strain MWYL1) GN=aroC PE=3 SV=1 2 388 4.0E-99
sp|Q18F10|AROC_HALWD Chorismate synthase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=aroC PE=3 SV=1 4 374 2.0E-98
sp|Q0W6Q8|AROC_METAR Chorismate synthase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=aroC PE=3 SV=1 2 373 4.0E-98
sp|Q0A9B2|AROC_ALKEH Chorismate synthase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=aroC PE=3 SV=1 2 378 5.0E-98
sp|Q7N299|AROC_PHOLL Chorismate synthase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=aroC PE=3 SV=1 2 378 1.0E-97
sp|B3PHF4|AROC_CELJU Chorismate synthase OS=Cellvibrio japonicus (strain Ueda107) GN=aroC PE=3 SV=1 2 373 1.0E-97
sp|Q4QNZ4|AROC_HAEI8 Chorismate synthase OS=Haemophilus influenzae (strain 86-028NP) GN=aroC PE=3 SV=1 2 373 2.0E-97
sp|C3LP65|AROC_VIBCM Chorismate synthase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=aroC PE=3 SV=1 2 373 3.0E-97
sp|Q9KQ85|AROC_VIBCH Chorismate synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=aroC PE=3 SV=1 2 373 3.0E-97
sp|A5F6F4|AROC_VIBC3 Chorismate synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=aroC PE=3 SV=1 2 373 3.0E-97
sp|Q5E3U6|AROC_VIBF1 Chorismate synthase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=aroC PE=3 SV=1 2 373 3.0E-97
sp|B4EZG9|AROC_PROMH Chorismate synthase OS=Proteus mirabilis (strain HI4320) GN=aroC PE=3 SV=1 2 388 4.0E-97
sp|Q3J713|AROC_NITOC Chorismate synthase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=aroC PE=3 SV=1 2 392 4.0E-97
sp|Q47ZC3|AROC_COLP3 Chorismate synthase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=aroC PE=3 SV=1 2 373 1.0E-96
sp|P43875|AROC_HAEIN Chorismate synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=aroC PE=3 SV=1 2 373 1.0E-96
sp|A5UAV8|AROC_HAEIE Chorismate synthase OS=Haemophilus influenzae (strain PittEE) GN=aroC PE=3 SV=1 2 373 4.0E-96
sp|A1S7K8|AROC_SHEAM Chorismate synthase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=aroC PE=3 SV=1 2 379 4.0E-96
sp|B8F415|AROC_HAEPS Chorismate synthase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=aroC PE=3 SV=1 2 373 5.0E-96
sp|B5FGA8|AROC_VIBFM Chorismate synthase OS=Vibrio fischeri (strain MJ11) GN=aroC PE=3 SV=1 2 373 5.0E-96
sp|A5UFZ9|AROC_HAEIG Chorismate synthase OS=Haemophilus influenzae (strain PittGG) GN=aroC PE=3 SV=1 2 373 7.0E-96
sp|B0UWQ4|AROC_HISS2 Chorismate synthase OS=Histophilus somni (strain 2336) GN=aroC PE=3 SV=1 2 373 8.0E-96
sp|Q0I3U1|AROC_HAES1 Chorismate synthase OS=Haemophilus somnus (strain 129Pt) GN=aroC PE=3 SV=1 2 373 8.0E-96
sp|Q7VLX2|AROC_HAEDU Chorismate synthase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=aroC PE=3 SV=1 2 373 1.0E-95
sp|B0BP27|AROC_ACTPJ Chorismate synthase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=aroC PE=3 SV=1 2 373 2.0E-95
sp|B3GXI4|AROC_ACTP7 Chorismate synthase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=aroC PE=3 SV=1 2 373 2.0E-95
sp|Q12P04|AROC_SHEDO Chorismate synthase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=aroC PE=3 SV=1 2 381 2.0E-95
sp|A3N0B0|AROC_ACTP2 Chorismate synthase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=aroC PE=3 SV=1 2 373 3.0E-95
sp|A0KKS7|AROC_AERHH Chorismate synthase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=aroC PE=3 SV=1 2 379 4.0E-95
sp|B8EEA7|AROC_SHEB2 Chorismate synthase OS=Shewanella baltica (strain OS223) GN=aroC PE=3 SV=1 2 379 5.0E-95
sp|A1STP2|AROC_PSYIN Chorismate synthase OS=Psychromonas ingrahamii (strain 37) GN=aroC PE=3 SV=1 2 379 5.0E-95
sp|A4Y889|AROC_SHEPC Chorismate synthase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=aroC PE=3 SV=1 2 391 8.0E-95
sp|A1RIA0|AROC_SHESW Chorismate synthase OS=Shewanella sp. (strain W3-18-1) GN=aroC PE=3 SV=1 2 379 2.0E-94
sp|A9KTV7|AROC_SHEB9 Chorismate synthase OS=Shewanella baltica (strain OS195) GN=aroC PE=3 SV=1 2 379 2.0E-94
sp|A6WQ14|AROC_SHEB8 Chorismate synthase OS=Shewanella baltica (strain OS185) GN=aroC PE=3 SV=1 2 379 2.0E-94
sp|A3D676|AROC_SHEB5 Chorismate synthase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=aroC PE=3 SV=1 2 379 2.0E-94
sp|P57840|AROC_PASMU Chorismate synthase OS=Pasteurella multocida (strain Pm70) GN=aroC PE=3 SV=1 2 379 2.0E-94
sp|Q8PW84|AROC_METMA Chorismate synthase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=aroC PE=3 SV=1 2 373 2.0E-94
sp|A1U0Y3|AROC_MARHV Chorismate synthase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=aroC PE=3 SV=1 2 388 2.0E-94
sp|Q58575|AROC_METJA Chorismate synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=aroC PE=3 SV=1 1 373 3.0E-94
sp|A4SM83|AROC_AERS4 Chorismate synthase OS=Aeromonas salmonicida (strain A449) GN=aroC PE=3 SV=1 2 379 4.0E-94
sp|Q2SJE4|AROC_HAHCH Chorismate synthase OS=Hahella chejuensis (strain KCTC 2396) GN=aroC PE=3 SV=1 2 373 4.0E-94
sp|A4IYS7|AROC_FRATW Chorismate synthase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=aroC PE=3 SV=1 2 374 4.0E-94
sp|Q5NGG6|AROC_FRATT Chorismate synthase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=aroC PE=3 SV=1 2 374 4.0E-94
sp|A0Q4Z0|AROC_FRATN Chorismate synthase OS=Francisella tularensis subsp. novicida (strain U112) GN=aroC PE=3 SV=1 2 374 4.0E-94
sp|Q14HW8|AROC_FRAT1 Chorismate synthase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=aroC PE=3 SV=1 2 374 4.0E-94
sp|B2SF54|AROC_FRATM Chorismate synthase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=aroC PE=3 SV=1 2 374 4.0E-94
sp|C4L8D2|AROC_TOLAT Chorismate synthase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=aroC PE=3 SV=1 2 379 5.0E-94
sp|Q7MV04|AROC_PORGI Chorismate synthase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=aroC PE=3 SV=1 1 385 6.0E-94
sp|Q21IX8|AROC_SACD2 Chorismate synthase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=aroC PE=3 SV=1 2 373 7.0E-94
sp|Q60AY5|AROC_METCA Chorismate synthase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=aroC PE=3 SV=1 2 373 9.0E-94
sp|Q8TXN1|AROC_METKA Chorismate synthase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=aroC PE=3 SV=1 1 373 1.0E-93
sp|Q12X75|AROC_METBU Chorismate synthase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=aroC PE=3 SV=1 2 373 1.0E-93
sp|Q1QUP5|AROC_CHRSD Chorismate synthase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=aroC PE=3 SV=1 2 387 2.0E-93
sp|A7MH70|AROC_CROS8 Chorismate synthase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aroC PE=3 SV=1 2 392 9.0E-93
sp|Q47HR7|AROC_DECAR Chorismate synthase OS=Dechloromonas aromatica (strain RCB) GN=aroC PE=3 SV=1 2 378 1.0E-92
sp|Q0BNG4|AROC_FRATO Chorismate synthase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=aroC PE=3 SV=1 2 374 1.0E-92
sp|Q2A549|AROC_FRATH Chorismate synthase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=aroC PE=3 SV=1 2 374 1.0E-92
sp|A7NA74|AROC_FRATF Chorismate synthase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=aroC PE=3 SV=1 2 374 1.0E-92
sp|Q3IJ50|AROC_PSEHT Chorismate synthase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=aroC PE=3 SV=1 2 379 6.0E-92
sp|Q058B0|AROC_BUCCC Chorismate synthase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=aroC PE=3 SV=1 2 373 6.0E-92
sp|Q07ZQ7|AROC_SHEFN Chorismate synthase OS=Shewanella frigidimarina (strain NCIMB 400) GN=aroC PE=3 SV=1 2 391 9.0E-92
sp|A1JK48|AROC_YERE8 Chorismate synthase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aroC PE=3 SV=1 2 378 1.0E-91
sp|B1XWC5|AROC_LEPCP Chorismate synthase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=aroC PE=3 SV=1 2 401 2.0E-91
sp|Q83D67|AROC_COXBU Chorismate synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=aroC PE=3 SV=1 2 379 2.0E-91
sp|A1AW83|AROC_RUTMC Chorismate synthase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=aroC PE=3 SV=1 2 388 3.0E-91
sp|B1JGG7|AROC_YERPY Chorismate synthase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aroC PE=3 SV=1 2 378 4.0E-91
sp|A4TM78|AROC_YERPP Chorismate synthase OS=Yersinia pestis (strain Pestoides F) GN=aroC PE=3 SV=1 2 378 4.0E-91
sp|Q1CHK6|AROC_YERPN Chorismate synthase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=aroC PE=3 SV=1 2 378 4.0E-91
sp|A9R7W3|AROC_YERPG Chorismate synthase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aroC PE=3 SV=1 2 378 4.0E-91
sp|Q8ZD41|AROC_YERPE Chorismate synthase OS=Yersinia pestis GN=aroC PE=3 SV=3 2 378 4.0E-91
sp|Q1C664|AROC_YERPA Chorismate synthase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aroC PE=3 SV=1 2 378 4.0E-91
sp|A7FGK6|AROC_YERP3 Chorismate synthase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aroC PE=3 SV=1 2 378 4.0E-91
sp|Q668V5|AROC_YERPS Chorismate synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aroC PE=3 SV=1 2 378 5.0E-91
sp|B2K8I9|AROC_YERPB Chorismate synthase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aroC PE=3 SV=1 2 378 5.0E-91
sp|Q89AX9|AROC_BUCBP Chorismate synthase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=aroC PE=3 SV=1 2 373 6.0E-91
sp|Q5QW40|AROC_IDILO Chorismate synthase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=aroC PE=3 SV=1 2 389 7.0E-91
sp|B2UGK8|AROC_RALPJ Chorismate synthase OS=Ralstonia pickettii (strain 12J) GN=aroC PE=3 SV=1 2 387 7.0E-91
sp|Q2LUC8|AROC_SYNAS Chorismate synthase OS=Syntrophus aciditrophicus (strain SB) GN=aroC PE=3 SV=1 2 377 9.0E-91
sp|C6DA85|AROC_PECCP Chorismate synthase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aroC PE=3 SV=1 2 378 1.0E-90
sp|A3QFN4|AROC_SHELP Chorismate synthase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=aroC PE=3 SV=1 2 391 1.0E-90
sp|C5BL71|AROC_TERTT Chorismate synthase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=aroC PE=3 SV=1 2 373 1.0E-90
sp|B7LLE1|AROC_ESCF3 Chorismate synthase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aroC PE=3 SV=1 2 379 2.0E-90
sp|A9MJ42|AROC_SALAR Chorismate synthase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=aroC PE=3 SV=1 2 379 4.0E-90
sp|A8GH82|AROC_SERP5 Chorismate synthase OS=Serratia proteamaculans (strain 568) GN=aroC PE=3 SV=1 2 379 5.0E-90
sp|A6V7B0|AROC_PSEA7 Chorismate synthase OS=Pseudomonas aeruginosa (strain PA7) GN=aroC PE=3 SV=1 2 388 6.0E-90
sp|Q9JT81|AROC_NEIMA Chorismate synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=aroC PE=3 SV=1 2 391 6.0E-90
sp|Q9I344|AROC_PSEAE Chorismate synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aroC PE=3 SV=1 2 388 6.0E-90
sp|Q02KH1|AROC_PSEAB Chorismate synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=aroC PE=3 SV=1 2 388 6.0E-90
sp|B7UV40|AROC_PSEA8 Chorismate synthase OS=Pseudomonas aeruginosa (strain LESB58) GN=aroC PE=3 SV=1 2 388 6.0E-90
sp|Q0T2F6|AROC_SHIF8 Chorismate synthase OS=Shigella flexneri serotype 5b (strain 8401) GN=aroC PE=3 SV=1 2 379 7.0E-90
sp|A1V3K9|AROC_BURMS Chorismate synthase OS=Burkholderia mallei (strain SAVP1) GN=aroC PE=3 SV=2 2 378 7.0E-90
sp|Q62KU7|AROC_BURMA Chorismate synthase OS=Burkholderia mallei (strain ATCC 23344) GN=aroC PE=3 SV=1 2 378 7.0E-90
sp|A3MJ92|AROC_BURM7 Chorismate synthase OS=Burkholderia mallei (strain NCTC 10247) GN=aroC PE=3 SV=2 2 378 7.0E-90
sp|Q5WUE6|AROC_LEGPL Chorismate synthase OS=Legionella pneumophila (strain Lens) GN=aroC PE=3 SV=1 2 378 7.0E-90
sp|Q13WE6|AROC_BURXL Chorismate synthase OS=Burkholderia xenovorans (strain LB400) GN=aroC PE=3 SV=1 2 387 7.0E-90
sp|Q3YZN2|AROC_SHISS Chorismate synthase OS=Shigella sonnei (strain Ss046) GN=aroC PE=3 SV=1 2 379 8.0E-90
sp|Q83QQ5|AROC_SHIFL Chorismate synthase OS=Shigella flexneri GN=aroC PE=3 SV=4 2 379 8.0E-90
sp|B6I4X6|AROC_ECOSE Chorismate synthase OS=Escherichia coli (strain SE11) GN=aroC PE=3 SV=1 2 379 8.0E-90
sp|B7LBI3|AROC_ECO55 Chorismate synthase OS=Escherichia coli (strain 55989 / EAEC) GN=aroC PE=3 SV=1 2 379 8.0E-90
sp|B7UFY7|AROC_ECO27 Chorismate synthase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aroC PE=3 SV=1 2 379 8.0E-90
sp|P12008|AROC_ECOLI Chorismate synthase OS=Escherichia coli (strain K12) GN=aroC PE=1 SV=4 2 379 8.0E-90
sp|A8A2J9|AROC_ECOHS Chorismate synthase OS=Escherichia coli O9:H4 (strain HS) GN=aroC PE=3 SV=1 2 379 8.0E-90
sp|B1X9K2|AROC_ECODH Chorismate synthase OS=Escherichia coli (strain K12 / DH10B) GN=aroC PE=3 SV=1 2 379 8.0E-90
sp|C4ZVM2|AROC_ECOBW Chorismate synthase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aroC PE=3 SV=1 2 379 8.0E-90
sp|Q31YC9|AROC_SHIBS Chorismate synthase OS=Shigella boydii serotype 4 (strain Sb227) GN=aroC PE=3 SV=1 2 379 8.0E-90
sp|B2TWB1|AROC_SHIB3 Chorismate synthase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aroC PE=3 SV=1 2 379 8.0E-90
sp|A1TRH4|AROC_ACIAC Chorismate synthase OS=Acidovorax citrulli (strain AAC00-1) GN=aroC PE=3 SV=1 2 378 9.0E-90
sp|Q6MCU1|AROC_PARUW Chorismate synthase OS=Protochlamydia amoebophila (strain UWE25) GN=aroC PE=3 SV=1 2 374 9.0E-90
sp|C4K3S0|AROC_HAMD5 Chorismate synthase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=aroC PE=3 SV=1 2 378 1.0E-89
sp|B5BBA5|AROC_SALPK Chorismate synthase OS=Salmonella paratyphi A (strain AKU_12601) GN=aroC PE=3 SV=1 2 379 1.0E-89
sp|Q5PCX2|AROC_SALPA Chorismate synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aroC PE=3 SV=1 2 379 1.0E-89
sp|Q32DK8|AROC_SHIDS Chorismate synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=aroC PE=3 SV=1 2 379 1.0E-89
sp|B1LLT5|AROC_ECOSM Chorismate synthase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aroC PE=3 SV=1 2 379 1.0E-89
sp|B7N5U1|AROC_ECOLU Chorismate synthase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aroC PE=3 SV=1 2 379 1.0E-89
sp|B1IXB6|AROC_ECOLC Chorismate synthase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aroC PE=3 SV=1 2 379 1.0E-89
sp|P63609|AROC_ECOL6 Chorismate synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aroC PE=3 SV=2 2 379 1.0E-89
sp|Q0TFB7|AROC_ECOL5 Chorismate synthase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aroC PE=3 SV=1 2 379 1.0E-89
sp|B7M6L0|AROC_ECO8A Chorismate synthase OS=Escherichia coli O8 (strain IAI1) GN=aroC PE=3 SV=1 2 379 1.0E-89
sp|B7MY06|AROC_ECO81 Chorismate synthase OS=Escherichia coli O81 (strain ED1a) GN=aroC PE=3 SV=1 2 379 1.0E-89
sp|B5YXX0|AROC_ECO5E Chorismate synthase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aroC PE=3 SV=1 2 379 1.0E-89
sp|P63610|AROC_ECO57 Chorismate synthase OS=Escherichia coli O157:H7 GN=aroC PE=3 SV=2 2 379 1.0E-89
sp|Q1R983|AROC_ECOUT Chorismate synthase OS=Escherichia coli (strain UTI89 / UPEC) GN=aroC PE=3 SV=3 2 379 1.0E-89
sp|A1ADH8|AROC_ECOK1 Chorismate synthase OS=Escherichia coli O1:K1 / APEC GN=aroC PE=3 SV=1 2 379 1.0E-89
sp|B7MG93|AROC_ECO45 Chorismate synthase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aroC PE=3 SV=1 2 379 1.0E-89
sp|A7ZPE5|AROC_ECO24 Chorismate synthase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aroC PE=3 SV=1 2 379 1.0E-89
sp|Q63TK6|AROC_BURPS Chorismate synthase OS=Burkholderia pseudomallei (strain K96243) GN=aroC PE=3 SV=1 2 378 1.0E-89
sp|A3N8Q9|AROC_BURP6 Chorismate synthase OS=Burkholderia pseudomallei (strain 668) GN=aroC PE=3 SV=1 2 378 1.0E-89
sp|Q3JT35|AROC_BURP1 Chorismate synthase OS=Burkholderia pseudomallei (strain 1710b) GN=aroC PE=3 SV=2 2 378 1.0E-89
sp|A3NUG3|AROC_BURP0 Chorismate synthase OS=Burkholderia pseudomallei (strain 1106a) GN=aroC PE=3 SV=1 2 378 1.0E-89
sp|Q7VRU6|AROC_BLOFL Chorismate synthase OS=Blochmannia floridanus GN=aroC PE=3 SV=1 2 373 2.0E-89
sp|Q2SVC0|AROC_BURTA Chorismate synthase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=aroC PE=3 SV=1 2 378 2.0E-89
sp|A9ABG9|AROC_BURM1 Chorismate synthase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=aroC PE=3 SV=1 2 378 2.0E-89
sp|P58729|AROC_SALTY Chorismate synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aroC PE=3 SV=2 2 379 2.0E-89
sp|A9N460|AROC_SALPB Chorismate synthase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aroC PE=3 SV=1 2 379 2.0E-89
sp|B4SZQ7|AROC_SALNS Chorismate synthase OS=Salmonella newport (strain SL254) GN=aroC PE=3 SV=1 2 379 2.0E-89
sp|B4TCA5|AROC_SALHS Chorismate synthase OS=Salmonella heidelberg (strain SL476) GN=aroC PE=3 SV=1 2 379 2.0E-89
sp|Q57LX0|AROC_SALCH Chorismate synthase OS=Salmonella choleraesuis (strain SC-B67) GN=aroC PE=3 SV=1 2 379 2.0E-89
sp|Q5X2Y6|AROC_LEGPA Chorismate synthase OS=Legionella pneumophila (strain Paris) GN=aroC PE=3 SV=1 2 378 2.0E-89
sp|B7NP10|AROC_ECO7I Chorismate synthase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aroC PE=3 SV=1 2 379 2.0E-89
sp|B2JK28|AROC_BURP8 Chorismate synthase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=aroC PE=3 SV=1 2 378 2.0E-89
sp|B4TQB9|AROC_SALSV Chorismate synthase OS=Salmonella schwarzengrund (strain CVM19633) GN=aroC PE=3 SV=1 2 379 3.0E-89
sp|B5RCK9|AROC_SALG2 Chorismate synthase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aroC PE=3 SV=1 2 379 3.0E-89
sp|B5R3R5|AROC_SALEP Chorismate synthase OS=Salmonella enteritidis PT4 (strain P125109) GN=aroC PE=3 SV=1 2 379 3.0E-89
sp|B5FPM7|AROC_SALDC Chorismate synthase OS=Salmonella dublin (strain CT_02021853) GN=aroC PE=3 SV=1 2 379 3.0E-89
sp|B5EZR6|AROC_SALA4 Chorismate synthase OS=Salmonella agona (strain SL483) GN=aroC PE=3 SV=1 2 379 3.0E-89
sp|P16280|AROC_SALTI Chorismate synthase OS=Salmonella typhi GN=aroC PE=3 SV=4 2 379 3.0E-89
sp|C5BAF2|AROC_EDWI9 Chorismate synthase OS=Edwardsiella ictaluri (strain 93-146) GN=aroC PE=3 SV=1 2 378 3.0E-89
sp|Q5ZT62|AROC_LEGPH Chorismate synthase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=aroC PE=3 SV=1 2 378 3.0E-89
sp|A5IEA1|AROC_LEGPC Chorismate synthase OS=Legionella pneumophila (strain Corby) GN=aroC PE=3 SV=1 2 378 3.0E-89
sp|Q1GZD3|AROC_METFK Chorismate synthase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=aroC PE=3 SV=1 2 384 3.0E-89
sp|A2S381|AROC_BURM9 Chorismate synthase OS=Burkholderia mallei (strain NCTC 10229) GN=aroC PE=3 SV=2 2 378 5.0E-89
sp|Q492G9|AROC_BLOPB Chorismate synthase OS=Blochmannia pennsylvanicus (strain BPEN) GN=aroC PE=3 SV=1 2 378 5.0E-89
sp|Q9JY99|AROC_NEIMB Chorismate synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=aroC PE=3 SV=1 2 391 6.0E-89
sp|Q0HWM5|AROC_SHESR Chorismate synthase OS=Shewanella sp. (strain MR-7) GN=aroC PE=3 SV=1 2 391 6.0E-89
sp|Q0HKC3|AROC_SHESM Chorismate synthase OS=Shewanella sp. (strain MR-4) GN=aroC PE=3 SV=1 2 391 6.0E-89
sp|A0KV84|AROC_SHESA Chorismate synthase OS=Shewanella sp. (strain ANA-3) GN=aroC PE=3 SV=1 2 391 7.0E-89
sp|A9KQX0|AROC_CLOPH Chorismate synthase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=aroC PE=3 SV=1 2 355 7.0E-89
sp|A4WCW2|AROC_ENT38 Chorismate synthase OS=Enterobacter sp. (strain 638) GN=aroC PE=3 SV=1 2 388 8.0E-89
sp|Q3SL02|AROC_THIDA Chorismate synthase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=aroC PE=3 SV=1 2 378 8.0E-89
sp|C4ZAX1|AROC_EUBR3 Chorismate synthase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=aroC PE=3 SV=1 2 375 9.0E-89
sp|Q6D2M6|AROC_PECAS Chorismate synthase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aroC PE=3 SV=1 2 378 1.0E-88
sp|B2SZH3|AROC_BURPP Chorismate synthase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=aroC PE=3 SV=1 2 378 1.0E-88
sp|C1DBU8|AROC_LARHH Chorismate synthase OS=Laribacter hongkongensis (strain HLHK9) GN=aroC PE=3 SV=1 2 378 1.0E-88
sp|A4XTH9|AROC_PSEMY Chorismate synthase OS=Pseudomonas mendocina (strain ymp) GN=aroC PE=3 SV=1 2 388 2.0E-88
sp|A1KV89|AROC_NEIMF Chorismate synthase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=aroC PE=3 SV=1 2 387 3.0E-88
sp|A9M1Q2|AROC_NEIM0 Chorismate synthase OS=Neisseria meningitidis serogroup C (strain 053442) GN=aroC PE=3 SV=1 2 387 3.0E-88
sp|B4RN46|AROC_NEIG2 Chorismate synthase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=aroC PE=3 SV=1 2 379 3.0E-88
sp|Q5F756|AROC_NEIG1 Chorismate synthase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=aroC PE=3 SV=1 2 379 3.0E-88
sp|A6UPX8|AROC_METVS Chorismate synthase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=aroC PE=3 SV=1 1 373 4.0E-88
sp|B1KKS1|AROC_SHEWM Chorismate synthase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=aroC PE=3 SV=1 2 379 5.0E-88
sp|Q21TN3|AROC_RHOFT Chorismate synthase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=aroC PE=3 SV=1 2 378 6.0E-88
sp|Q472Q5|AROC_CUPPJ Chorismate synthase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=aroC PE=3 SV=1 2 378 7.0E-88
sp|O29587|AROC_ARCFU Chorismate synthase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=aroC PE=3 SV=1 1 375 7.0E-88
sp|B1XUP3|AROC_POLNS Chorismate synthase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=aroC PE=3 SV=1 2 378 7.0E-88
sp|B9LMX0|AROC_HALLT Chorismate synthase OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=aroC PE=3 SV=1 4 374 8.0E-88
sp|A4VM84|AROC_PSEU5 Chorismate synthase OS=Pseudomonas stutzeri (strain A1501) GN=aroC PE=3 SV=1 2 388 1.0E-87
sp|B4E7H2|AROC_BURCJ Chorismate synthase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=aroC PE=3 SV=1 2 378 1.0E-87
sp|Q7NYT5|AROC_CHRVO Chorismate synthase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=aroC PE=3 SV=1 2 378 1.0E-87
sp|A0LE92|AROC_SYNFM Chorismate synthase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=aroC PE=3 SV=1 2 373 2.0E-87
sp|A8ADP9|AROC_CITK8 Chorismate synthase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aroC PE=3 SV=1 2 379 2.0E-87
sp|A8FTS6|AROC_SHESH Chorismate synthase OS=Shewanella sediminis (strain HAW-EB3) GN=aroC PE=3 SV=1 2 379 3.0E-87
sp|Q0KC14|AROC_CUPNH Chorismate synthase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=aroC PE=3 SV=2 2 378 4.0E-87
sp|A0K6T5|AROC_BURCH Chorismate synthase OS=Burkholderia cenocepacia (strain HI2424) GN=aroC PE=3 SV=1 2 378 4.0E-87
sp|Q1BWW8|AROC_BURCA Chorismate synthase OS=Burkholderia cenocepacia (strain AU 1054) GN=aroC PE=3 SV=1 2 378 4.0E-87
sp|A6TC15|AROC_KLEP7 Chorismate synthase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aroC PE=3 SV=1 2 379 4.0E-87
sp|B1J4S1|AROC_PSEPW Chorismate synthase OS=Pseudomonas putida (strain W619) GN=aroC PE=3 SV=1 2 388 5.0E-87
sp|Q0BG24|AROC_BURCM Chorismate synthase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=aroC PE=3 SV=1 2 378 7.0E-87
sp|B1K077|AROC_BURCC Chorismate synthase OS=Burkholderia cenocepacia (strain MC0-3) GN=aroC PE=3 SV=1 2 378 7.0E-87
sp|Q39H65|AROC_BURL3 Chorismate synthase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=aroC PE=3 SV=1 2 378 7.0E-87
sp|Q3BRK5|AROC_XANC5 Chorismate synthase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=aroC PE=3 SV=1 2 378 9.0E-87
sp|B1YNZ5|AROC_BURA4 Chorismate synthase OS=Burkholderia ambifaria (strain MC40-6) GN=aroC PE=3 SV=1 2 378 1.0E-86
sp|A5CX05|AROC_VESOH Chorismate synthase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=aroC PE=3 SV=1 2 388 1.0E-86
sp|Q5P1K1|AROC_AROAE Chorismate synthase OS=Aromatoleum aromaticum (strain EbN1) GN=aroC PE=3 SV=1 2 396 2.0E-86
sp|B5XVW6|AROC_KLEP3 Chorismate synthase OS=Klebsiella pneumoniae (strain 342) GN=aroC PE=3 SV=1 2 379 2.0E-86
sp|Q884P5|AROC_PSESM Chorismate synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=aroC PE=3 SV=1 2 388 2.0E-86
sp|A4JDS6|AROC_BURVG Chorismate synthase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=aroC PE=3 SV=1 2 378 3.0E-86
sp|Q0AEP5|AROC_NITEC Chorismate synthase OS=Nitrosomonas eutropha (strain C91) GN=aroC PE=3 SV=1 2 373 4.0E-86
sp|Q48KN0|AROC_PSE14 Chorismate synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=aroC PE=3 SV=1 2 388 4.0E-86
sp|Q8PJ20|AROC_XANAC Chorismate synthase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=aroC PE=3 SV=1 2 378 4.0E-86
sp|A6UUV1|AROC_META3 Chorismate synthase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=aroC PE=3 SV=1 1 373 4.0E-86
sp|B8FFQ6|AROC_DESAA Chorismate synthase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=aroC PE=3 SV=1 2 375 7.0E-86
sp|Q5GXQ6|AROC_XANOR Chorismate synthase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=aroC PE=3 SV=1 2 378 7.0E-86
sp|B2SVP7|AROC_XANOP Chorismate synthase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=aroC PE=3 SV=1 2 378 7.0E-86
sp|Q2P0T3|AROC_XANOM Chorismate synthase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=aroC PE=3 SV=1 2 378 7.0E-86
sp|Q72DN5|AROC_DESVH Chorismate synthase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=aroC PE=3 SV=1 2 380 1.0E-85
sp|Q4ZVC2|AROC_PSEU2 Chorismate synthase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=aroC PE=3 SV=1 2 388 1.0E-85
sp|A6T017|AROC_JANMA Chorismate synthase OS=Janthinobacterium sp. (strain Marseille) GN=aroC PE=3 SV=1 2 387 1.0E-85
sp|B0KUL0|AROC_PSEPG Chorismate synthase OS=Pseudomonas putida (strain GB-1) GN=aroC PE=3 SV=1 2 388 2.0E-85
sp|Q1LPA2|AROC_CUPMC Chorismate synthase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=aroC PE=3 SV=1 2 378 2.0E-85
sp|Q1LTA9|AROC_BAUCH Chorismate synthase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=aroC PE=3 SV=1 2 378 2.0E-85
sp|A1VF90|AROC_DESVV Chorismate synthase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=aroC PE=3 SV=1 2 380 2.0E-85
sp|Q1ID65|AROC_PSEE4 Chorismate synthase OS=Pseudomonas entomophila (strain L48) GN=aroC PE=3 SV=1 2 388 4.0E-85
sp|A1VQW9|AROC_POLNA Chorismate synthase OS=Polaromonas naphthalenivorans (strain CJ2) GN=aroC PE=3 SV=1 2 378 8.0E-85
sp|Q88LU7|AROC_PSEPK Chorismate synthase OS=Pseudomonas putida (strain KT2440) GN=aroC PE=3 SV=1 2 388 8.0E-85
sp|A5W794|AROC_PSEP1 Chorismate synthase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=aroC PE=3 SV=1 2 388 8.0E-85
sp|Q7VY92|AROC_BORPE Chorismate synthase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=aroC PE=3 SV=1 2 378 9.0E-85
sp|Q7WKJ5|AROC_BORBR Chorismate synthase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=aroC PE=3 SV=1 2 378 2.0E-84
sp|B0RR76|AROC_XANCB Chorismate synthase OS=Xanthomonas campestris pv. campestris (strain B100) GN=aroC PE=3 SV=1 2 378 2.0E-84
sp|A4G4F3|AROC_HERAR Chorismate synthase OS=Herminiimonas arsenicoxydans GN=aroC PE=3 SV=1 2 387 2.0E-84
sp|B2VIY1|AROC_ERWT9 Chorismate synthase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aroC PE=3 SV=1 2 379 2.0E-84
sp|A1WL18|AROC_VEREI Chorismate synthase OS=Verminephrobacter eiseniae (strain EF01-2) GN=aroC PE=3 SV=1 2 378 2.0E-84
sp|Q8P7R0|AROC_XANCP Chorismate synthase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=aroC PE=3 SV=1 2 378 2.0E-84
sp|Q4UWE0|AROC_XANC8 Chorismate synthase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=aroC PE=3 SV=1 2 378 2.0E-84
sp|Q0VPH7|AROC_ALCBS Chorismate synthase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=aroC PE=3 SV=1 2 392 2.0E-84
sp|Q4K8J3|AROC_PSEF5 Chorismate synthase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=aroC PE=3 SV=1 2 388 3.0E-84
sp|A2SFP8|AROC_METPP Chorismate synthase OS=Methylibium petroleiphilum (strain PM1) GN=aroC PE=3 SV=1 2 378 3.0E-84
sp|Q3KFJ1|AROC_PSEPF Chorismate synthase OS=Pseudomonas fluorescens (strain Pf0-1) GN=aroC PE=3 SV=1 2 388 5.0E-84
sp|C3K084|AROC_PSEFS Chorismate synthase OS=Pseudomonas fluorescens (strain SBW25) GN=aroC PE=3 SV=1 2 388 6.0E-84
sp|Q2NSH3|AROC_SODGM Chorismate synthase OS=Sodalis glossinidius (strain morsitans) GN=aroC PE=3 SV=1 2 388 7.0E-84
sp|A9IT47|AROC_BORPD Chorismate synthase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=aroC PE=3 SV=1 2 378 9.0E-84
sp|B9KE09|AROC_CAMLR Chorismate synthase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=aroC PE=3 SV=1 1 384 1.0E-83
sp|Q8XZ40|AROC_RALSO Chorismate synthase OS=Ralstonia solanacearum (strain GMI1000) GN=aroC PE=3 SV=1 2 378 1.0E-83
sp|Q6LXL7|AROC_METMP Chorismate synthase OS=Methanococcus maripaludis (strain S2 / LL) GN=aroC PE=3 SV=1 1 373 1.0E-83
sp|C6C0I6|AROC_DESAD Chorismate synthase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=aroC PE=3 SV=1 2 375 1.0E-83
sp|A4SXH9|AROC_POLSQ Chorismate synthase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=aroC PE=3 SV=1 2 388 1.0E-83
sp|Q7W950|AROC_BORPA Chorismate synthase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=aroC PE=3 SV=1 2 378 2.0E-83
sp|Q2KYK7|AROC_BORA1 Chorismate synthase OS=Bordetella avium (strain 197N) GN=aroC PE=3 SV=1 2 373 5.0E-83
sp|C5CS25|AROC_VARPS Chorismate synthase OS=Variovorax paradoxus (strain S110) GN=aroC PE=3 SV=1 2 378 7.0E-83
sp|Q2NGS6|AROC_METST Chorismate synthase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=aroC PE=3 SV=1 2 373 9.0E-83
sp|B9MAD0|AROC_ACIET Chorismate synthase OS=Acidovorax ebreus (strain TPSY) GN=aroC PE=3 SV=1 2 378 1.0E-82
sp|A4FWK1|AROC_METM5 Chorismate synthase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=aroC PE=3 SV=1 1 373 2.0E-82
sp|Q2W6Y1|AROC_MAGSA Chorismate synthase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=aroC PE=3 SV=1 4 373 3.0E-82
sp|A7HZN6|AROC_CAMHC Chorismate synthase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=aroC PE=3 SV=1 1 384 4.0E-82
sp|A1W6H4|AROC_ACISJ Chorismate synthase OS=Acidovorax sp. (strain JS42) GN=aroC PE=3 SV=1 2 378 5.0E-82
sp|B8DRR9|AROC_DESVM Chorismate synthase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=aroC PE=3 SV=1 2 375 5.0E-82
sp|Q2Y7L8|AROC_NITMU Chorismate synthase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=aroC PE=3 SV=1 2 387 5.0E-82
sp|Q9HJY7|AROC_THEAC Chorismate synthase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=aroC PE=3 SV=1 1 380 8.0E-82
sp|Q16CN2|AROC_ROSDO Chorismate synthase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=aroC PE=3 SV=1 1 378 9.0E-82
sp|A1K498|AROC_AZOSB Chorismate synthase OS=Azoarcus sp. (strain BH72) GN=aroC PE=3 SV=1 2 396 9.0E-82
sp|A9H0U2|AROC_GLUDA Chorismate synthase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=aroC PE=3 SV=1 2 378 1.0E-81
sp|A5VFP1|AROC_SPHWW Chorismate synthase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=aroC PE=3 SV=1 1 378 1.0E-81
sp|A6VGS0|AROC_METM7 Chorismate synthase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=aroC PE=3 SV=1 1 373 1.0E-81
sp|A5FY49|AROC_ACICJ Chorismate synthase OS=Acidiphilium cryptum (strain JF-5) GN=aroC PE=3 SV=1 2 386 3.0E-81
sp|A0LDR1|AROC_MAGMM Chorismate synthase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=aroC PE=3 SV=1 2 379 3.0E-81
sp|Q1GCR5|AROC_RUEST Chorismate synthase OS=Ruegeria sp. (strain TM1040) GN=aroC PE=3 SV=1 1 378 3.0E-81
sp|A5FS06|AROC_DEHMB Chorismate synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=aroC PE=3 SV=1 2 373 5.0E-81
sp|Q3ZZI6|AROC_DEHMC Chorismate synthase OS=Dehalococcoides mccartyi (strain CBDB1) GN=aroC PE=3 SV=1 2 373 6.0E-81
sp|Q12CG7|AROC_POLSJ Chorismate synthase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=aroC PE=3 SV=1 2 387 9.0E-81
sp|B6IRC6|AROC_RHOCS Chorismate synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=aroC PE=3 SV=1 2 377 1.0E-80
sp|Q5FPG9|AROC_GLUOX Chorismate synthase OS=Gluconobacter oxydans (strain 621H) GN=aroC PE=3 SV=1 2 378 2.0E-80
sp|A7IMW7|AROC_XANP2 Chorismate synthase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=aroC PE=3 SV=1 1 373 2.0E-80
sp|B4SQW1|AROC_STRM5 Chorismate synthase OS=Stenotrophomonas maltophilia (strain R551-3) GN=aroC PE=3 SV=1 2 378 4.0E-80
sp|Q9PDL0|AROC_XYLFA Chorismate synthase OS=Xylella fastidiosa (strain 9a5c) GN=aroC PE=3 SV=2 2 378 5.0E-80
sp|Q82TK9|AROC_NITEU Chorismate synthase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=aroC PE=3 SV=1 2 379 7.0E-80
sp|Q3Z993|AROC_DEHM1 Chorismate synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=aroC PE=3 SV=1 2 373 7.0E-80
sp|Q2GCF2|AROC_NOVAD Chorismate synthase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=aroC PE=3 SV=1 1 378 1.0E-79
sp|Q5V5K5|AROC_HALMA Chorismate synthase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=aroC PE=3 SV=1 2 374 1.0E-79
sp|B2FP01|AROC_STRMK Chorismate synthase OS=Stenotrophomonas maltophilia (strain K279a) GN=aroC PE=3 SV=1 2 378 1.0E-79
sp|Q5LX60|AROC_RUEPO Chorismate synthase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=aroC PE=3 SV=1 1 378 2.0E-79
sp|Q89RY1|AROC_BRADU Chorismate synthase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=aroC PE=3 SV=1 1 373 2.0E-79
sp|B0VPN2|AROC_ACIBS Chorismate synthase OS=Acinetobacter baumannii (strain SDF) GN=aroC PE=3 SV=1 2 393 2.0E-79
sp|Q9HQC2|AROC_HALSA Chorismate synthase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=aroC PE=3 SV=1 4 374 3.0E-79
sp|A4YQ28|AROC_BRASO Chorismate synthase OS=Bradyrhizobium sp. (strain ORS278) GN=aroC PE=3 SV=2 1 373 3.0E-79
sp|B2I0B7|AROC_ACIBC Chorismate synthase OS=Acinetobacter baumannii (strain ACICU) GN=aroC PE=3 SV=1 2 393 3.0E-79
sp|B0VDX7|AROC_ACIBY Chorismate synthase OS=Acinetobacter baumannii (strain AYE) GN=aroC PE=3 SV=1 2 393 4.0E-79
sp|A3M5C7|AROC_ACIBT Chorismate synthase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=aroC PE=3 SV=2 2 393 4.0E-79
sp|B7I5W6|AROC_ACIB5 Chorismate synthase OS=Acinetobacter baumannii (strain AB0057) GN=aroC PE=3 SV=1 2 393 4.0E-79
sp|B7H3A6|AROC_ACIB3 Chorismate synthase OS=Acinetobacter baumannii (strain AB307-0294) GN=aroC PE=3 SV=1 2 393 4.0E-79
sp|Q1GVE2|AROC_SPHAL Chorismate synthase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=aroC PE=3 SV=1 1 378 5.0E-79
sp|A5EEP1|AROC_BRASB Chorismate synthase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=aroC PE=3 SV=1 1 373 9.0E-79
sp|A6Q1H1|AROC_NITSB Chorismate synthase OS=Nitratiruptor sp. (strain SB155-2) GN=aroC PE=3 SV=1 1 375 9.0E-79
sp|O02607|AROC_TOXGO Chorismate synthase OS=Toxoplasma gondii GN=AROC PE=2 SV=1 1 287 1.0E-78
sp|Q96Y94|AROC_SULTO Chorismate synthase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=aroC PE=3 SV=1 2 373 2.0E-78
sp|A5UNA1|AROC_METS3 Chorismate synthase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=aroC PE=3 SV=1 2 373 3.0E-78
sp|Q822F8|AROC_CHLCV Chorismate synthase OS=Chlamydophila caviae (strain GPIC) GN=aroC PE=3 SV=1 4 379 3.0E-78
sp|Q87DS4|AROC_XYLFT Chorismate synthase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=aroC PE=3 SV=1 2 378 3.0E-78
sp|B2I9I6|AROC_XYLF2 Chorismate synthase OS=Xylella fastidiosa (strain M23) GN=aroC PE=3 SV=1 2 378 3.0E-78
sp|Q30NY4|AROC_SULDN Chorismate synthase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=aroC PE=3 SV=1 1 384 4.0E-78
sp|B8ESC6|AROC_METSB Chorismate synthase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=aroC PE=3 SV=1 2 373 5.0E-78
sp|Q5L5F2|AROC_CHLAB Chorismate synthase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=aroC PE=3 SV=1 4 379 6.0E-78
sp|B0U6K0|AROC_XYLFM Chorismate synthase OS=Xylella fastidiosa (strain M12) GN=aroC PE=3 SV=1 2 378 6.0E-78
sp|Q6NAI4|AROC_RHOPA Chorismate synthase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=aroC PE=3 SV=1 1 373 7.0E-78
sp|B0BC02|AROC_CHLTB Chorismate synthase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=aroC PE=3 SV=1 4 363 7.0E-78
sp|B0B7T7|AROC_CHLT2 Chorismate synthase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=aroC PE=3 SV=1 4 363 7.0E-78
sp|A4WWC0|AROC_RHOS5 Chorismate synthase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=aroC PE=3 SV=1 1 388 9.0E-78
sp|B3QIL0|AROC_RHOPT Chorismate synthase OS=Rhodopseudomonas palustris (strain TIE-1) GN=aroC PE=3 SV=1 1 373 1.0E-77
sp|Q2RR25|AROC_RHORT Chorismate synthase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=aroC PE=3 SV=1 3 373 1.0E-77
sp|Q3KLY8|AROC_CHLTA Chorismate synthase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=aroC PE=3 SV=1 4 363 1.0E-77
sp|Q2J0T8|AROC_RHOP2 Chorismate synthase OS=Rhodopseudomonas palustris (strain HaA2) GN=aroC PE=3 SV=1 1 373 2.0E-77
sp|Q4JC74|AROC_SULAC Chorismate synthase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=aroC PE=3 SV=1 2 373 2.0E-77
sp|C5A782|AROC_THEGJ Chorismate synthase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=aroC PE=3 SV=1 5 377 2.0E-77
sp|Q7M841|AROC_WOLSU Chorismate synthase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=aroC PE=3 SV=1 1 375 2.0E-77
sp|Q21A81|AROC_RHOPB Chorismate synthase OS=Rhodopseudomonas palustris (strain BisB18) GN=aroC PE=3 SV=1 1 373 3.0E-77
sp|O84373|AROC_CHLTR Chorismate synthase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=aroC PE=3 SV=1 4 363 7.0E-77
sp|A1URW3|AROC_BARBK Chorismate synthase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=aroC PE=3 SV=1 2 373 1.0E-76
sp|A3DDD8|AROC_CLOTH Chorismate synthase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=aroC PE=3 SV=1 2 387 1.0E-76
sp|Q255H5|AROC_CHLFF Chorismate synthase OS=Chlamydophila felis (strain Fe/C-56) GN=aroC PE=3 SV=1 4 379 2.0E-76
sp|Q13BI7|AROC_RHOPS Chorismate synthase OS=Rhodopseudomonas palustris (strain BisB5) GN=aroC PE=3 SV=1 1 373 4.0E-76
sp|A5WDY8|AROC_PSYWF Chorismate synthase OS=Psychrobacter sp. (strain PRwf-1) GN=aroC PE=3 SV=1 2 373 4.0E-76
sp|C3MZF2|AROC_SULIA Chorismate synthase OS=Sulfolobus islandicus (strain M.16.27) GN=aroC PE=3 SV=1 2 373 5.0E-76
sp|A0RRM6|AROC_CAMFF Chorismate synthase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=aroC PE=3 SV=1 1 381 5.0E-76
sp|C3N7H4|AROC_SULIY Chorismate synthase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=aroC PE=3 SV=1 2 373 5.0E-76
sp|C3MXK6|AROC_SULIM Chorismate synthase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=aroC PE=3 SV=1 2 373 5.0E-76
sp|C3MRB7|AROC_SULIL Chorismate synthase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=aroC PE=3 SV=1 2 373 5.0E-76
sp|C4KIN2|AROC_SULIK Chorismate synthase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=aroC PE=3 SV=1 2 373 5.0E-76
sp|Q28VL4|AROC_JANSC Chorismate synthase OS=Jannaschia sp. (strain CCS1) GN=aroC PE=3 SV=1 1 378 7.0E-76
sp|Q6FAR2|AROC_ACIAD Chorismate synthase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=aroC PE=3 SV=1 2 393 9.0E-76
sp|Q11KE5|AROC_CHESB Chorismate synthase OS=Chelativorans sp. (strain BNC1) GN=aroC PE=3 SV=1 2 373 1.0E-75
sp|Q07HS5|AROC_RHOP5 Chorismate synthase OS=Rhodopseudomonas palustris (strain BisA53) GN=aroC PE=3 SV=1 1 373 1.0E-75
sp|A8EV89|AROC_ARCB4 Chorismate synthase OS=Arcobacter butzleri (strain RM4018) GN=aroC PE=3 SV=1 1 379 2.0E-75
sp|Q2N810|AROC_ERYLH Chorismate synthase OS=Erythrobacter litoralis (strain HTCC2594) GN=aroC PE=3 SV=1 1 378 2.0E-75
sp|C3NG02|AROC_SULIN Chorismate synthase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=aroC PE=3 SV=1 2 373 2.0E-75
sp|Q980I7|AROC_SULSO Chorismate synthase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=aroC PE=3 SV=1 2 373 2.0E-75
sp|E3PV41|AROC_CLOSD Chorismate synthase OS=Clostridium sticklandii (strain ATCC 12662 / DSM 519 / JCM 1433 / NCIB 10654) GN=aroC PE=3 SV=1 2 373 2.0E-75
sp|Q2KBP0|AROC_RHIEC Chorismate synthase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=aroC PE=3 SV=1 2 373 2.0E-75
sp|A1BA52|AROC_PARDP Chorismate synthase OS=Paracoccus denitrificans (strain Pd 1222) GN=aroC PE=3 SV=1 1 378 4.0E-75
sp|A8ZT68|AROC_DESOH Chorismate synthase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=aroC PE=3 SV=1 2 377 4.0E-75
sp|Q3SUZ5|AROC_NITWN Chorismate synthase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=aroC PE=3 SV=2 2 373 7.0E-75
sp|Q4FRQ5|AROC_PSYA2 Chorismate synthase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=aroC PE=3 SV=1 2 373 7.0E-75
sp|Q9Z6M2|AROC_CHLPN Chorismate synthase OS=Chlamydia pneumoniae GN=aroC PE=3 SV=1 2 379 8.0E-75
sp|Q1MKK1|AROC_RHIL3 Chorismate synthase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=aroC PE=3 SV=1 2 373 1.0E-74
sp|Q4FN06|AROC_PELUB Chorismate synthase OS=Pelagibacter ubique (strain HTCC1062) GN=aroC PE=3 SV=1 1 378 1.0E-74
sp|A4YHW1|AROC_METS5 Chorismate synthase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=aroC PE=3 SV=1 2 388 2.0E-74
sp|Q1QQ46|AROC_NITHX Chorismate synthase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=aroC PE=3 SV=1 2 373 2.0E-74
sp|B2IDQ8|AROC_BEII9 Chorismate synthase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=aroC PE=3 SV=1 2 386 4.0E-74
sp|A5EXT0|AROC_DICNV Chorismate synthase OS=Dichelobacter nodosus (strain VCS1703A) GN=aroC PE=3 SV=1 2 379 7.0E-74
sp|B5ZST4|AROC_RHILW Chorismate synthase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=aroC PE=3 SV=1 2 373 2.0E-73
sp|C3MHI8|AROC_RHISN Chorismate synthase OS=Rhizobium sp. (strain NGR234) GN=aroC PE=3 SV=1 2 373 2.0E-73
sp|Q5NLU3|AROC_ZYMMO Chorismate synthase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=aroC PE=3 SV=1 1 378 3.0E-73
sp|Q1QA91|AROC_PSYCK Chorismate synthase OS=Psychrobacter cryohalolentis (strain K5) GN=aroC PE=3 SV=1 2 391 5.0E-73
sp|Q97AR9|AROC_THEVO Chorismate synthase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=aroC PE=3 SV=1 1 374 6.0E-73
sp|Q9PK26|AROC_CHLMU Chorismate synthase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=aroC PE=3 SV=1 4 363 1.0E-72
sp|B1L5G9|AROC_KORCO Chorismate synthase OS=Korarchaeum cryptofilum (strain OPF8) GN=aroC PE=3 SV=1 4 373 2.0E-72
sp|Q0BVN0|AROC_GRABC Chorismate synthase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=aroC PE=3 SV=2 2 379 2.0E-72
sp|Q0ARD9|AROC_MARMM Chorismate synthase OS=Maricaulis maris (strain MCS10) GN=aroC PE=3 SV=1 2 373 2.0E-72
sp|B1M325|AROC_METRJ Chorismate synthase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=aroC PE=3 SV=1 2 373 3.0E-72
sp|A8I4M5|AROC_AZOC5 Chorismate synthase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=aroC PE=3 SV=1 1 373 3.0E-72
sp|A6QCJ1|AROC_SULNB Chorismate synthase OS=Sulfurovum sp. (strain NBC37-1) GN=aroC PE=3 SV=1 1 379 4.0E-72
sp|Q73NM0|AROC_TREDE Chorismate synthase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=aroC PE=3 SV=1 2 379 5.0E-72
sp|Q9V1H0|AROC_PYRAB Chorismate synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=aroC PE=3 SV=1 5 383 7.0E-72
sp|B6JFJ0|AROC_OLICO Chorismate synthase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=aroC PE=3 SV=1 1 373 8.0E-72
sp|B4RHV8|AROC_PHEZH Chorismate synthase OS=Phenylobacterium zucineum (strain HLK1) GN=aroC PE=3 SV=1 2 378 1.0E-71
sp|Q7VIA8|AROC_HELHP Chorismate synthase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=aroC PE=3 SV=1 1 375 1.0E-71
sp|A8Z6F5|AROC_CAMC1 Chorismate synthase OS=Campylobacter concisus (strain 13826) GN=aroC PE=3 SV=1 1 379 3.0E-71
sp|A7H187|AROC_CAMC5 Chorismate synthase OS=Campylobacter curvus (strain 525.92) GN=aroC PE=3 SV=1 1 375 4.0E-71
sp|Q9ZLH1|AROC_HELPJ Chorismate synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=aroC PE=3 SV=1 1 375 7.0E-71
sp|A8A9W1|AROC_IGNH4 Chorismate synthase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=aroC PE=3 SV=1 2 388 8.0E-71
sp|C7NZH8|AROC_HALMD Chorismate synthase OS=Halomicrobium mukohataei (strain ATCC 700874 / DSM 12286 / JCM 9738 / NCIMB 13541) GN=aroC PE=3 SV=1 2 374 1.0E-70
sp|A8LMT3|AROC_DINSH Chorismate synthase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=aroC PE=3 SV=1 1 378 1.0E-70
sp|B9KQP8|AROC_RHOSK Chorismate synthase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=aroC PE=3 SV=1 2 378 1.0E-70
sp|Q3IY15|AROC_RHOS4 Chorismate synthase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=aroC PE=3 SV=1 2 378 1.0E-70
sp|B0UJB1|AROC_METS4 Chorismate synthase OS=Methylobacterium sp. (strain 4-46) GN=aroC PE=3 SV=1 2 373 2.0E-70
sp|B8J4Q3|AROC_DESDA Chorismate synthase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=aroC PE=3 SV=1 2 361 2.0E-70
sp|P56122|AROC_HELPY Chorismate synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=aroC PE=1 SV=1 1 375 2.0E-70
sp|A3PFR1|AROC_RHOS1 Chorismate synthase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=aroC PE=3 SV=1 2 378 3.0E-70
sp|B3PS94|AROC_RHIE6 Chorismate synthase OS=Rhizobium etli (strain CIAT 652) GN=aroC PE=3 SV=1 2 373 5.0E-70
sp|B6JLQ1|AROC_HELP2 Chorismate synthase OS=Helicobacter pylori (strain P12) GN=aroC PE=3 SV=1 1 375 5.0E-70
sp|A8MC69|AROC_CALMQ Chorismate synthase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=aroC PE=3 SV=1 1 373 6.0E-70
sp|Q1CTK7|AROC_HELPH Chorismate synthase OS=Helicobacter pylori (strain HPAG1) GN=aroC PE=3 SV=1 1 375 9.0E-70
sp|B2UTG3|AROC_HELPS Chorismate synthase OS=Helicobacter pylori (strain Shi470) GN=aroC PE=3 SV=1 1 375 9.0E-70
sp|Q17XJ5|AROC_HELAH Chorismate synthase OS=Helicobacter acinonychis (strain Sheeba) GN=aroC PE=3 SV=1 1 375 1.0E-69
sp|Q9YEL4|AROC_AERPE Chorismate synthase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=aroC PE=3 SV=1 3 367 1.0E-69
sp|B5Z736|AROC_HELPG Chorismate synthase OS=Helicobacter pylori (strain G27) GN=aroC PE=3 SV=1 1 375 1.0E-69
sp|A7HR75|AROC_PARL1 Chorismate synthase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=aroC PE=3 SV=1 2 378 2.0E-69
sp|Q5JFT4|AROC_THEKO Chorismate synthase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=aroC PE=3 SV=1 5 377 2.0E-69
sp|Q6MHP7|AROC_BDEBA Chorismate synthase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=aroC PE=3 SV=1 2 373 2.0E-69
sp|Q985Z4|AROC_RHILO Chorismate synthase OS=Rhizobium loti (strain MAFF303099) GN=aroC PE=3 SV=1 2 373 8.0E-69
sp|B9JSM6|AROC_AGRVS Chorismate synthase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=aroC PE=3 SV=1 2 373 2.0E-68
sp|C0RHD5|AROC_BRUMB Chorismate synthase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=aroC PE=3 SV=1 2 373 5.0E-68
sp|A6U6U1|AROC_SINMW Chorismate synthase OS=Sinorhizobium medicae (strain WSM419) GN=aroC PE=3 SV=1 2 373 5.0E-68
sp|P63608|AROC_BRUSU Chorismate synthase OS=Brucella suis biovar 1 (strain 1330) GN=aroC PE=3 SV=1 2 373 6.0E-68
sp|B0CKB2|AROC_BRUSI Chorismate synthase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=aroC PE=3 SV=1 2 373 6.0E-68
sp|A5VP02|AROC_BRUO2 Chorismate synthase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=aroC PE=3 SV=1 2 373 6.0E-68
sp|P63607|AROC_BRUME Chorismate synthase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=aroC PE=3 SV=1 2 373 6.0E-68
sp|A9M8V2|AROC_BRUC2 Chorismate synthase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=aroC PE=3 SV=1 2 373 6.0E-68
sp|Q57ET8|AROC_BRUAB Chorismate synthase OS=Brucella abortus biovar 1 (strain 9-941) GN=aroC PE=3 SV=1 2 373 6.0E-68
sp|Q2YMF8|AROC_BRUA2 Chorismate synthase OS=Brucella abortus (strain 2308) GN=aroC PE=3 SV=1 2 373 6.0E-68
sp|B2S9R7|AROC_BRUA1 Chorismate synthase OS=Brucella abortus (strain S19) GN=aroC PE=3 SV=1 2 373 6.0E-68
sp|E0TIQ1|AROC_ZINIC Chorismate synthase OS=Zinderia insecticola (strain CARI) GN=aroC PE=3 SV=1 5 379 9.0E-68
sp|C7PC56|AROC_CHIPD Chorismate synthase OS=Chitinophaga pinensis (strain ATCC 43595 / DSM 2588 / NCIB 11800 / UQM 2034) GN=aroC PE=3 SV=1 1 375 9.0E-68
sp|A9W6U7|AROC_METEP Chorismate synthase OS=Methylobacterium extorquens (strain PA1) GN=aroC PE=3 SV=1 2 373 1.0E-67
sp|B7KT24|AROC_METC4 Chorismate synthase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=aroC PE=3 SV=1 2 373 1.0E-67
sp|Q0C3Z3|AROC_HYPNA Chorismate synthase OS=Hyphomonas neptunium (strain ATCC 15444) GN=aroC PE=3 SV=1 2 373 6.0E-67
sp|A3MUI8|AROC_PYRCJ Chorismate synthase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=aroC PE=3 SV=1 1 385 7.0E-67
sp|A6WWB6|AROC_OCHA4 Chorismate synthase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=aroC PE=3 SV=1 2 373 8.0E-67
sp|B1ZHL0|AROC_METPB Chorismate synthase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=aroC PE=3 SV=1 2 373 4.0E-66
sp|A8FNU6|AROC_CAMJ8 Chorismate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=aroC PE=3 SV=1 1 375 9.0E-66
sp|A1W1N6|AROC_CAMJJ Chorismate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=aroC PE=3 SV=1 1 375 8.0E-65
sp|Q9PM41|AROC_CAMJE Chorismate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=aroC PE=1 SV=1 1 375 1.0E-64
sp|Q5HSF9|AROC_CAMJR Chorismate synthase OS=Campylobacter jejuni (strain RM1221) GN=aroC PE=3 SV=1 1 384 1.0E-64
sp|B8IS51|AROC_METNO Chorismate synthase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=aroC PE=3 SV=1 2 373 2.0E-64
sp|A7H5Y1|AROC_CAMJD Chorismate synthase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=aroC PE=3 SV=1 1 384 2.0E-64
sp|A4WMP8|AROC_PYRAR Chorismate synthase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=aroC PE=3 SV=1 1 373 4.0E-64
sp|Q6G4D4|AROC_BARHE Chorismate synthase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=aroC PE=3 SV=1 2 373 6.0E-64
sp|Q8ZW90|AROC_PYRAE Chorismate synthase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=aroC PE=3 SV=1 1 373 1.0E-63
sp|Q30XS4|AROC_DESAG Chorismate synthase OS=Desulfovibrio alaskensis (strain G20) GN=aroC PE=3 SV=1 2 381 1.0E-63
sp|Q92RH3|AROC_RHIME Chorismate synthase OS=Rhizobium meliloti (strain 1021) GN=aroC PE=3 SV=1 2 373 2.0E-63
sp|Q7D0R6|AROC_AGRFC Chorismate synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=aroC PE=3 SV=2 2 373 4.0E-63
sp|Q9A3P8|AROC_CAUCR Chorismate synthase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=aroC PE=3 SV=1 2 373 8.0E-63
sp|O02607|AROC_TOXGO Chorismate synthase OS=Toxoplasma gondii GN=AROC PE=2 SV=1 298 385 3.0E-19
[Show less]

GO

GO Term Description Terminal node
GO:0004107 chorismate synthase activity Yes
GO:0009073 aromatic amino acid family biosynthetic process Yes
GO:0019752 carboxylic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0009072 aromatic amino acid family metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016835 carbon-oxygen lyase activity No
GO:0016838 carbon-oxygen lyase activity, acting on phosphates No
GO:0044249 cellular biosynthetic process No
GO:0016829 lyase activity No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:1901564 organonitrogen compound metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0043436 oxoacid metabolic process No
GO:0009058 biosynthetic process No
GO:0044283 small molecule biosynthetic process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0003824 catalytic activity No
GO:0019438 aromatic compound biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0006082 organic acid metabolic process No
GO:0008150 biological_process No
GO:0044281 small molecule metabolic process No
GO:0016053 organic acid biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|008630
MSTYGTLFRVTTYGESHCASVGAIIDGCPPGLELRDTDIQTQLSRRRPGQSNLTTPRNEKDLVHIQSGVEHGVTL
GTPIGLLVKNEDHRPHDYSETDFYPRPSHADYTYLQKYGIKASSGGGRSSARETIGRVAAGAIAERYLKQAFGIE
IVAFVSSVGKIQIPQTTTADDDSDDAPDPVSPEFLKLISTVTREDVDKHTTRCPHLETAERMVQRIIRAKDAQDS
IGGTVTCVIRNVPGGLGEPTFDKFEAKLGHAMLSIPATKAFEIGSGFRGTEVPGSKHNDPFVVREDGTLGTKTNW
SGGVQGGITNSEDIYFRIAFKSPATISQPQSTAQYDGEPGTLAARGRHDPCVVPRAVPIVEAMAAIVVMDQLLIQ
NARKTAASLLPPITTLPPTMVLPPATQ*
Coding >Agabi119p4|008630
ATGTCTACTTACGGTACCCTTTTCCGTGTCACCACCTACGGCGAGAGCCACTGTGCCTCCGTCGGTGCGATCATC
GACGGCTGCCCGCCTGGTCTCGAGCTCAGAGATACTGACATCCAAACGCAACTCAGCCGTCGCAGACCCGGCCAG
AGTAACCTCACGACTCCTCGGAATGAGAAGGACCTCGTCCATATCCAATCTGGCGTCGAGCATGGTGTCACTCTC
GGCACACCCATTGGTCTCCTCGTAAAGAACGAGGATCACCGCCCACATGACTACTCTGAAACCGACTTCTATCCC
CGTCCGAGCCATGCTGATTATACTTATCTCCAAAAGTACGGCATCAAGGCCAGCAGTGGTGGCGGTCGCAGCAGT
GCTCGCGAGACCATCGGTCGAGTGGCCGCGGGCGCTATCGCCGAGAGGTACCTGAAACAAGCCTTCGGGATTGAA
ATCGTCGCTTTCGTCTCCTCTGTCGGCAAGATTCAAATACCCCAGACTACGACTGCTGACGACGACAGTGATGAT
GCACCGGACCCAGTCTCTCCGGAATTTCTCAAATTGATTTCCACCGTCACACGAGAAGATGTCGATAAGCATACT
ACTAGGTGCCCTCATCTAGAAACCGCCGAGCGCATGGTTCAGCGCATCATCCGCGCCAAAGATGCTCAAGATTCT
ATTGGTGGTACCGTCACTTGTGTTATTCGCAATGTTCCTGGGGGCCTTGGCGAACCCACTTTCGACAAGTTCGAA
GCTAAGCTGGGCCATGCTATGCTCTCGATCCCCGCCACCAAGGCCTTTGAGATTGGTTCCGGTTTCCGAGGGACT
GAGGTTCCAGGAAGCAAACACAACGATCCCTTCGTCGTTCGTGAGGACGGAACACTCGGTACAAAAACCAACTGG
AGTGGAGGTGTCCAGGGTGGTATCACCAACTCTGAAGACATTTACTTCCGTATTGCTTTCAAGTCACCCGCGACT
ATCTCCCAGCCCCAGAGCACCGCTCAGTATGATGGTGAGCCAGGTACGCTGGCAGCTCGTGGTCGCCATGATCCT
TGTGTTGTTCCTCGTGCCGTTCCCATCGTTGAAGCCATGGCTGCGATCGTGGTTATGGACCAACTTCTCATTCAA
AACGCCCGCAAGACCGCTGCGAGCCTCTTACCGCCAATTACCACCTTACCCCCGACCATGGTTTTACCTCCCGCA
ACCCAATAG
Transcript >Agabi119p4|008630
ATGTCTACTTACGGTACCCTTTTCCGTGTCACCACCTACGGCGAGAGCCACTGTGCCTCCGTCGGTGCGATCATC
GACGGCTGCCCGCCTGGTCTCGAGCTCAGAGATACTGACATCCAAACGCAACTCAGCCGTCGCAGACCCGGCCAG
AGTAACCTCACGACTCCTCGGAATGAGAAGGACCTCGTCCATATCCAATCTGGCGTCGAGCATGGTGTCACTCTC
GGCACACCCATTGGTCTCCTCGTAAAGAACGAGGATCACCGCCCACATGACTACTCTGAAACCGACTTCTATCCC
CGTCCGAGCCATGCTGATTATACTTATCTCCAAAAGTACGGCATCAAGGCCAGCAGTGGTGGCGGTCGCAGCAGT
GCTCGCGAGACCATCGGTCGAGTGGCCGCGGGCGCTATCGCCGAGAGGTACCTGAAACAAGCCTTCGGGATTGAA
ATCGTCGCTTTCGTCTCCTCTGTCGGCAAGATTCAAATACCCCAGACTACGACTGCTGACGACGACAGTGATGAT
GCACCGGACCCAGTCTCTCCGGAATTTCTCAAATTGATTTCCACCGTCACACGAGAAGATGTCGATAAGCATACT
ACTAGGTGCCCTCATCTAGAAACCGCCGAGCGCATGGTTCAGCGCATCATCCGCGCCAAAGATGCTCAAGATTCT
ATTGGTGGTACCGTCACTTGTGTTATTCGCAATGTTCCTGGGGGCCTTGGCGAACCCACTTTCGACAAGTTCGAA
GCTAAGCTGGGCCATGCTATGCTCTCGATCCCCGCCACCAAGGCCTTTGAGATTGGTTCCGGTTTCCGAGGGACT
GAGGTTCCAGGAAGCAAACACAACGATCCCTTCGTCGTTCGTGAGGACGGAACACTCGGTACAAAAACCAACTGG
AGTGGAGGTGTCCAGGGTGGTATCACCAACTCTGAAGACATTTACTTCCGTATTGCTTTCAAGTCACCCGCGACT
ATCTCCCAGCCCCAGAGCACCGCTCAGTATGATGGTGAGCCAGGTACGCTGGCAGCTCGTGGTCGCCATGATCCT
TGTGTTGTTCCTCGTGCCGTTCCCATCGTTGAAGCCATGGCTGCGATCGTGGTTATGGACCAACTTCTCATTCAA
AACGCCCGCAAGACCGCTGCGAGCCTCTTACCGCCAATTACCACCTTACCCCCGACCATGGTTTTACCTCCCGCA
ACCCAATAG
Gene >Agabi119p4|008630
ATGTCTACTTACGGTACCCTTTTCCGTGTCACCACCTACGGCGAGAGCCACTGTGCCTCCGTCGGTGCGATCATC
GACGGCTGCCCGCCTGTGCGTCACCCTGTAGTGTTTATTTGTTGTTCGTTTTCTGACTACCGTAAAATTTCCAGG
GTCTCGAGCTCAGAGATACTGACATCCAAACGCAACTCAGCCGTCGCAGACCCGGCCAGAGTAACCTCACGACTC
CTGTCAGTACAAGTTATCTCTCCATATTTTTTTCTTAATTAACAGTCGTGCCACACAGCGGAATGAGAAGGACCT
CGTCCATATCCAATCTGGCGTCGAGCATGGTGTCACTCTCGGCACACCCATTGGTCTCCTCGTAAAGAACGAGGA
TCACCGCCCACATGACTACTCTGAAACCGACTTCTATCCCCGTCCGAGCCATGCTGATTATACTTATCTCCAAAA
GTACGGCATCAAGGCCAGCAGTGGTGGCGGTCGCAGCAGTGCTCGCGAGACCATCGGTATGATTTCCATATTAAC
CTCTGGCATGTTTGCTAAAAAAAATTTAATTAAAAGGTCGAGTGGCCGCGGGCGCTATCGCCGAGAGGTACCTGA
AACAAGCCTTCGGGATTGAAATCGTCGCTTTCGTCTCCTCTGTCGGCAAGATTCAAATACCCCAGACTACGACTG
CTGACGACGACAGTGATGATGCACCGGACCCAGTCTCTCCGGAATTTCTCAAATTGATTTCCACCGTCACACGAG
AAGATGTCGATAAGCATACTACTAGGTGCCCTCATCTAGAAACCGCCGAGCGCATGGTTCAGGTTAGTTTATTAA
AAAAAATCTAAGGTTATCAGTGCCTCATGGCGATTTAGCGCATCATCCGCGCCAAAGATGCTCAAGATTCTATTG
GTGGTACCGTCACTTGTGTTATTCGCAATGTTCCTGGGGGCCTTGGCGAACCCACTTTCGACAAGTTCGAAGCTA
AGCTGGGCCATGCTATGCTCTCGATCCCCGCCACCAAGGCCTTTGAGATTGGTTCCGGTTTCCGAGGGACTGAGG
TTCCAGGAAGCAAACACAACGATCCCTTCGTCGTTCGTGAGGACGGAACACTCGGTACAAAAACCAACTGGAGTG
GAGGTGTCCAGGGTGGTATCACCAACTCTGAAGACATTTACTTCCGGTGCGTCTCAGTCTTCTTCTTAAGTCGAA
CTGTCCACAAAGCGTGCACTCCTTTAGTATTGCTTTCAAGTCACCCGCGACTATCTCCCAGCCCCAGAGCACCGC
TCAGTATGATGGTGAGCCAGGTACGCTGGCAGCTCGTGGTCGCCATGATCCTTGTGTTGTTCCTCGTGCCGTTCC
CATCGTTGAAGCCATGGCTGCGATCGTGGTTATGGACCAACTTCTCATTCAAAACGCCCGCAAGACCGCTGCGAG
CCTCTTACCGCCAATTACCACCTTACCCCCGACCATGGTTTTACCTCCCGCAACCCAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail