Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|008210
Gene name
Locationscaffold_01a:1918056..1920194
Strand+
Gene length (bp)2138
Transcript length (bp)1890
Coding sequence length (bp)1890
Protein length (aa) 630

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00782 DSPc Dual specificity phosphatase, catalytic domain 5.2E-16 83 258

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13453|PMP1_SCHPO Tyrosine-protein phosphatase pmp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmp1 PE=3 SV=1 71 265 7.0E-16
sp|Q9BY84|DUS16_HUMAN Dual specificity protein phosphatase 16 OS=Homo sapiens GN=DUSP16 PE=1 SV=1 68 269 2.0E-14
sp|P43078|PTPX_CANAW Probable tyrosine-protein phosphatase OS=Candida albicans (strain WO-1) GN=CPP1 PE=3 SV=2 48 266 2.0E-14
sp|P38590|MSG5_YEAST Tyrosine-protein phosphatase MSG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSG5 PE=1 SV=2 72 281 2.0E-14
sp|Q5APU2|CPP1_CANAL Dual specificity protein tyrosine phosphatase CCP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CPP1 PE=1 SV=1 48 266 7.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13453|PMP1_SCHPO Tyrosine-protein phosphatase pmp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmp1 PE=3 SV=1 71 265 7.0E-16
sp|Q9BY84|DUS16_HUMAN Dual specificity protein phosphatase 16 OS=Homo sapiens GN=DUSP16 PE=1 SV=1 68 269 2.0E-14
sp|P43078|PTPX_CANAW Probable tyrosine-protein phosphatase OS=Candida albicans (strain WO-1) GN=CPP1 PE=3 SV=2 48 266 2.0E-14
sp|P38590|MSG5_YEAST Tyrosine-protein phosphatase MSG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSG5 PE=1 SV=2 72 281 2.0E-14
sp|Q5APU2|CPP1_CANAL Dual specificity protein tyrosine phosphatase CCP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CPP1 PE=1 SV=1 48 266 7.0E-14
sp|Q05922|DUS2_MOUSE Dual specificity protein phosphatase 2 OS=Mus musculus GN=Dusp2 PE=1 SV=2 62 260 1.0E-13
sp|Q99956|DUS9_HUMAN Dual specificity protein phosphatase 9 OS=Homo sapiens GN=DUSP9 PE=1 SV=1 73 261 1.0E-13
sp|Q63340|DUS7_RAT Dual specificity protein phosphatase 7 (Fragment) OS=Rattus norvegicus GN=Dusp7 PE=2 SV=1 76 260 9.0E-13
sp|Q16690|DUS5_HUMAN Dual specificity protein phosphatase 5 OS=Homo sapiens GN=DUSP5 PE=1 SV=2 75 278 1.0E-12
sp|Q16829|DUS7_HUMAN Dual specificity protein phosphatase 7 OS=Homo sapiens GN=DUSP7 PE=1 SV=4 76 274 2.0E-12
sp|Q91Z46|DUS7_MOUSE Dual specificity protein phosphatase 7 OS=Mus musculus GN=Dusp7 PE=2 SV=4 76 260 2.0E-12
sp|Q2KJ36|DUS6_BOVIN Dual specificity protein phosphatase 6 OS=Bos taurus GN=DUSP6 PE=2 SV=1 76 260 2.0E-11
sp|Q9DBB1|DUS6_MOUSE Dual specificity protein phosphatase 6 OS=Mus musculus GN=Dusp6 PE=1 SV=1 76 260 2.0E-11
sp|Q16828|DUS6_HUMAN Dual specificity protein phosphatase 6 OS=Homo sapiens GN=DUSP6 PE=1 SV=2 76 260 2.0E-11
sp|Q05923|DUS2_HUMAN Dual specificity protein phosphatase 2 OS=Homo sapiens GN=DUSP2 PE=1 SV=1 75 260 2.0E-11
sp|Q64346|DUS6_RAT Dual specificity protein phosphatase 6 OS=Rattus norvegicus GN=Dusp6 PE=1 SV=1 76 260 2.0E-11
sp|Q91790|DUS1A_XENLA Dual specificity protein phosphatase 1-A OS=Xenopus laevis GN=dusp1-a PE=1 SV=1 75 278 2.0E-11
sp|P40479|SDP1_YEAST Dual-specificity protein phosphatase SDP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDP1 PE=1 SV=1 151 270 5.0E-11
sp|P28562|DUS1_HUMAN Dual specificity protein phosphatase 1 OS=Homo sapiens GN=DUSP1 PE=1 SV=3 62 270 6.0E-11
sp|Q90W58|DUS1B_XENLA Dual specificity protein phosphatase 1-B OS=Xenopus laevis GN=dusp1-b PE=2 SV=1 75 278 9.0E-11
sp|P28563|DUS1_MOUSE Dual specificity protein phosphatase 1 OS=Mus musculus GN=Dusp1 PE=1 SV=1 62 270 4.0E-10
sp|Q64623|DUS1_RAT Dual specificity protein phosphatase 1 OS=Rattus norvegicus GN=Dusp1 PE=1 SV=1 62 270 5.0E-10
sp|O54838|DUS5_RAT Dual specificity protein phosphatase 5 OS=Rattus norvegicus GN=Dusp5 PE=2 SV=1 75 260 2.0E-09
sp|O55737|123R_IIV6 Putative tyrosine phosphatase 123R OS=Invertebrate iridescent virus 6 GN=IIV6-123R PE=3 SV=1 182 260 1.0E-08
sp|Q13202|DUS8_HUMAN Dual specificity protein phosphatase 8 OS=Homo sapiens GN=DUSP8 PE=1 SV=2 75 261 1.0E-08
sp|Q10038|VHP1_CAEEL Tyrosine-protein phosphatase vhp-1 OS=Caenorhabditis elegans GN=vhp-1 PE=1 SV=2 71 263 1.0E-08
sp|O09112|DUS8_MOUSE Dual specificity protein phosphatase 8 OS=Mus musculus GN=Dusp8 PE=2 SV=1 75 261 1.0E-08
sp|Q0IID7|DUS10_BOVIN Dual specificity protein phosphatase 10 OS=Bos taurus GN=DUSP10 PE=2 SV=1 79 265 1.0E-08
sp|Q9Y6W6|DUS10_HUMAN Dual specificity protein phosphatase 10 OS=Homo sapiens GN=DUSP10 PE=1 SV=1 186 265 1.0E-08
sp|Q9ESS0|DUS10_MOUSE Dual specificity protein phosphatase 10 OS=Mus musculus GN=Dusp10 PE=2 SV=2 186 265 1.0E-08
sp|Q9JLY7|DUS14_MOUSE Dual specificity protein phosphatase 14 OS=Mus musculus GN=Dusp14 PE=2 SV=2 60 265 2.0E-08
sp|O95147|DUS14_HUMAN Dual specificity protein phosphatase 14 OS=Homo sapiens GN=DUSP14 PE=1 SV=1 60 265 4.0E-07
sp|Q17QM8|DUS14_BOVIN Dual specificity protein phosphatase 14 OS=Bos taurus GN=DUSP14 PE=2 SV=1 60 265 4.0E-07
sp|Q60969|STYX_MOUSE Serine/threonine/tyrosine-interacting protein OS=Mus musculus GN=Styx PE=1 SV=2 178 278 6.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016311 dephosphorylation Yes
GO:0008138 protein tyrosine/serine/threonine phosphatase activity Yes
GO:0016787 hydrolase activity No
GO:0044237 cellular metabolic process No
GO:0042578 phosphoric ester hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0006793 phosphorus metabolic process No
GO:0004721 phosphoprotein phosphatase activity No
GO:0003824 catalytic activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0016791 phosphatase activity No
GO:0003674 molecular_function No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|008210
MGPSPSLSPHLSPMSRRKNTKRLSLSLPPHDASLVPEPSRRLSTASLPSPARPTSSLLHRKEEEGDSPTVPYADG
PVQIIPGIWLGSEDNARDWKDLVDRGIRAILNVAKEVSSPLDALAAQPLRSTVSVPDLKSPSDSSYYPPHIPSGR
PAMHYLKLQWSHGQKDLVNDGFQAGFLFTDAALARGDGILVHCQCGISRSATMVIALVMRAATLCSPSVPPEVWN
LKGMQAAYSFVKEKSKWIGPNMSLIYELLDYEKKLKPDSTSPAPSDAGSAVTSEEEIWSKQRQLLDEMPSDTENS
ERDSFLVMQEARDLDKAMENRIHAENLVEEEEEPELLGIGGGFDDTRERRRSADTFDSSATNSPDDEIEATPRNI
FNPPFTSRPAPHLRPPPSAPAWRQTFDIPHIPPAPLTAVRSTFDLPPKPKPKVRRRPPPIGLPPVPSSPVTLVID
DQGPHSPPAVQPAAESTVSSIPFAPSSQLHSPSQSLPTAIETPDRPPPPHRPASLPKQGLRQRADARKPSLPPQH
LLRRLNVRESSAAPSTATPHQTLFVFPPSPTLTMRTPSAVMLTTQPAEVFAPRNGKVPFPSISTPKISTFKQHGR
TKSFIGVGTPMTPTTAFTKAEARGYFGLE*
Coding >Agabi119p4|008210
ATGGGCCCATCTCCTTCGCTCTCTCCCCATCTCTCCCCCATGAGCCGTCGCAAAAACACAAAAAGACTTTCCCTT
TCTCTTCCTCCCCACGACGCCTCTCTCGTCCCCGAACCTTCCCGCCGTCTCTCTACCGCCTCTCTTCCCTCCCCT
GCTCGCCCCACCTCTTCTCTCCTCCATCGCAAGGAAGAAGAGGGCGACTCCCCCACCGTCCCCTATGCCGATGGC
CCCGTTCAGATCATACCCGGCATCTGGCTAGGATCAGAGGACAACGCCCGCGACTGGAAGGACCTCGTCGACCGC
GGTATCAGGGCCATTCTCAACGTAGCCAAGGAAGTCTCGTCTCCTCTGGACGCATTGGCCGCTCAGCCTCTCCGC
TCTACCGTCTCCGTTCCCGATTTGAAATCCCCCTCAGACTCATCCTACTACCCCCCGCATATCCCCAGCGGAAGG
CCTGCCATGCACTACCTCAAACTCCAGTGGTCCCATGGTCAGAAGGATCTCGTCAATGACGGCTTTCAGGCCGGC
TTTCTCTTTACCGATGCTGCCTTGGCCCGTGGTGACGGCATCCTCGTCCACTGCCAATGCGGAATCTCACGCTCA
GCTACCATGGTGATCGCCCTCGTCATGCGTGCGGCTACCCTTTGCTCTCCATCCGTACCCCCAGAAGTCTGGAAT
CTCAAGGGCATGCAGGCCGCATATTCTTTTGTCAAGGAAAAAAGCAAGTGGATTGGCCCAAATATGTCTCTTATT
TATGAACTCCTTGACTACGAGAAGAAACTCAAGCCAGATTCCACTTCCCCTGCTCCTTCAGATGCTGGCTCGGCT
GTGACCAGCGAGGAGGAAATATGGTCGAAACAACGGCAGCTCCTCGATGAAATGCCCTCCGACACTGAAAACTCC
GAACGCGACAGCTTCCTCGTCATGCAAGAGGCTCGTGACCTTGACAAAGCCATGGAAAACCGCATTCACGCCGAG
AATCTTGTGGAAGAGGAAGAAGAACCCGAGTTATTGGGCATCGGAGGTGGCTTTGACGATACCCGAGAACGACGC
CGAAGCGCGGATACCTTTGACAGTTCAGCGACCAACTCGCCAGACGACGAAATCGAGGCAACGCCCAGGAACATC
TTTAACCCCCCGTTCACCTCTCGACCTGCGCCTCACCTGCGGCCGCCGCCCTCTGCTCCAGCGTGGAGACAAACC
TTCGATATCCCGCATATCCCGCCTGCCCCTCTAACTGCCGTACGATCGACCTTTGATCTTCCACCCAAACCTAAA
CCCAAAGTACGACGTCGTCCTCCGCCAATCGGTCTTCCTCCGGTTCCCTCTTCTCCCGTCACTCTTGTGATAGAC
GACCAGGGTCCTCATTCTCCGCCTGCTGTGCAGCCCGCAGCCGAATCTACAGTATCCTCGATCCCATTTGCTCCC
TCGTCGCAGCTTCATTCCCCATCACAATCCCTTCCCACCGCAATTGAGACACCTGATCGACCGCCACCGCCTCAC
CGCCCTGCATCCCTCCCCAAGCAAGGTCTACGGCAGCGTGCAGATGCCCGCAAGCCATCACTACCGCCGCAACAC
CTCCTAAGGAGACTCAATGTACGCGAGTCCTCTGCGGCACCGTCTACCGCTACACCGCATCAAACCCTGTTTGTT
TTCCCACCTTCTCCCACCCTCACTATGCGGACCCCATCAGCTGTCATGTTAACGACGCAACCCGCTGAAGTTTTT
GCTCCAAGGAATGGAAAGGTTCCATTTCCGAGCATCTCTACACCTAAAATATCCACTTTCAAGCAGCACGGCCGG
ACGAAATCGTTCATTGGAGTCGGAACGCCCATGACTCCAACTACTGCGTTTACAAAGGCGGAAGCGAGAGGCTAT
TTCGGCCTCGAGTGA
Transcript >Agabi119p4|008210
ATGGGCCCATCTCCTTCGCTCTCTCCCCATCTCTCCCCCATGAGCCGTCGCAAAAACACAAAAAGACTTTCCCTT
TCTCTTCCTCCCCACGACGCCTCTCTCGTCCCCGAACCTTCCCGCCGTCTCTCTACCGCCTCTCTTCCCTCCCCT
GCTCGCCCCACCTCTTCTCTCCTCCATCGCAAGGAAGAAGAGGGCGACTCCCCCACCGTCCCCTATGCCGATGGC
CCCGTTCAGATCATACCCGGCATCTGGCTAGGATCAGAGGACAACGCCCGCGACTGGAAGGACCTCGTCGACCGC
GGTATCAGGGCCATTCTCAACGTAGCCAAGGAAGTCTCGTCTCCTCTGGACGCATTGGCCGCTCAGCCTCTCCGC
TCTACCGTCTCCGTTCCCGATTTGAAATCCCCCTCAGACTCATCCTACTACCCCCCGCATATCCCCAGCGGAAGG
CCTGCCATGCACTACCTCAAACTCCAGTGGTCCCATGGTCAGAAGGATCTCGTCAATGACGGCTTTCAGGCCGGC
TTTCTCTTTACCGATGCTGCCTTGGCCCGTGGTGACGGCATCCTCGTCCACTGCCAATGCGGAATCTCACGCTCA
GCTACCATGGTGATCGCCCTCGTCATGCGTGCGGCTACCCTTTGCTCTCCATCCGTACCCCCAGAAGTCTGGAAT
CTCAAGGGCATGCAGGCCGCATATTCTTTTGTCAAGGAAAAAAGCAAGTGGATTGGCCCAAATATGTCTCTTATT
TATGAACTCCTTGACTACGAGAAGAAACTCAAGCCAGATTCCACTTCCCCTGCTCCTTCAGATGCTGGCTCGGCT
GTGACCAGCGAGGAGGAAATATGGTCGAAACAACGGCAGCTCCTCGATGAAATGCCCTCCGACACTGAAAACTCC
GAACGCGACAGCTTCCTCGTCATGCAAGAGGCTCGTGACCTTGACAAAGCCATGGAAAACCGCATTCACGCCGAG
AATCTTGTGGAAGAGGAAGAAGAACCCGAGTTATTGGGCATCGGAGGTGGCTTTGACGATACCCGAGAACGACGC
CGAAGCGCGGATACCTTTGACAGTTCAGCGACCAACTCGCCAGACGACGAAATCGAGGCAACGCCCAGGAACATC
TTTAACCCCCCGTTCACCTCTCGACCTGCGCCTCACCTGCGGCCGCCGCCCTCTGCTCCAGCGTGGAGACAAACC
TTCGATATCCCGCATATCCCGCCTGCCCCTCTAACTGCCGTACGATCGACCTTTGATCTTCCACCCAAACCTAAA
CCCAAAGTACGACGTCGTCCTCCGCCAATCGGTCTTCCTCCGGTTCCCTCTTCTCCCGTCACTCTTGTGATAGAC
GACCAGGGTCCTCATTCTCCGCCTGCTGTGCAGCCCGCAGCCGAATCTACAGTATCCTCGATCCCATTTGCTCCC
TCGTCGCAGCTTCATTCCCCATCACAATCCCTTCCCACCGCAATTGAGACACCTGATCGACCGCCACCGCCTCAC
CGCCCTGCATCCCTCCCCAAGCAAGGTCTACGGCAGCGTGCAGATGCCCGCAAGCCATCACTACCGCCGCAACAC
CTCCTAAGGAGACTCAATGTACGCGAGTCCTCTGCGGCACCGTCTACCGCTACACCGCATCAAACCCTGTTTGTT
TTCCCACCTTCTCCCACCCTCACTATGCGGACCCCATCAGCTGTCATGTTAACGACGCAACCCGCTGAAGTTTTT
GCTCCAAGGAATGGAAAGGTTCCATTTCCGAGCATCTCTACACCTAAAATATCCACTTTCAAGCAGCACGGCCGG
ACGAAATCGTTCATTGGAGTCGGAACGCCCATGACTCCAACTACTGCGTTTACAAAGGCGGAAGCGAGAGGCTAT
TTCGGCCTCGAGTGA
Gene >Agabi119p4|008210
ATGGGCCCATCTCCTTCGCTCTCTCCCCATCTCTCCCCCATGAGCCGTCGCAAAAACACAAAAAGACTTTCCCTT
TCTCTTCCTCCCCACGACGCCTCTCTCGTCCCCGAACCTTCCCGCCGTCTCTCTACCGCCTCTCTTCCCTCCCCT
GCTCGCCCCACCTCTTCTCTCCTCCATCGCAAGGAAGAAGAGGGCGACTCCCCCACCGTCCCCTATGCCGATGGC
CCCGTTCAGATCATACCCGGCATCTGGCTAGGATCAGAGGACAACGCCCGCGACTGGAAGGACCTCGTCGACCGC
GGTATCAGGGCCATTCTCAACGTAGCCAAGGAAGTCTCGTCTCCTCTGGACGCATTGGCCGCTCAGCCTCTCCGC
TCTACCGTCTCCGTTCCCGATTTGAAATCCCCCTCAGACTCATCCTACTACCCCCCGCATATCCCCAGCGGAAGG
CCTGCCATGCACTACCTCAAACTCCAGTGGTCCCATGGTCAGAAGGATCTCGTCAATGACGGCTTTCAGGCCGGC
TTTCTCTTTACCGATGCTGCCTTGGCCCGTGGTGACGGCATCCTCGTCCAGTCAGTTCATCCCGTCTGACCCCTC
CTTTTCTCTACCTCATCCTCTTTCCAGCTGCCAATGCGGAATCTCACGCTCAGCTACCATGGTGATCGCCCTCGT
CATGCGTGCGGCTACCCTTTGCTCTCCATCCGTACCCCCAGAAGTCTGGAATCTCAAGGGCATGCAGGCCGCATA
TTCTTTTGTCAAGGAAAAAAGCAAGTGGATTGGCCCAAATATGTCGTATGTCTATCAAAAAAAACATTGCCCAGG
TCCCAACATCACGTCACTAATTCACCCCTAGTCTTATTTATGAACTCCTTGACTACGAGAAGAAACTCAAGCCAG
ATTCCACTTCCCCTGCTCCTTCAGATGCTGGCTCGGCTGTGACCAGCGAGGAGGAAATATGGTCGAAACAACGGC
AGCTCCTCGATGAAATGCCCTCCGACACTGAAAACTCCGAACGCGACAGCTTCCTCGTCATGCAAGAGGCTCGTG
ACCTTGACAAAGCCATGGAAAACCGCATTGTAGCTCGCAAGTCATCAACCTCCTCTATCGCCTCCGCCGGATCTG
GATACGGCATGGGCCCCGCTTGGCGAAGCCGCTACAGCACGCGTAAGCGAGCTGGTTCCATCGCCAGCAACATGA
CAAATAACAGCATTATAAGCGAGAATCTTGTGGAAGAGGAAGAAGAACCCGAGTTATTGGGCATCGGAGGTGGCT
TTGACGATACCCGAGAACGACGCCGAAGCGCGGATACCTTTGACAGTTCAGCGACCAACTCGCCAGACGACGAAA
TCGAGGCAACGCCCAGGAACATCTTTAACCCCCCGTTCACCTCTCGACCTGCGCCTCACCTGCGGCCGCCGCCCT
CTGCTCCAGCGTGGAGACAAACCTTCGATATCCCGCATATCCCGCCTGCCCCTCTAACTGCCGTACGATCGACCT
TTGATCTTCCACCCAAACCTAAACCCAAAGTACGACGTCGTCCTCCGCCAATCGGTCTTCCTCCGGTTCCCTCTT
CTCCCGTCACTCTTGTGATAGACGACCAGGGTCCTCATTCTCCGCCTGCTGTGCAGCCCGCAGCCGAATCTACAG
TATCCTCGATCCCATTTGCTCCCTCGTCGCAGCTTCATTCCCCATCACAATCCCTTCCCACCGCAATTGAGACAC
CTGATCGACCGCCACCGCCTCACCGCCCTGCATCCCTCCCCAAGCAAGGTCTACGGCAGCGTGCAGATGCCCGCA
AGCCATCACTACCGCCGCAACACCTCCTAAGGAGACTCAATGTACGCGAGTCCTCTGCGGCACCGTCTACCGCTA
CACCGCATCAAACCCTGTTTGTTTTCCCACCTTCTCCCACCCTCACTATGCGGACCCCATCAGCTGTCATGTTAA
CGACGCAACCCGCTGAAGTTTTTGCTCCAAGGAATGGAAAGGTTCCATTTCCGAGCATCTCTACACCTAAAATAT
CCACTTTCAAGCAGCACGGCCGGACGAAATCGTTCATTGGAGTCGGAACGCCCATGACTCCAACTACTGCGTTTA
CAAAGGCGGAAGCGAGAGGCTATTTCGGCCTCGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail