Agaricus bisporus var burnettii H119p4

General Properties

Protein ID	Agabi119p4\|008130
Gene name
Location	scaffold_01a:1907860..1909270
Strand	+
Gene length (bp)	1410
Transcript length (bp)	1044
Coding sequence length (bp)	1044
Protein length (aa)	348

PFAM Domains

PFAM Domain ID	Short name	Long name	E-value	Start	End
PF00400	WD40	WD domain, G-beta repeat	1.4E-09	53	85
PF00400	WD40	WD domain, G-beta repeat	4.5E-10	90	128
PF00400	WD40	WD domain, G-beta repeat	1.2E-09	135	170
PF00400	WD40	WD domain, G-beta repeat	6.4E-09	175	212
PF00400	WD40	WD domain, G-beta repeat	4.3E-04	216	255
PF00400	WD40	WD domain, G-beta repeat	1.0E-03	261	301
PF00400	WD40	WD domain, G-beta repeat	3.1E-04	306	344
PF12894	ANAPC4_WD40	Anaphase-promoting complex subunit 4 WD40 domain	1.3E-07	56	109

Swissprot hits

[Show all]

Swissprot ID	Swissprot Description	Start	End	E-value
sp\|Q498M4\|WDR5_RAT	WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1	12	344	4.0E-133
sp\|P61965\|WDR5_MOUSE	WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1	12	344	4.0E-133
sp\|P61964\|WDR5_HUMAN	WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1	12	344	4.0E-133
sp\|Q2KIG2\|WDR5_BOVIN	WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1	12	344	2.0E-132
sp\|Q5M786\|WDR5_XENTR	WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1	12	344	5.0E-131

[Show all]

[Show less]

Swissprot ID	Swissprot Description	Start	End	E-value
sp\|Q498M4\|WDR5_RAT	WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1	12	344	4.0E-133
sp\|P61965\|WDR5_MOUSE	WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1	12	344	4.0E-133
sp\|P61964\|WDR5_HUMAN	WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1	12	344	4.0E-133
sp\|Q2KIG2\|WDR5_BOVIN	WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1	12	344	2.0E-132
sp\|Q5M786\|WDR5_XENTR	WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1	12	344	5.0E-131
sp\|Q9V3J8\|WDS_DROME	Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1	46	344	8.0E-128
sp\|Q5RE95\|WDR5B_PONAB	WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1	29	345	2.0E-122
sp\|Q86VZ2\|WDR5B_HUMAN	WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1	21	345	8.0E-122
sp\|Q9D7H2\|WDR5B_MOUSE	WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1	22	344	2.0E-116
sp\|Q54KL5\|WDR5_DICDI	WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1	43	344	3.0E-116
sp\|Q4V8C4\|WDR5B_RAT	WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1	29	344	1.0E-115
sp\|Q9M2Z2\|WDR5A_ARATH	COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1	37	344	2.0E-115
sp\|Q9SY00\|WDR5B_ARATH	COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1	42	344	4.0E-111
sp\|Q17963\|WDR51_CAEEL	WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1	47	344	1.0E-107
sp\|A8X8C6\|TG125_CAEBR	WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1	32	344	7.0E-107
sp\|Q93847\|YZLL_CAEEL	Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1	19	344	9.0E-98
sp\|Q23256\|WDR53_CAEEL	WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1	43	344	1.0E-95
sp\|Q8W1K8\|MUT11_CHLRE	Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1	30	344	2.0E-84
sp\|O43017\|SWD3_SCHPO	Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1	48	275	4.0E-66
sp\|Q8YTC2\|Y2800_NOSS1	Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1	49	344	7.0E-56
sp\|Q8YRI1\|YY46_NOSS1	Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1	26	344	5.0E-55
sp\|Q8YTC2\|Y2800_NOSS1	Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1	66	344	4.0E-54
sp\|Q8YV57\|Y2124_NOSS1	Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1	54	344	6.0E-54
sp\|Q8YTC2\|Y2800_NOSS1	Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1	54	344	2.0E-53
sp\|Q8YRI1\|YY46_NOSS1	Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1	26	344	2.0E-52
sp\|P49695\|PKWA_THECU	Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1	19	344	2.0E-52
sp\|Q8YTC2\|Y2800_NOSS1	Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1	54	344	7.0E-52
sp\|Q00808\|HETE1_PODAS	Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1	54	344	1.0E-51
sp\|Q8YTC2\|Y2800_NOSS1	Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1	54	344	2.0E-51
sp\|Q8YTC2\|Y2800_NOSS1	Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1	64	344	2.0E-50
sp\|C3XVT5\|LIS1_BRAFL	Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1	21	344	1.0E-49
sp\|Q8YRI1\|YY46_NOSS1	Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1	52	344	2.0E-49
sp\|Q8YRI1\|YY46_NOSS1	Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1	54	341	2.0E-49
sp\|Q8N136\|DAW1_HUMAN	Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1	44	344	2.0E-49
sp\|A7S338\|LIS1_NEMVE	Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1	46	344	2.0E-49
sp\|B5X3C4\|LIS1B_SALSA	Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1	46	344	2.0E-49
sp\|Q00808\|HETE1_PODAS	Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1	54	344	3.0E-49
sp\|Q00808\|HETE1_PODAS	Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1	54	344	2.0E-48
sp\|Q8YRI1\|YY46_NOSS1	Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1	52	344	3.0E-48
sp\|Q17N69\|LIS1_AEDAE	Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2	46	344	4.0E-48
sp\|Q4RJN5\|LIS1_TETNG	Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1	46	344	5.0E-48
sp\|Q803D2\|LIS1B_DANRE	Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3	46	344	8.0E-48
sp\|Q8YRI1\|YY46_NOSS1	Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1	52	344	1.0E-47
sp\|B5X3Z6\|LIS1A_SALSA	Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1	46	344	3.0E-47
sp\|Q9PTR5\|LIS1_CHICK	Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3	46	344	4.0E-47
sp\|Q9GL51\|LIS1_PIG	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3	46	344	4.0E-47
sp\|Q8YRI1\|YY46_NOSS1	Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1	54	344	5.0E-47
sp\|Q8YRI1\|YY46_NOSS1	Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1	56	344	5.0E-47
sp\|Q00808\|HETE1_PODAS	Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1	26	336	6.0E-47
sp\|P63004\|LIS1_RAT	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2	46	344	6.0E-47
sp\|P63005\|LIS1_MOUSE	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2	46	344	6.0E-47
sp\|P43034\|LIS1_HUMAN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2	46	344	6.0E-47
sp\|B0LSW3\|LIS1_FELCA	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1	46	344	6.0E-47
sp\|P43033\|LIS1_BOVIN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2	46	344	6.0E-47
sp\|Q0P593\|DAW1_BOVIN	Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1	44	344	6.0E-47
sp\|Q8HXX0\|LIS1_MACFA	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3	46	344	8.0E-47
sp\|Q00808\|HETE1_PODAS	Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1	54	344	9.0E-47
sp\|Q5BK30\|DAW1_RAT	Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1	44	344	1.0E-46
sp\|Q5IS43\|LIS1_PANTR	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3	46	344	1.0E-46
sp\|Q0P593\|DAW1_BOVIN	Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1	16	344	2.0E-46
sp\|Q8I0F4\|LIS1_DICDI	Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1	16	344	2.0E-46
sp\|Q5REG7\|LIS1_PONAB	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3	46	344	3.0E-46
sp\|Q8YRI1\|YY46_NOSS1	Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1	60	344	7.0E-46
sp\|Q4R8E7\|DAW1_MACFA	Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1	44	344	9.0E-46
sp\|Q90ZL4\|LIS1_XENLA	Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3	46	344	9.0E-46
sp\|Q8N136\|DAW1_HUMAN	Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1	37	344	1.0E-45
sp\|Q6NZH4\|LIS1_XENTR	Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3	46	344	1.0E-45
sp\|Q8YV57\|Y2124_NOSS1	Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1	54	344	2.0E-45
sp\|C4Q0P6\|LIS1_SCHMA	Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1	46	344	2.0E-45
sp\|Q7T394\|LIS1A_DANRE	Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3	46	344	2.0E-45
sp\|B3S4I5\|LIS1_TRIAD	Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1	46	344	7.0E-45
sp\|Q5BK30\|DAW1_RAT	Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1	53	344	1.0E-44
sp\|Q8YV57\|Y2124_NOSS1	Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1	54	347	2.0E-44
sp\|Q6P2Y2\|DAW1_XENTR	Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1	44	344	2.0E-44
sp\|Q5FWQ6\|DAW1_XENLA	Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1	44	344	4.0E-44
sp\|Q8YV57\|Y2124_NOSS1	Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1	28	344	1.0E-43
sp\|P49695\|PKWA_THECU	Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1	54	304	1.0E-43
sp\|Q4R8E7\|DAW1_MACFA	Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1	53	344	3.0E-43
sp\|Q8YV57\|Y2124_NOSS1	Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1	59	306	4.0E-43
sp\|B7PS00\|LIS1_IXOSC	Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2	38	344	7.0E-43
sp\|F6ZT52\|POC1B_XENTR	POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1	54	344	1.0E-42
sp\|Q1LV15\|DAW1_DANRE	Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2	44	344	1.0E-42
sp\|Q6P2Y2\|DAW1_XENTR	Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1	1	344	2.0E-42
sp\|Q5XGI5\|WDR83_XENTR	WD repeat domain-containing protein 83 OS=Xenopus tropicalis GN=wdr83 PE=2 SV=1	42	344	2.0E-42
sp\|D3BUN1\|LIS1_POLPA	Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1	38	344	3.0E-42
sp\|Q4V7Z1\|POC1B_XENLA	POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1	44	344	4.0E-42
sp\|Q96DI7\|SNR40_HUMAN	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1	30	347	1.0E-41
sp\|D3TLL6\|LIS1_GLOMM	Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1	46	344	2.0E-41
sp\|Q3Y8L7\|DAW1_CHLRE	Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1	52	344	2.0E-41
sp\|Q3Y8L7\|DAW1_CHLRE	Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1	52	304	2.0E-41
sp\|B4QHG6\|LIS1_DROSI	Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1	46	344	3.0E-41
sp\|B4HSL3\|LIS1_DROSE	Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1	46	344	3.0E-41
sp\|Q7KNS3\|LIS1_DROME	Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2	46	344	3.0E-41
sp\|P0CS42\|LIS1_CRYNJ	Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1	51	337	3.0E-41
sp\|P0CS43\|LIS1_CRYNB	Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1	51	337	3.0E-41
sp\|Q5RF51\|SNR40_PONAB	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1	30	347	3.0E-41
sp\|B4LQ21\|LIS1_DROVI	Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1	46	344	4.0E-41
sp\|B4JWA1\|LIS1_DROGR	Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1	46	344	4.0E-41
sp\|Q6PE01\|SNR40_MOUSE	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1	50	347	4.0E-41
sp\|B4KT48\|LIS1_DROMO	Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1	46	344	5.0E-41
sp\|B4P6P9\|LIS1_DROYA	Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1	46	344	5.0E-41
sp\|B3NPW0\|LIS1_DROER	Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1	46	344	5.0E-41
sp\|Q291L9\|LIS1_DROPS	Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1	46	344	6.0E-41
sp\|B4GAJ1\|LIS1_DROPE	Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1	46	344	6.0E-41
sp\|Q2HJH6\|SNR40_BOVIN	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1	30	347	8.0E-41
sp\|A2CEH0\|POC1B_DANRE	POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1	54	344	1.0E-40
sp\|Q9DAJ4\|WDR83_MOUSE	WD repeat domain-containing protein 83 OS=Mus musculus GN=Wdr83 PE=1 SV=1	42	347	2.0E-40
sp\|Q5BLX8\|WDR83_RAT	WD repeat domain-containing protein 83 OS=Rattus norvegicus GN=Wdr83 PE=1 SV=1	42	347	3.0E-40
sp\|Q1LV15\|DAW1_DANRE	Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2	49	301	4.0E-40
sp\|Q8TC44\|POC1B_HUMAN	POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1	54	347	4.0E-40
sp\|B3MEY6\|LIS1_DROAN	Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1	46	344	4.0E-40
sp\|B4MY65\|LIS1_DROWI	Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1	46	344	5.0E-40
sp\|A8NEG8\|LIS1_COPC7	Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3	46	337	5.0E-40
sp\|Q61FW2\|SEL10_CAEBR	F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1	53	344	5.0E-40
sp\|Q9BRX9\|WDR83_HUMAN	WD repeat domain-containing protein 83 OS=Homo sapiens GN=WDR83 PE=1 SV=1	43	347	7.0E-40
sp\|Q6DH44\|WDR83_DANRE	WD repeat domain-containing protein 83 OS=Danio rerio GN=wdr83 PE=2 SV=1	43	326	7.0E-40
sp\|Q93794\|SEL10_CAEEL	F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3	53	344	1.0E-39
sp\|Q00808\|HETE1_PODAS	Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1	81	344	2.0E-39
sp\|Q5RD06\|POC1B_PONAB	POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1	54	347	2.0E-39
sp\|Q3Y8L7\|DAW1_CHLRE	Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1	6	344	6.0E-39
sp\|Q9VZF4\|FBXW7_DROME	F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1	46	344	7.0E-39
sp\|P38123\|SWD3_YEAST	COMPASS component SWD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWD3 PE=1 SV=1	62	344	7.0E-39
sp\|A9V790\|LIS1_MONBE	Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1	20	344	1.0E-38
sp\|Q9UUG8\|TUP12_SCHPO	Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2	22	344	1.0E-38
sp\|Q4P9P9\|LIS1_USTMA	Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1	51	322	2.0E-38
sp\|D3ZW91\|POC1B_RAT	POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1	43	344	2.0E-38
sp\|B8P4B0\|LIS11_POSPM	Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1	20	344	3.0E-38
sp\|A0DB19\|LIS11_PARTE	Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1	16	344	1.0E-37
sp\|Q54Y96\|SMU1_DICDI	WD40 repeat-containing protein smu1 OS=Dictyostelium discoideum GN=smu1 PE=3 SV=2	56	344	1.0E-37
sp\|B8PD53\|LIS12_POSPM	Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1	20	337	1.0E-37
sp\|Q0U1B1\|LIS1_PHANO	Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1	37	314	2.0E-37
sp\|Q3KQ62\|WDR83_XENLA	WD repeat domain-containing protein 83 OS=Xenopus laevis GN=wdr83 PE=2 SV=1	42	344	3.0E-37
sp\|B6HP56\|LIS11_PENRW	Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1	46	325	3.0E-37
sp\|D1ZEM6\|LIS12_SORMK	Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1	46	313	4.0E-37
sp\|Q7S7L4\|LIS12_NEUCR	Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2	46	313	5.0E-37
sp\|Q969H0\|FBXW7_HUMAN	F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1	47	344	6.0E-37
sp\|F1MNN4\|FBXW7_BOVIN	F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2	47	344	7.0E-37
sp\|Q8VBV4\|FBXW7_MOUSE	F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1	47	344	8.0E-37
sp\|Q8JZX3\|POC1A_MOUSE	POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2	47	301	9.0E-37
sp\|Q8BHD1\|POC1B_MOUSE	POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1	54	344	1.0E-36
sp\|C4YFX2\|TUP1_CANAW	Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1	57	344	1.0E-36
sp\|P0CY34\|TUP1_CANAL	Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1	57	344	1.0E-36
sp\|A0CH87\|LIS12_PARTE	Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1	16	344	2.0E-36
sp\|Q2UGU1\|LIS1_ASPOR	Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2	35	325	2.0E-36
sp\|B8N9H4\|LIS1_ASPFN	Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2	35	325	2.0E-36
sp\|O76734\|TUP1_DICDI	General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1	1	344	4.0E-36
sp\|A7EKM8\|LIS1_SCLS1	Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1	46	326	4.0E-36
sp\|Q8YTC2\|Y2800_NOSS1	Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1	26	263	5.0E-36
sp\|B2VWG7\|LIS1_PYRTR	Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1	46	314	9.0E-36
sp\|Q8JZX3\|POC1A_MOUSE	POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2	42	344	1.0E-35
sp\|A8XZJ9\|LIS1_CAEBR	Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2	4	344	1.0E-35
sp\|Q8YV57\|Y2124_NOSS1	Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1	54	274	2.0E-35
sp\|Q4WLM7\|LIS1_ASPFU	Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1	37	319	2.0E-35
sp\|B0XM00\|LIS1_ASPFC	Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1	37	319	2.0E-35
sp\|Q9NDC9\|LIS1_CAEEL	Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1	4	344	2.0E-35
sp\|Q2TBP4\|POC1A_BOVIN	POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1	47	301	2.0E-35
sp\|Q8NBT0\|POC1A_HUMAN	POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2	47	301	2.0E-35
sp\|A1CUD6\|LIS11_ASPCL	Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1	37	302	4.0E-35
sp\|A1DP19\|LIS1_NEOFI	Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1	46	319	4.0E-35
sp\|P87053\|POF1_SCHPO	F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1	51	345	4.0E-35
sp\|Q8YTC2\|Y2800_NOSS1	Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1	54	222	5.0E-35
sp\|Q9UTC7\|YIDC_SCHPO	Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1	56	345	7.0E-35
sp\|Q9VPR4\|NLE_DROME	Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2	50	344	8.0E-35
sp\|Q7RY30\|LIS11_NEUCR	Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2	35	326	2.0E-34
sp\|Q7ZVF0\|POC1A_DANRE	POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1	44	344	2.0E-34
sp\|B6QC56\|LIS11_TALMQ	Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1	46	326	2.0E-34
sp\|D5GBI7\|LIS1_TUBMM	Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1	38	327	2.0E-34
sp\|A2CEH0\|POC1B_DANRE	POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1	25	300	3.0E-34
sp\|C1GB49\|LIS1_PARBD	Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1	46	314	3.0E-34
sp\|D1ZEB4\|LIS11_SORMK	Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1	35	326	5.0E-34
sp\|Q28I85\|POC1A_XENTR	POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1	43	344	5.0E-34
sp\|C7Z6H2\|LIS1_NECH7	Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1	46	313	5.0E-34
sp\|G0SC29\|NLE1_CHATD	Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2	44	344	5.0E-34
sp\|A1CF18\|LIS12_ASPCL	Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1	46	317	9.0E-34
sp\|C0S902\|LIS1_PARBP	Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2	46	314	9.0E-34
sp\|B2B766\|LIS12_PODAN	Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1	46	320	1.0E-33
sp\|P74442\|Y143_SYNY3	Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1	32	344	1.0E-33
sp\|Q8NBT0\|POC1A_HUMAN	POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2	54	344	2.0E-33
sp\|Q7T0P4\|POC1A_XENLA	POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2	51	300	2.0E-33
sp\|Q2TBP4\|POC1A_BOVIN	POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1	43	344	4.0E-33
sp\|O13282\|TAF5_SCHPO	Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1	54	255	4.0E-33
sp\|O22212\|PRP4L_ARATH	U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1	56	344	4.0E-33
sp\|Q28I85\|POC1A_XENTR	POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1	46	313	6.0E-33
sp\|P38129\|TAF5_YEAST	Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1	54	269	6.0E-33
sp\|Q4ICM0\|LIS1_GIBZE	Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2	46	313	7.0E-33
sp\|C5PFX0\|LIS1_COCP7	Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2	46	302	7.0E-33
sp\|Q2GT28\|LIS12_CHAGB	Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1	46	302	1.0E-32
sp\|B8M0Q1\|LIS1_TALSN	Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1	46	311	1.0E-32
sp\|B7FNU7\|LIS1_PHATC	Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1	46	344	2.0E-32
sp\|P78706\|RCO1_NEUCR	Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2	57	344	2.0E-32
sp\|O74855\|NLE1_SCHPO	Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1	50	344	2.0E-32
sp\|Q15542\|TAF5_HUMAN	Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3	53	255	2.0E-32
sp\|Q8W117\|SMU1_ARATH	Suppressor of mec-8 and unc-52 protein homolog 1 OS=Arabidopsis thaliana GN=SMU1 PE=1 SV=1	36	344	2.0E-32
sp\|Q7T0P4\|POC1A_XENLA	POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2	54	344	3.0E-32
sp\|A2QP30\|LIS1_ASPNC	Nuclear distribution protein nudF OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nudF PE=3 SV=1	51	314	3.0E-32
sp\|P56094\|TUP1_KLULA	General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2	57	344	4.0E-32
sp\|Q8C092\|TAF5_MOUSE	Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1	53	255	4.0E-32
sp\|Q9VZF4\|FBXW7_DROME	F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1	54	346	7.0E-32
sp\|C5JD40\|LIS1_AJEDS	Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1	46	302	8.0E-32
sp\|C5GVJ9\|LIS1_AJEDR	Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1	46	302	8.0E-32
sp\|Q00808\|HETE1_PODAS	Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1	54	299	9.0E-32
sp\|Q54H44\|WDR83_DICDI	WD repeat domain-containing protein 83 homolog OS=Dictyostelium discoideum GN=morg1 PE=3 SV=1	53	344	9.0E-32
sp\|Q6S7B0\|TAF5_ARATH	Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1	53	259	1.0E-31
sp\|Q9VU65\|POC1_DROME	POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1	54	344	1.0E-31
sp\|Q2HBX6\|LIS11_CHAGB	Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1	35	326	1.0E-31
sp\|Q9VPR4\|NLE_DROME	Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2	54	344	2.0E-31
sp\|C4JZS6\|LIS11_UNCRE	Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1	46	320	2.0E-31
sp\|Q55563\|Y163_SYNY3	Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1	53	318	2.0E-31
sp\|Q93794\|SEL10_CAEEL	F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3	52	311	3.0E-31
sp\|Q55AR8\|SNR40_DICDI	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Dictyostelium discoideum GN=snrnp40 PE=3 SV=1	50	343	3.0E-31
sp\|D3BUN1\|LIS1_POLPA	Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1	54	302	4.0E-31
sp\|Q99M63\|SMU1_RAT	WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1	46	344	4.0E-31
sp\|Q3UKJ7\|SMU1_MOUSE	WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2	46	344	4.0E-31
sp\|Q2TAY7\|SMU1_HUMAN	WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2	46	344	4.0E-31
sp\|Q76B40\|SMU1_CRIGR	WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1	46	344	4.0E-31
sp\|Q2TBS9\|SMU1_BOVIN	WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1	46	344	4.0E-31
sp\|P0CS48\|PRP46_CRYNJ	Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1	46	311	5.0E-31
sp\|Q5JTN6\|WDR38_HUMAN	WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1	43	339	5.0E-31
sp\|Q5ZME8\|SMU1_CHICK	WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1	46	344	5.0E-31
sp\|P0CS49\|PRP46_CRYNB	Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1	46	311	5.0E-31
sp\|B6QC06\|LIS12_TALMQ	Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1	57	312	6.0E-31
sp\|B8NGT5\|SCONB_ASPFN	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1	54	336	7.0E-31
sp\|Q2UFN8\|SCONB_ASPOR	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1	54	336	8.0E-31
sp\|Q55563\|Y163_SYNY3	Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1	57	347	9.0E-31
sp\|Q7ZXK9\|NLE1_XENLA	Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1	54	344	1.0E-30
sp\|Q9FLX9\|NLE1_ARATH	Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1	54	344	1.0E-30
sp\|A2QCU8\|SCONB_ASPNC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1	54	336	1.0E-30
sp\|Q6P4J8\|SMU1_XENTR	WD40 repeat-containing protein SMU1 OS=Xenopus tropicalis GN=smu1 PE=2 SV=1	46	344	1.0E-30
sp\|Q55563\|Y163_SYNY3	Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1	31	344	2.0E-30
sp\|B8M7Q5\|SCONB_TALSN	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1	53	322	2.0E-30
sp\|Q6NRT3\|SMU1_XENLA	WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1	46	344	2.0E-30
sp\|B6GZD3\|LIS12_PENRW	Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1	46	320	2.0E-30
sp\|Q09715\|TUP11_SCHPO	Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1	57	344	2.0E-30
sp\|Q6CKE8\|PRP46_KLULA	Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP46 PE=3 SV=1	45	344	3.0E-30
sp\|B2AEZ5\|LIS11_PODAN	Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2	35	326	3.0E-30
sp\|C6HTE8\|LIS1_AJECH	Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1	46	325	3.0E-30
sp\|C0NRC6\|LIS1_AJECG	Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1	46	325	3.0E-30
sp\|Q9D994\|WDR38_MOUSE	WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1	57	344	3.0E-30
sp\|Q00659\|SCONB_EMENI	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2	54	336	4.0E-30
sp\|Q91WQ5\|TAF5L_MOUSE	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1	53	261	4.0E-30
sp\|Q6ZMY6\|WDR88_HUMAN	WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2	50	344	4.0E-30
sp\|Q4WT34\|PRP46_ASPFU	Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1	34	344	5.0E-30
sp\|Q5BE22\|PRP46_EMENI	Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1	53	344	6.0E-30
sp\|P78706\|RCO1_NEUCR	Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2	66	301	7.0E-30
sp\|B6Q4Z5\|SCONB_TALMQ	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1	53	336	7.0E-30
sp\|Q0CY32\|SCONB_ASPTN	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1	54	336	8.0E-30
sp\|F6ZT52\|POC1B_XENTR	POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1	53	254	1.0E-29
sp\|Q969H0\|FBXW7_HUMAN	F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1	73	311	1.0E-29
sp\|Q5JTN6\|WDR38_HUMAN	WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1	93	344	1.0E-29
sp\|Q0D0X6\|LIS1_ASPTN	Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1	20	311	1.0E-29
sp\|Q8VEJ4\|NLE1_MOUSE	Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4	54	344	2.0E-29
sp\|Q229Z6\|POC1_TETTS	POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1	46	343	2.0E-29
sp\|Q00664\|LIS1_EMENI	Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudF PE=1 SV=1	16	320	2.0E-29
sp\|Q3MHE2\|PRP4_BOVIN	U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1	56	347	2.0E-29
sp\|F1MNN4\|FBXW7_BOVIN	F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2	73	311	3.0E-29
sp\|Q6P5M2\|WDR61_DANRE	WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1	47	301	3.0E-29
sp\|Q5RFF8\|NLE1_PONAB	Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3	54	344	3.0E-29
sp\|C1GB49\|LIS1_PARBD	Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1	94	344	4.0E-29
sp\|A4R3M4\|LIS1_MAGO7	Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3	46	338	4.0E-29
sp\|Q5NVD0\|PRP4_PONAB	U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1	56	347	4.0E-29
sp\|C0S902\|LIS1_PARBP	Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2	94	344	5.0E-29
sp\|Q58D20\|NLE1_BOVIN	Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3	54	344	5.0E-29
sp\|O75529\|TAF5L_HUMAN	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1	53	262	5.0E-29
sp\|A1DP19\|LIS1_NEOFI	Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1	94	344	6.0E-29
sp\|O43172\|PRP4_HUMAN	U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2	56	347	6.0E-29
sp\|Q9NVX2\|NLE1_HUMAN	Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4	54	344	6.0E-29
sp\|Q4X0A9\|SCONB_ASPFU	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1	54	336	6.0E-29
sp\|B0XTS1\|SCONB_ASPFC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1	54	336	6.0E-29
sp\|Q8VBV4\|FBXW7_MOUSE	F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1	73	311	7.0E-29
sp\|Q9DAW6\|PRP4_MOUSE	U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1	56	347	7.0E-29
sp\|Q4WLM7\|LIS1_ASPFU	Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1	94	344	9.0E-29
sp\|B0XM00\|LIS1_ASPFC	Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1	94	344	9.0E-29
sp\|P20053\|PRP4_YEAST	U4/U6 small nuclear ribonucleoprotein PRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP4 PE=1 SV=1	31	255	1.0E-28
sp\|A1C7E4\|SCONB_ASPCL	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1	54	336	1.0E-28
sp\|Q15542\|TAF5_HUMAN	Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3	18	344	2.0E-28
sp\|Q55563\|Y163_SYNY3	Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1	53	344	2.0E-28
sp\|Q3MHE2\|PRP4_BOVIN	U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1	54	300	2.0E-28
sp\|P93107\|PF20_CHLRE	Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1	54	344	2.0E-28
sp\|Q75BY3\|PRP46_ASHGO	Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2	36	344	2.0E-28
sp\|P93340\|GBLP_NICPL	Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1	9	258	2.0E-28
sp\|A1DHW6\|SCONB_NEOFI	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1	54	336	2.0E-28
sp\|Q8K450\|SPG16_MOUSE	Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1	46	300	2.0E-28
sp\|O74319\|TAF73_SCHPO	Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1	3	255	3.0E-28
sp\|P53622\|COPA_YEAST	Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2	57	333	3.0E-28
sp\|Q7ZVA0\|SMU1_DANRE	WD40 repeat-containing protein SMU1 OS=Danio rerio GN=smu1 PE=2 SV=1	46	344	3.0E-28
sp\|Q0U1B1\|LIS1_PHANO	Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1	94	344	4.0E-28
sp\|B2VWG7\|LIS1_PYRTR	Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1	94	344	4.0E-28
sp\|P49846\|TAF5_DROME	Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1	18	344	4.0E-28
sp\|O18640\|GBLP_DROME	Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2	44	302	4.0E-28
sp\|P16649\|TUP1_YEAST	General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2	103	322	4.0E-28
sp\|Q8C092\|TAF5_MOUSE	Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1	18	344	5.0E-28
sp\|Q5NVD0\|PRP4_PONAB	U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1	54	300	5.0E-28
sp\|O43172\|PRP4_HUMAN	U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2	54	300	5.0E-28
sp\|Q01369\|GBLP_NEUCR	Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1	40	305	6.0E-28
sp\|Q9DAW6\|PRP4_MOUSE	U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1	54	300	7.0E-28
sp\|Q969H0\|FBXW7_HUMAN	F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1	54	266	8.0E-28
sp\|Q5RFF8\|NLE1_PONAB	Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3	50	344	8.0E-28
sp\|Q6P1V3\|WSB1_XENTR	WD repeat and SOCS box-containing protein 1 OS=Xenopus tropicalis GN=wsb1 PE=2 SV=1	64	311	8.0E-28
sp\|C4JPW9\|LIS12_UNCRE	Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1	26	314	9.0E-28
sp\|F1MNN4\|FBXW7_BOVIN	F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2	54	266	1.0E-27
sp\|A1CUD6\|LIS11_ASPCL	Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1	94	344	1.0E-27
sp\|Q55563\|Y163_SYNY3	Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1	54	344	1.0E-27
sp\|Q9NVX2\|NLE1_HUMAN	Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4	50	344	1.0E-27
sp\|P74598\|Y1491_SYNY3	Uncharacterized WD repeat-containing protein sll1491 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1491 PE=3 SV=1	54	344	1.0E-27
sp\|Q8VBV4\|FBXW7_MOUSE	F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1	54	266	2.0E-27
sp\|Q6FJZ9\|PRP46_CANGA	Pre-mRNA-splicing factor PRP46 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP46 PE=3 SV=1	53	344	2.0E-27
sp\|Q05946\|UTP13_YEAST	U3 small nucleolar RNA-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP13 PE=1 SV=1	56	211	2.0E-27
sp\|O13615\|PRP46_SCHPO	Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1	53	344	2.0E-27
sp\|Q4P9P9\|LIS1_USTMA	Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1	75	344	3.0E-27
sp\|D5GBI7\|LIS1_TUBMM	Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1	47	250	3.0E-27
sp\|O24076\|GBLP_MEDSA	Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1	9	258	3.0E-27
sp\|Q42384\|PRL1_ARATH	Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1	53	347	3.0E-27
sp\|Q12417\|PRP46_YEAST	Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1	53	344	3.0E-27
sp\|B2B766\|LIS12_PODAN	Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1	94	344	4.0E-27
sp\|Q0J3D9\|COPA3_ORYSJ	Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1	57	333	4.0E-27
sp\|D3ZW91\|POC1B_RAT	POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1	48	217	5.0E-27
sp\|B6HP56\|LIS11_PENRW	Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1	94	344	5.0E-27
sp\|Q6S7B0\|TAF5_ARATH	Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1	2	344	5.0E-27
sp\|Q9LV28\|GPLPC_ARATH	Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1	9	302	5.0E-27
sp\|P49846\|TAF5_DROME	Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1	54	256	6.0E-27
sp\|Q8K3E5\|AHI1_MOUSE	Jouberin OS=Mus musculus GN=Ahi1 PE=1 SV=2	52	345	6.0E-27
sp\|P49026\|GBLP_TOBAC	Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1	9	258	6.0E-27
sp\|Q6P5M2\|WDR61_DANRE	WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1	73	344	7.0E-27
sp\|Q6DTM3\|AHI1_RAT	Jouberin OS=Rattus norvegicus GN=Ahi1 PE=1 SV=1	52	345	8.0E-27
sp\|Q8BHD1\|POC1B_MOUSE	POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1	48	211	9.0E-27
sp\|Q9AUR8\|COPA1_ORYSJ	Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1	57	333	9.0E-27
sp\|Q91WQ5\|TAF5L_MOUSE	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1	44	218	1.0E-26
sp\|O75529\|TAF5L_HUMAN	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1	44	218	1.0E-26
sp\|Q9BVA0\|KTNB1_HUMAN	Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1	54	261	1.0E-26
sp\|Q39836\|GBLP_SOYBN	Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1	9	258	1.0E-26
sp\|Q9USN3\|UTP13_SCHPO	Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3	53	308	1.0E-26
sp\|C5FWH1\|LIS1_ARTOC	Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1	46	326	1.0E-26
sp\|Q8BG40\|KTNB1_MOUSE	Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1	54	261	1.0E-26
sp\|Q9AUR7\|COPA2_ORYSJ	Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1	57	333	1.0E-26
sp\|Q8VEJ4\|NLE1_MOUSE	Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4	50	344	2.0E-26
sp\|Q55DA2\|CIAO1_DICDI	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Dictyostelium discoideum GN=ciao1 PE=3 SV=1	54	214	2.0E-26
sp\|Q9C4Z6\|GPLPB_ARATH	Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1	54	302	2.0E-26
sp\|Q8N0X2\|SPG16_HUMAN	Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2	56	301	2.0E-26
sp\|Q5RD06\|POC1B_PONAB	POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1	48	211	3.0E-26
sp\|P87053\|POF1_SCHPO	F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1	48	300	3.0E-26
sp\|D5GBI7\|LIS1_TUBMM	Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1	94	344	3.0E-26
sp\|Q55563\|Y163_SYNY3	Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1	53	304	3.0E-26
sp\|Q0D0X6\|LIS1_ASPTN	Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1	93	344	3.0E-26
sp\|Q9QXE7\|TBL1X_MOUSE	F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2	37	313	3.0E-26
sp\|Q39190\|PRL2_ARATH	Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2	53	347	3.0E-26
sp\|Q0U1B1\|LIS1_PHANO	Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1	47	238	4.0E-26
sp\|C5JD40\|LIS1_AJEDS	Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1	47	224	4.0E-26
sp\|C5GVJ9\|LIS1_AJEDR	Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1	47	224	4.0E-26
sp\|Q9FLX9\|NLE1_ARATH	Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1	49	169	4.0E-26
sp\|Q28D01\|WDR26_XENTR	WD repeat-containing protein 26 OS=Xenopus tropicalis GN=wdr26 PE=2 SV=2	108	344	4.0E-26
sp\|O43660\|PLRG1_HUMAN	Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1	46	304	4.0E-26
sp\|Q8TC44\|POC1B_HUMAN	POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1	48	211	5.0E-26
sp\|Q8BHJ5\|TBL1R_MOUSE	F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1	59	313	5.0E-26
sp\|Q2KID6\|PLRG1_BOVIN	Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1	46	304	5.0E-26
sp\|Q9BZK7\|TBL1R_HUMAN	F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1	59	313	5.0E-26
sp\|Q8L4J2\|CTF50_ARATH	Cleavage stimulation factor subunit 50 OS=Arabidopsis thaliana GN=CSTF50 PE=1 SV=1	54	344	5.0E-26
sp\|Q5JTN6\|WDR38_HUMAN	WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1	17	252	6.0E-26
sp\|C5FP68\|SCONB_ARTOC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1	54	336	6.0E-26
sp\|Q7SZM9\|TB1RA_XENLA	F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1	59	313	7.0E-26
sp\|Q6GPC6\|TB1RB_XENLA	F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1	59	313	7.0E-26
sp\|Q09855\|POF11_SCHPO	F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2	111	344	7.0E-26
sp\|P39014\|MET30_YEAST	F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1	54	315	7.0E-26
sp\|O22212\|PRP4L_ARATH	U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1	53	300	8.0E-26
sp\|B6Q4Z5\|SCONB_TALMQ	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1	54	303	8.0E-26
sp\|C1GB49\|LIS1_PARBD	Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1	54	238	9.0E-26
sp\|Q9USN3\|UTP13_SCHPO	Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3	40	254	9.0E-26
sp\|P62884\|GBLP_LEIIN	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1	42	302	9.0E-26
sp\|P62883\|GBLP_LEICH	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1	42	302	9.0E-26
sp\|Q9WUC8\|PLRG1_RAT	Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1	46	304	9.0E-26
sp\|Q8BHJ5\|TBL1R_MOUSE	F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1	54	267	1.0E-25
sp\|Q9BZK7\|TBL1R_HUMAN	F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1	54	267	1.0E-25
sp\|Q25306\|GBLP_LEIMA	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1	42	302	1.0E-25
sp\|Q6GMD2\|WDR61_XENLA	WD repeat-containing protein 61 OS=Xenopus laevis GN=wdr61 PE=2 SV=1	47	301	1.0E-25
sp\|O60907\|TBL1X_HUMAN	F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3	37	313	1.0E-25
sp\|Q6C709\|PRP46_YARLI	Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2	23	347	1.0E-25
sp\|O61585\|KTNB1_STRPU	Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1	54	267	1.0E-25
sp\|Q0V8J1\|WSB2_BOVIN	WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1	61	301	1.0E-25
sp\|P54313\|GBB2_RAT	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4	47	344	1.0E-25
sp\|P62880\|GBB2_MOUSE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3	47	344	1.0E-25
sp\|P62879\|GBB2_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3	47	344	1.0E-25
sp\|P11017\|GBB2_BOVIN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3	47	344	1.0E-25
sp\|B2VWG7\|LIS1_PYRTR	Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1	47	238	2.0E-25
sp\|C0S902\|LIS1_PARBP	Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2	54	238	2.0E-25
sp\|Q58D20\|NLE1_BOVIN	Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3	50	344	2.0E-25
sp\|P93107\|PF20_CHLRE	Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1	56	301	2.0E-25
sp\|Q6GPC6\|TB1RB_XENLA	F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1	54	267	2.0E-25
sp\|Q95RJ9\|EBI_DROME	F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2	54	267	2.0E-25
sp\|Q8N157\|AHI1_HUMAN	Jouberin OS=Homo sapiens GN=AHI1 PE=1 SV=1	52	345	2.0E-25
sp\|Q922V4\|PLRG1_MOUSE	Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1	46	304	2.0E-25
sp\|Q5SP67\|WDR26_DANRE	WD repeat-containing protein 26 OS=Danio rerio GN=wdr26 PE=1 SV=1	108	344	2.0E-25
sp\|P53699\|CDC4_CANAX	Cell division control protein 4 OS=Candida albicans GN=CDC4 PE=3 SV=1	46	344	2.0E-25
sp\|Q7ZUV2\|KTNB1_DANRE	Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1	54	219	2.0E-25
sp\|Q6PH57\|GBB1_DANRE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1	32	344	2.0E-25
sp\|Q9NYS7\|WSB2_HUMAN	WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1	61	301	2.0E-25
sp\|Q96WV5\|COPA_SCHPO	Putative coatomer subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPJ4664.04 PE=1 SV=1	56	333	2.0E-25
sp\|Q7SZM9\|TB1RA_XENLA	F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1	54	267	3.0E-25
sp\|Q9BQ87\|TBL1Y_HUMAN	F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1	37	313	3.0E-25
sp\|B0XAF3\|CIAO1_CULQU	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1	45	211	3.0E-25
sp\|Q9UT85\|YIPC_SCHPO	Uncharacterized WD repeat-containing protein C343.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC343.04c PE=3 SV=1	49	344	3.0E-25
sp\|O54929\|WSB2_MOUSE	WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2	61	301	3.0E-25
sp\|Q9C1X0\|YN55_SCHPO	Uncharacterized WD repeat-containing protein C713.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC713.05 PE=3 SV=1	53	310	3.0E-25
sp\|B6GZD3\|LIS12_PENRW	Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1	93	344	4.0E-25
sp\|P17343\|GBB1_CAEEL	Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2	24	318	4.0E-25
sp\|Q61ZF6\|GBB1_CAEBR	Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1	24	318	4.0E-25
sp\|D4D8P3\|SCONB_TRIVH	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1	54	344	4.0E-25
sp\|P49027\|GBLPA_ORYSJ	Guanine nucleotide-binding protein subunit beta-like protein A OS=Oryza sativa subsp. japonica GN=RACK1A PE=1 SV=1	50	263	4.0E-25
sp\|Q7PS24\|CIAO1_ANOGA	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3	44	211	4.0E-25
sp\|D4AM37\|SCONB_ARTBC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1	54	344	4.0E-25
sp\|P25382\|NLE1_YEAST	Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3	3	344	4.0E-25
sp\|Q7RY30\|LIS11_NEUCR	Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2	54	251	5.0E-25
sp\|P38129\|TAF5_YEAST	Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1	59	303	5.0E-25
sp\|B6QC06\|LIS12_TALMQ	Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1	95	344	5.0E-25
sp\|Q7ZXK9\|NLE1_XENLA	Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1	54	344	5.0E-25
sp\|C5FP68\|SCONB_ARTOC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1	53	221	5.0E-25
sp\|Q94A40\|COPA1_ARATH	Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2	57	333	5.0E-25
sp\|B7QKS1\|CIAO1_IXOSC	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Ixodes scapularis GN=ISCW023049 PE=3 SV=1	54	344	5.0E-25
sp\|Q9Y6I7\|WSB1_HUMAN	WD repeat and SOCS box-containing protein 1 OS=Homo sapiens GN=WSB1 PE=1 SV=1	64	307	5.0E-25
sp\|B4QFZ8\|CIAO1_DROSI	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila simulans GN=Ciao1 PE=3 SV=1	52	213	6.0E-25
sp\|P79147\|GBB3_CANLF	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Canis lupus familiaris GN=GNB3 PE=2 SV=1	47	344	6.0E-25
sp\|Q8BHD1\|POC1B_MOUSE	POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1	95	333	7.0E-25
sp\|Q7K1Y4\|CIAO1_DROME	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila melanogaster GN=Ciao1 PE=1 SV=1	52	213	7.0E-25
sp\|B3NQR5\|CIAO1_DROER	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila erecta GN=Ciao1 PE=3 SV=1	52	213	7.0E-25
sp\|Q6L4F8\|GBLPB_ORYSJ	Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1	26	302	7.0E-25
sp\|A8IZG4\|CIAO1_CHLRE	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1	48	272	7.0E-25
sp\|Q4V7Y7\|KTNB1_XENLA	Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1	54	264	8.0E-25
sp\|Q6S7B0\|TAF5_ARATH	Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1	47	204	9.0E-25
sp\|B4HRQ6\|CIAO1_DROSE	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila sechellia GN=Ciao1 PE=3 SV=1	52	213	9.0E-25
sp\|P63245\|GBLP_RAT	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3	50	302	9.0E-25
sp\|P63246\|GBLP_PIG	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3	50	302	9.0E-25
sp\|P68040\|GBLP_MOUSE	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3	50	302	9.0E-25
sp\|Q4R7Y4\|GBLP_MACFA	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3	50	302	9.0E-25
sp\|P63244\|GBLP_HUMAN	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3	50	302	9.0E-25
sp\|P63247\|GBLP_CHICK	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1	50	302	9.0E-25
sp\|P63243\|GBLP_BOVIN	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3	50	302	9.0E-25
sp\|B8M7Q5\|SCONB_TALSN	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1	54	299	1.0E-24
sp\|Q9USN3\|UTP13_SCHPO	Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3	72	346	1.0E-24
sp\|Q7T2F6\|WSB1_DANRE	WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1	64	300	1.0E-24
sp\|Q17GR9\|CIAO1_AEDAE	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1	53	241	1.0E-24
sp\|Q4R8H1\|TBL1X_MACFA	F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1	37	313	1.0E-24
sp\|Q9SJT9\|COPA2_ARATH	Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1	57	333	1.0E-24
sp\|B4P7Q3\|CIAO1_DROYA	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1	52	213	1.0E-24
sp\|P25635\|PWP2_YEAST	Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2	55	344	1.0E-24
sp\|B4MY77\|CIAO1_DROWI	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1	52	213	1.0E-24
sp\|O76734\|TUP1_DICDI	General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1	56	258	2.0E-24
sp\|Q2TBP4\|POC1A_BOVIN	POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1	52	220	2.0E-24
sp\|B8M0Q1\|LIS1_TALSN	Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1	48	249	2.0E-24
sp\|Q09855\|POF11_SCHPO	F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2	52	302	2.0E-24
sp\|Q9NYS7\|WSB2_HUMAN	WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1	54	257	2.0E-24
sp\|Q6CG48\|LIS1_YARLI	Nuclear distribution protein PAC1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAC1 PE=3 SV=1	43	344	2.0E-24
sp\|P52287\|GBB3_RAT	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Rattus norvegicus GN=Gnb3 PE=1 SV=1	47	344	2.0E-24
sp\|Q6PBD6\|WDR61_XENTR	WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1	54	301	2.0E-24
sp\|Q292E8\|CIAO1_DROPS	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila pseudoobscura pseudoobscura GN=Ciao1 PE=3 SV=1	52	213	2.0E-24
sp\|B4GDM7\|CIAO1_DROPE	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila persimilis GN=Ciao1 PE=3 SV=2	52	213	2.0E-24
sp\|A7RWD2\|CIAO1_NEMVE	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1	52	211	2.0E-24
sp\|P46800\|GBLP_DICDI	Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2	37	311	2.0E-24
sp\|P83774\|GBLP_CANAL	Guanine nucleotide-binding protein subunit beta-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASC1 PE=1 SV=2	50	304	2.0E-24
sp\|Q09715\|TUP11_SCHPO	Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1	18	344	3.0E-24
sp\|D4DG66\|LIS1_TRIVH	Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1	47	235	3.0E-24
sp\|D4AZ50\|LIS1_ARTBC	Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1	47	235	3.0E-24
sp\|Q86TI4\|WDR86_HUMAN	WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3	57	324	3.0E-24
sp\|Q9EPV5\|APAF_RAT	Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1	39	344	3.0E-24
sp\|P78706\|RCO1_NEUCR	Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2	51	256	4.0E-24
sp\|P53622\|COPA_YEAST	Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2	64	344	4.0E-24
sp\|Q0V8J1\|WSB2_BOVIN	WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1	54	257	4.0E-24
sp\|O54929\|WSB2_MOUSE	WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2	54	257	4.0E-24
sp\|O15736\|TIPD_DICDI	Protein tipD OS=Dictyostelium discoideum GN=tipD PE=3 SV=1	55	344	4.0E-24
sp\|B4J8H6\|WDR48_DROGR	WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1	57	299	4.0E-24
sp\|Q61011\|GBB3_MOUSE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus GN=Gnb3 PE=1 SV=2	47	344	4.0E-24
sp\|Q8NBT0\|POC1A_HUMAN	POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2	52	214	5.0E-24
sp\|B3MC74\|CIAO1_DROAN	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila ananassae GN=Ciao1 PE=3 SV=1	52	213	5.0E-24
sp\|Q28YY2\|WDR48_DROPS	WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2	57	299	5.0E-24
sp\|B4GIJ0\|WDR48_DROPE	WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1	57	299	5.0E-24
sp\|O88879\|APAF_MOUSE	Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3	39	344	5.0E-24
sp\|Q12788\|TBL3_HUMAN	Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2	57	344	5.0E-24
sp\|Q15542\|TAF5_HUMAN	Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3	59	301	6.0E-24
sp\|Q7ZUV2\|KTNB1_DANRE	Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1	54	261	6.0E-24
sp\|D4DG66\|LIS1_TRIVH	Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1	46	326	6.0E-24
sp\|D4AZ50\|LIS1_ARTBC	Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1	46	326	6.0E-24
sp\|Q86TI4\|WDR86_HUMAN	WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3	73	303	6.0E-24
sp\|Q55FR9\|COPA_DICDI	Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1	57	333	6.0E-24
sp\|Q8YTC2\|Y2800_NOSS1	Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1	53	182	7.0E-24
sp\|O61585\|KTNB1_STRPU	Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1	54	325	7.0E-24
sp\|Q95RJ9\|EBI_DROME	F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2	37	313	7.0E-24
sp\|P90648\|MHCKB_DICDI	Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1	73	344	7.0E-24
sp\|Q6NVM2\|KTNB1_XENTR	Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1	54	264	7.0E-24
sp\|Q91854\|TRCB_XENLA	Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1	91	344	7.0E-24
sp\|Q39336\|GBLP_BRANA	Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1	9	258	7.0E-24
sp\|P49695\|PKWA_THECU	Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1	44	172	8.0E-24
sp\|Q5R5W8\|GBB1_PONAB	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Pongo abelii GN=GNB1 PE=2 SV=3	32	344	8.0E-24
sp\|Q8CIE6\|COPA_MOUSE	Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2	57	333	8.0E-24
sp\|Q8C092\|TAF5_MOUSE	Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1	56	246	9.0E-24
sp\|Q9D994\|WDR38_MOUSE	WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1	19	222	9.0E-24
sp\|Q9H7D7\|WDR26_HUMAN	WD repeat-containing protein 26 OS=Homo sapiens GN=WDR26 PE=1 SV=3	108	344	9.0E-24
sp\|B4P7H8\|WDR48_DROYA	WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1	57	299	9.0E-24
sp\|Q27954\|COPA_BOVIN	Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1	57	333	9.0E-24
sp\|B6HP56\|LIS11_PENRW	Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1	47	249	1.0E-23
sp\|Q8JZX3\|POC1A_MOUSE	POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2	49	214	1.0E-23
sp\|C7Z6H2\|LIS1_NECH7	Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1	94	344	1.0E-23
sp\|P38129\|TAF5_YEAST	Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1	93	344	1.0E-23
sp\|Q8C092\|TAF5_MOUSE	Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1	59	301	1.0E-23
sp\|B6GZD3\|LIS12_PENRW	Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1	45	303	1.0E-23
sp\|Q9D994\|WDR38_MOUSE	WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1	54	292	1.0E-23
sp\|O18640\|GBLP_DROME	Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2	87	344	1.0E-23
sp\|O61585\|KTNB1_STRPU	Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1	54	248	1.0E-23
sp\|D4D8P3\|SCONB_TRIVH	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1	53	219	1.0E-23
sp\|D4AM37\|SCONB_ARTBC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1	53	219	1.0E-23
sp\|A7RWD2\|CIAO1_NEMVE	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1	54	344	1.0E-23
sp\|P46800\|GBLP_DICDI	Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2	93	344	1.0E-23
sp\|P90648\|MHCKB_DICDI	Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1	54	300	1.0E-23
sp\|Q5SRY7\|FBW1B_MOUSE	F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1	53	256	1.0E-23
sp\|P53621\|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2	57	333	1.0E-23
sp\|Q9UKB1\|FBW1B_HUMAN	F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1	53	256	1.0E-23
sp\|Q5ZIU8\|KTNB1_CHICK	Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2	54	223	1.0E-23
sp\|B3NSK1\|WDR48_DROER	WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1	57	299	1.0E-23
sp\|B3MET8\|WDR48_DROAN	WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1	57	299	1.0E-23
sp\|Q09990\|LIN23_CAEEL	F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2	53	256	1.0E-23
sp\|O54927\|WSB1_MOUSE	WD repeat and SOCS box-containing protein 1 OS=Mus musculus GN=Wsb1 PE=1 SV=1	64	307	1.0E-23
sp\|Q5FWQ6\|DAW1_XENLA	Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1	135	344	2.0E-23
sp\|A1CUD6\|LIS11_ASPCL	Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1	54	224	2.0E-23
sp\|Q9UTC7\|YIDC_SCHPO	Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1	47	257	2.0E-23
sp\|Q4ICM0\|LIS1_GIBZE	Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2	94	344	2.0E-23
sp\|Q15542\|TAF5_HUMAN	Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3	56	246	2.0E-23
sp\|Q09990\|LIN23_CAEEL	F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2	55	304	2.0E-23
sp\|O54927\|WSB1_MOUSE	WD repeat and SOCS box-containing protein 1 OS=Mus musculus GN=Wsb1 PE=1 SV=1	54	257	2.0E-23
sp\|O24456\|GBLPA_ARATH	Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2	9	258	2.0E-23
sp\|B4QB64\|WDR48_DROSI	WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1	57	299	2.0E-23
sp\|Q3ULA2\|FBW1A_MOUSE	F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2	91	344	2.0E-23
sp\|Q5GIS3\|GBB_PINFU	Guanine nucleotide-binding protein subunit beta OS=Pinctada fucata PE=1 SV=1	47	344	2.0E-23
sp\|Q21215\|GBLP_CAEEL	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans GN=rack-1 PE=1 SV=3	46	305	2.0E-23
sp\|O43071\|PRP17_SCHPO	Pre-mRNA-processing factor 17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp17 PE=1 SV=1	52	344	2.0E-23
sp\|P16520\|GBB3_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens GN=GNB3 PE=1 SV=1	47	344	2.0E-23
sp\|B4HND9\|WDR48_DROSE	WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1	57	299	2.0E-23
sp\|Q9Y297\|FBW1A_HUMAN	F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1	91	344	2.0E-23
sp\|Q6BU94\|PRP46_DEBHA	Pre-mRNA-splicing factor PRP46 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP46 PE=3 SV=2	8	347	2.0E-23
sp\|B3RNR8\|CIAO1_TRIAD	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_20668 PE=3 SV=1	44	221	2.0E-23
sp\|Q1LZ08\|WDR48_DROME	WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1	57	299	2.0E-23
sp\|Q8VEJ4\|NLE1_MOUSE	Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4	44	301	3.0E-23
sp\|A1DHW6\|SCONB_NEOFI	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1	53	344	3.0E-23
sp\|Q6P1V3\|WSB1_XENTR	WD repeat and SOCS box-containing protein 1 OS=Xenopus tropicalis GN=wsb1 PE=2 SV=1	54	257	3.0E-23
sp\|Q9Y6I7\|WSB1_HUMAN	WD repeat and SOCS box-containing protein 1 OS=Homo sapiens GN=WSB1 PE=1 SV=1	54	257	3.0E-23
sp\|Q5ZJH5\|WDR61_CHICK	WD repeat-containing protein 61 OS=Gallus gallus GN=WDR61 PE=2 SV=1	51	301	3.0E-23
sp\|Q8H0T9\|KTNB1_ARATH	Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3	49	261	3.0E-23
sp\|P07834\|CDC4_YEAST	Cell division control protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC4 PE=1 SV=2	51	338	3.0E-23
sp\|P36408\|GBB_DICDI	Guanine nucleotide-binding protein subunit beta OS=Dictyostelium discoideum GN=gpbA PE=1 SV=1	47	344	3.0E-23
sp\|P54311\|GBB1_RAT	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Rattus norvegicus GN=Gnb1 PE=1 SV=4	32	344	3.0E-23
sp\|P62874\|GBB1_MOUSE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus GN=Gnb1 PE=1 SV=3	32	344	3.0E-23
sp\|P62873\|GBB1_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens GN=GNB1 PE=1 SV=3	32	344	3.0E-23
sp\|P62872\|GBB1_CANLF	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Canis lupus familiaris GN=GNB1 PE=2 SV=3	32	344	3.0E-23
sp\|P62871\|GBB1_BOVIN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Bos taurus GN=GNB1 PE=1 SV=3	32	344	3.0E-23
sp\|Q8C6G8\|WDR26_MOUSE	WD repeat-containing protein 26 OS=Mus musculus GN=Wdr26 PE=1 SV=3	108	344	3.0E-23
sp\|C5PFX0\|LIS1_COCP7	Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2	47	238	4.0E-23
sp\|Q5ZIU8\|KTNB1_CHICK	Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2	54	229	4.0E-23
sp\|O74855\|NLE1_SCHPO	Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1	54	344	5.0E-23
sp\|Q7T2F6\|WSB1_DANRE	WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1	54	277	5.0E-23
sp\|B4MFM2\|WDR48_DROVI	WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1	57	299	5.0E-23
sp\|P69104\|GBLP_TRYBR	Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1	54	311	5.0E-23
sp\|P69103\|GBLP_TRYBB	Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1	54	311	5.0E-23
sp\|P63245\|GBLP_RAT	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3	87	344	6.0E-23
sp\|P63246\|GBLP_PIG	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3	87	344	6.0E-23
sp\|P68040\|GBLP_MOUSE	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3	87	344	6.0E-23
sp\|Q4R7Y4\|GBLP_MACFA	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3	87	344	6.0E-23
sp\|P63244\|GBLP_HUMAN	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3	87	344	6.0E-23
sp\|P63247\|GBLP_CHICK	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1	87	344	6.0E-23
sp\|P63243\|GBLP_BOVIN	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3	87	344	6.0E-23
sp\|B4KTK4\|CIAO1_DROMO	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1	52	213	6.0E-23
sp\|B4KRQ4\|WDR48_DROMO	WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1	57	299	6.0E-23
sp\|Q54LT8\|STRAP_DICDI	Serine-threonine kinase receptor-associated protein OS=Dictyostelium discoideum GN=strap PE=3 SV=1	52	344	6.0E-23
sp\|B4JW81\|CIAO1_DROGR	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila grimshawi GN=Ciao1 PE=3 SV=1	52	213	7.0E-23
sp\|O61585\|KTNB1_STRPU	Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1	127	344	8.0E-23
sp\|Q3ULA2\|FBW1A_MOUSE	F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2	44	260	8.0E-23
sp\|B4LJT7\|CIAO1_DROVI	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila virilis GN=Ciao1 PE=3 SV=1	52	213	8.0E-23
sp\|O74855\|NLE1_SCHPO	Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1	49	169	9.0E-23
sp\|Q4X0A9\|SCONB_ASPFU	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1	53	344	9.0E-23
sp\|B0XTS1\|SCONB_ASPFC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1	53	344	9.0E-23
sp\|O14727\|APAF_HUMAN	Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2	51	344	9.0E-23
sp\|Q1LV15\|DAW1_DANRE	Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2	135	344	1.0E-22
sp\|Q0CY32\|SCONB_ASPTN	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1	53	344	1.0E-22
sp\|Q9Y297\|FBW1A_HUMAN	F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1	44	256	1.0E-22
sp\|Q6NLV4\|FY_ARATH	Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1	48	300	1.0E-22
sp\|Q20168\|COPB2_CAEEL	Probable coatomer subunit beta' OS=Caenorhabditis elegans GN=copb-2 PE=3 SV=3	61	275	1.0E-22
sp\|Q6TMK6\|GBB1_CRIGR	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Cricetulus griseus GN=GNB1 PE=2 SV=3	32	344	1.0E-22
sp\|O80990\|CIA1_ARATH	Protein CIA1 OS=Arabidopsis thaliana GN=CIA1 PE=1 SV=2	57	305	1.0E-22
sp\|Q7ZXK9\|NLE1_XENLA	Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1	49	169	2.0E-22
sp\|Q5RFF8\|NLE1_PONAB	Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3	49	169	2.0E-22
sp\|Q58D20\|NLE1_BOVIN	Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3	49	169	2.0E-22
sp\|Q9NVX2\|NLE1_HUMAN	Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4	49	169	2.0E-22
sp\|Q9BVA0\|KTNB1_HUMAN	Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1	87	347	2.0E-22
sp\|Q8BG40\|KTNB1_MOUSE	Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1	87	347	2.0E-22
sp\|Q6NVM2\|KTNB1_XENTR	Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1	115	344	2.0E-22
sp\|Q91854\|TRCB_XENLA	Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1	44	256	2.0E-22
sp\|Q5SRY7\|FBW1B_MOUSE	F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1	109	344	2.0E-22
sp\|Q5SRY7\|FBW1B_MOUSE	F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1	55	303	2.0E-22
sp\|Q9UKB1\|FBW1B_HUMAN	F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1	111	344	2.0E-22
sp\|P97499\|TEP1_MOUSE	Telomerase protein component 1 OS=Mus musculus GN=Tep1 PE=1 SV=1	54	301	2.0E-22
sp\|P79959\|GBB1_XENLA	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Xenopus laevis GN=gnb1 PE=2 SV=1	32	344	2.0E-22
sp\|Q5ZMV7\|WDR82_CHICK	WD repeat-containing protein 82 OS=Gallus gallus GN=WDR82 PE=2 SV=1	61	333	2.0E-22
sp\|O45040\|GBB1_HOMAM	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1	47	344	2.0E-22
sp\|Q26544\|WSL17_SCHMA	WD repeat-containing protein SL1-17 OS=Schistosoma mansoni PE=2 SV=1	47	300	3.0E-22
sp\|Q8BFQ4\|WDR82_MOUSE	WD repeat-containing protein 82 OS=Mus musculus GN=Wdr82 PE=1 SV=1	61	333	3.0E-22
sp\|Q6UXN9\|WDR82_HUMAN	WD repeat-containing protein 82 OS=Homo sapiens GN=WDR82 PE=1 SV=1	61	333	3.0E-22
sp\|A0AUS0\|WSDU1_DANRE	WD repeat, SAM and U-box domain-containing protein 1 OS=Danio rerio GN=wdsub1 PE=2 SV=1	54	344	3.0E-22
sp\|O08653\|TEP1_RAT	Telomerase protein component 1 OS=Rattus norvegicus GN=Tep1 PE=1 SV=1	54	301	3.0E-22
sp\|Q9SZQ5\|VIP3_ARATH	WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1	72	344	3.0E-22
sp\|Q7RY30\|LIS11_NEUCR	Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2	137	344	4.0E-22
sp\|Q58D20\|NLE1_BOVIN	Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3	44	301	4.0E-22
sp\|C4JPW9\|LIS12_UNCRE	Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1	47	235	4.0E-22
sp\|Q9UKB1\|FBW1B_HUMAN	F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1	55	303	4.0E-22
sp\|Q09990\|LIN23_CAEEL	F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2	115	344	4.0E-22
sp\|Q32PJ6\|CIAO1_BOVIN	Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1	53	211	4.0E-22
sp\|Q5M7T1\|CIAO1_RAT	Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1	53	211	4.0E-22
sp\|Q91WQ5\|TAF5L_MOUSE	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1	65	344	5.0E-22
sp\|Q99KN2\|CIAO1_MOUSE	Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1	53	211	5.0E-22
sp\|D1ZEB4\|LIS11_SORMK	Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1	137	344	6.0E-22
sp\|Q8K450\|SPG16_MOUSE	Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1	27	345	6.0E-22
sp\|Q5SRY7\|FBW1B_MOUSE	F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1	51	212	6.0E-22
sp\|Q21215\|GBLP_CAEEL	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans GN=rack-1 PE=1 SV=3	88	344	6.0E-22
sp\|O76071\|CIAO1_HUMAN	Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1	53	211	6.0E-22
sp\|Q9W5Z5\|WSB1_TAKRU	WD repeat and SOCS box-containing protein 1 OS=Takifugu rubripes GN=wsb1 PE=2 SV=1	54	259	6.0E-22
sp\|Q9UTC7\|YIDC_SCHPO	Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1	53	300	7.0E-22
sp\|Q5RFF8\|NLE1_PONAB	Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3	44	255	7.0E-22
sp\|Q9UKB1\|FBW1B_HUMAN	F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1	51	212	7.0E-22
sp\|P25387\|GBLP_CHLRE	Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1	88	344	7.0E-22
sp\|Q9NVX2\|NLE1_HUMAN	Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4	44	255	8.0E-22
sp\|Q99973\|TEP1_HUMAN	Telomerase protein component 1 OS=Homo sapiens GN=TEP1 PE=1 SV=2	54	324	8.0E-22
sp\|Q969H0\|FBXW7_HUMAN	F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1	53	223	9.0E-22
sp\|Q2KJJ5\|TBL3_BOVIN	Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1	57	344	9.0E-22
sp\|Q08E38\|PRP19_BOVIN	Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1	54	302	9.0E-22
sp\|Q54YD8\|COPB2_DICDI	Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1	54	312	9.0E-22
sp\|F1MNN4\|FBXW7_BOVIN	F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2	53	223	1.0E-21
sp\|Q09715\|TUP11_SCHPO	Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1	49	214	1.0E-21
sp\|Q229Z6\|POC1_TETTS	POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1	79	344	1.0E-21
sp\|Q7ZUV2\|KTNB1_DANRE	Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1	110	325	1.0E-21
sp\|Q6PBD6\|WDR61_XENTR	WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1	49	212	1.0E-21
sp\|Q91854\|TRCB_XENLA	Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1	59	302	1.0E-21
sp\|Q99KN2\|CIAO1_MOUSE	Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1	64	254	1.0E-21
sp\|Q05B17\|WDR48_XENTR	WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1	57	303	1.0E-21
sp\|Q9NRL3\|STRN4_HUMAN	Striatin-4 OS=Homo sapiens GN=STRN4 PE=1 SV=2	50	336	1.0E-21
sp\|Q9UMS4\|PRP19_HUMAN	Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1	54	302	1.0E-21
sp\|Q9C270\|PWP2_NEUCR	Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B18D24.40 PE=3 SV=1	57	344	1.0E-21
sp\|Q5A7Q3\|PRP46_CANAL	Pre-mRNA-splicing factor PRP46 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP46 PE=3 SV=1	19	344	1.0E-21
sp\|Q8VBV4\|FBXW7_MOUSE	F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1	53	223	2.0E-21
sp\|Q15542\|TAF5_HUMAN	Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3	45	173	2.0E-21
sp\|O75529\|TAF5L_HUMAN	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1	58	344	2.0E-21
sp\|P20053\|PRP4_YEAST	U4/U6 small nuclear ribonucleoprotein PRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP4 PE=1 SV=1	54	301	2.0E-21
sp\|Q4V7Y7\|KTNB1_XENLA	Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1	156	344	2.0E-21
sp\|Q3ULA2\|FBW1A_MOUSE	F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2	59	302	2.0E-21
sp\|Q9Y297\|FBW1A_HUMAN	F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1	59	302	2.0E-21
sp\|Q5M7T1\|CIAO1_RAT	Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1	64	280	2.0E-21
sp\|Q6PFM9\|WDR48_DANRE	WD repeat-containing protein 48 OS=Danio rerio GN=wdr48 PE=2 SV=2	57	303	2.0E-21
sp\|Q9JMJ4\|PRP19_RAT	Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2	54	302	2.0E-21
sp\|Q99KP6\|PRP19_MOUSE	Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1	54	302	2.0E-21
sp\|Q5ZMA2\|PRP19_CHICK	Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1	54	302	2.0E-21
sp\|Q9VLN1\|WDR82_DROME	WD repeat-containing protein 82 OS=Drosophila melanogaster GN=Wdr82 PE=1 SV=1	48	333	2.0E-21
sp\|O60508\|PRP17_HUMAN	Pre-mRNA-processing factor 17 OS=Homo sapiens GN=CDC40 PE=1 SV=1	55	325	2.0E-21
sp\|Q5U2W5\|TBL3_RAT	Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1	57	344	2.0E-21
sp\|Q922B6\|TRAF7_MOUSE	E3 ubiquitin-protein ligase TRAF7 OS=Mus musculus GN=Traf7 PE=1 SV=1	46	344	2.0E-21
sp\|Q9DC48\|PRP17_MOUSE	Pre-mRNA-processing factor 17 OS=Mus musculus GN=Cdc40 PE=2 SV=1	55	325	2.0E-21
sp\|Q803D2\|LIS1B_DANRE	Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3	54	212	3.0E-21
sp\|Q90ZL4\|LIS1_XENLA	Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3	54	212	3.0E-21
sp\|Q6NZH4\|LIS1_XENTR	Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3	54	212	3.0E-21
sp\|Q5ZIU8\|KTNB1_CHICK	Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2	115	344	3.0E-21
sp\|Q09990\|LIN23_CAEEL	F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2	51	212	3.0E-21
sp\|O76071\|CIAO1_HUMAN	Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1	64	280	3.0E-21
sp\|P23232\|GBB_LOLFO	Guanine nucleotide-binding protein subunit beta OS=Loligo forbesi PE=2 SV=1	11	344	3.0E-21
sp\|Q8RXA7\|SCD1_ARATH	DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana GN=SCD1 PE=1 SV=1	54	301	3.0E-21
sp\|Q01277\|SCONB_NEUCR	Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1	96	296	3.0E-21
sp\|Q54S79\|WDR3_DICDI	WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1	73	259	3.0E-21
sp\|O94620\|CWF17_SCHPO	Pre-mRNA-splicing factor cwf17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf17 PE=1 SV=1	50	343	3.0E-21
sp\|Q8C092\|TAF5_MOUSE	Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1	45	174	4.0E-21
sp\|Q9LV28\|GPLPC_ARATH	Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1	114	344	4.0E-21
sp\|Q6Q0C0\|TRAF7_HUMAN	E3 ubiquitin-protein ligase TRAF7 OS=Homo sapiens GN=TRAF7 PE=1 SV=1	46	344	4.0E-21
sp\|O42249\|GBLP_ORENI	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1	87	344	4.0E-21
sp\|Q9NSI6\|BRWD1_HUMAN	Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens GN=BRWD1 PE=1 SV=4	56	344	4.0E-21
sp\|P26308\|GBB1_DROME	Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster GN=Gbeta13F PE=1 SV=1	47	344	4.0E-21
sp\|P38011\|GBLP_YEAST	Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4	51	333	4.0E-21
sp\|O48847\|LUH_ARATH	Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana GN=LUH PE=1 SV=1	61	344	4.0E-21
sp\|A1C7E4\|SCONB_ASPCL	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1	53	344	5.0E-21
sp\|Q25306\|GBLP_LEIMA	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1	96	306	5.0E-21
sp\|Q8H0T9\|KTNB1_ARATH	Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3	57	300	5.0E-21
sp\|Q32PJ6\|CIAO1_BOVIN	Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1	64	254	5.0E-21
sp\|O14170\|POP2_SCHPO	WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1	53	255	5.0E-21
sp\|Q58E77\|WD82B_XENLA	WD repeat-containing protein 82-B OS=Xenopus laevis GN=wdr82-b PE=2 SV=1	61	333	5.0E-21
sp\|Q8BHB4\|WDR3_MOUSE	WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1	35	217	5.0E-21
sp\|A7MB12\|UTP15_BOVIN	U3 small nucleolar RNA-associated protein 15 homolog OS=Bos taurus GN=UTP15 PE=2 SV=1	33	322	5.0E-21
sp\|Q08706\|GBB_LYMST	Guanine nucleotide-binding protein subunit beta OS=Lymnaea stagnalis PE=2 SV=1	47	344	6.0E-21
sp\|Q5F3K4\|WDR48_CHICK	WD repeat-containing protein 48 OS=Gallus gallus GN=WDR48 PE=2 SV=1	57	303	6.0E-21
sp\|Q8C7V3\|UTP15_MOUSE	U3 small nucleolar RNA-associated protein 15 homolog OS=Mus musculus GN=Utp15 PE=1 SV=1	60	322	6.0E-21
sp\|O24456\|GBLPA_ARATH	Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2	51	255	7.0E-21
sp\|Q5ZJH5\|WDR61_CHICK	WD repeat-containing protein 61 OS=Gallus gallus GN=WDR61 PE=2 SV=1	73	341	7.0E-21
sp\|A2RRU3\|UTP15_RAT	U3 small nucleolar RNA-associated protein 15 homolog OS=Rattus norvegicus GN=Utp15 PE=2 SV=1	33	322	8.0E-21
sp\|Q9HAV0\|GBB4_HUMAN	Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3	47	344	8.0E-21
sp\|Q32LN7\|WDR61_BOVIN	WD repeat-containing protein 61 OS=Bos taurus GN=WDR61 PE=2 SV=1	49	212	8.0E-21
sp\|A1DP19\|LIS1_NEOFI	Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1	72	344	9.0E-21
sp\|Q09855\|POF11_SCHPO	F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2	60	331	9.0E-21
sp\|Q6GL39\|WDR82_XENTR	WD repeat-containing protein 82 OS=Xenopus tropicalis GN=wdr82 PE=2 SV=1	61	333	9.0E-21
sp\|Q9GZS3\|WDR61_HUMAN	WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1	49	212	9.0E-21
sp\|B7PS00\|LIS1_IXOSC	Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2	54	212	1.0E-20
sp\|O13282\|TAF5_SCHPO	Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1	50	173	1.0E-20
sp\|P62884\|GBLP_LEIIN	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1	96	306	1.0E-20
sp\|P62883\|GBLP_LEICH	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1	96	306	1.0E-20
sp\|D4D8P3\|SCONB_TRIVH	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1	138	325	1.0E-20
sp\|D4AM37\|SCONB_ARTBC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1	138	325	1.0E-20
sp\|Q39336\|GBLP_BRANA	Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1	51	225	1.0E-20
sp\|Q9ERF3\|WDR61_MOUSE	WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1	49	212	1.0E-20
sp\|Q09150\|REC14_SCHPO	Meiotic recombination protein rec14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rec14 PE=3 SV=1	42	252	1.0E-20
sp\|Q10281\|GBLP_SCHPO	Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3	47	311	1.0E-20
sp\|Q4V7A0\|WDR61_RAT	WD repeat-containing protein 61 OS=Rattus norvegicus GN=Wdr61 PE=1 SV=1	49	212	1.0E-20
sp\|B6GZA1\|SCONB_PENRW	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sconB PE=3 SV=1	53	344	1.0E-20
sp\|Q4R2Z6\|WDR48_MACFA	WD repeat-containing protein 48 OS=Macaca fascicularis GN=WDR48 PE=2 SV=1	57	303	1.0E-20
sp\|Q6NV31\|WDR82_DANRE	WD repeat-containing protein 82 OS=Danio rerio GN=wdr82 PE=2 SV=1	61	333	1.0E-20
sp\|Q8BH57\|WDR48_MOUSE	WD repeat-containing protein 48 OS=Mus musculus GN=Wdr48 PE=1 SV=1	57	303	1.0E-20
sp\|P27612\|PLAP_MOUSE	Phospholipase A-2-activating protein OS=Mus musculus GN=Plaa PE=1 SV=4	42	293	1.0E-20
sp\|P58404\|STRN4_MOUSE	Striatin-4 OS=Mus musculus GN=Strn4 PE=1 SV=2	50	336	1.0E-20
sp\|A7S338\|LIS1_NEMVE	Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1	54	212	2.0E-20
sp\|Q5BK30\|DAW1_RAT	Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1	64	344	2.0E-20
sp\|O74855\|NLE1_SCHPO	Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1	44	211	2.0E-20
sp\|Q39836\|GBLP_SOYBN	Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1	95	344	2.0E-20
sp\|Q9C4Z6\|GPLPB_ARATH	Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1	115	344	2.0E-20
sp\|B0XAF3\|CIAO1_CULQU	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1	54	344	2.0E-20
sp\|B7QKS1\|CIAO1_IXOSC	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Ixodes scapularis GN=ISCW023049 PE=3 SV=1	53	302	2.0E-20
sp\|Q5ZIU8\|KTNB1_CHICK	Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2	87	347	2.0E-20
sp\|Q32LN7\|WDR61_BOVIN	WD repeat-containing protein 61 OS=Bos taurus GN=WDR61 PE=2 SV=1	24	301	2.0E-20
sp\|Q9GZS3\|WDR61_HUMAN	WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1	24	301	2.0E-20
sp\|Q19124\|A16L1_CAEEL	Autophagic-related protein 16.1 OS=Caenorhabditis elegans GN=atg-16.1 PE=3 SV=1	69	344	2.0E-20
sp\|Q8TAF3\|WDR48_HUMAN	WD repeat-containing protein 48 OS=Homo sapiens GN=WDR48 PE=1 SV=1	57	303	2.0E-20
sp\|Q640J6\|WD82A_XENLA	WD repeat-containing protein 82-A OS=Xenopus laevis GN=wdr82-a PE=2 SV=1	61	333	2.0E-20
sp\|Q5RAW8\|WDR48_PONAB	WD repeat-containing protein 48 OS=Pongo abelii GN=WDR48 PE=2 SV=1	57	303	2.0E-20
sp\|Q32PG3\|WDR48_BOVIN	WD repeat-containing protein 48 OS=Bos taurus GN=WDR48 PE=2 SV=1	57	303	2.0E-20
sp\|Q8TED0\|UTP15_HUMAN	U3 small nucleolar RNA-associated protein 15 homolog OS=Homo sapiens GN=UTP15 PE=1 SV=3	60	322	2.0E-20
sp\|O13286\|SRW1_SCHPO	WD repeat-containing protein srw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srw1 PE=1 SV=1	61	302	2.0E-20
sp\|Q4RJN5\|LIS1_TETNG	Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1	54	212	3.0E-20
sp\|C4Q0P6\|LIS1_SCHMA	Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1	56	212	3.0E-20
sp\|A8XZJ9\|LIS1_CAEBR	Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2	54	212	3.0E-20
sp\|B6QC06\|LIS12_TALMQ	Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1	54	222	3.0E-20
sp\|C5FP68\|SCONB_ARTOC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1	138	325	3.0E-20
sp\|P90648\|MHCKB_DICDI	Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1	44	256	3.0E-20
sp\|P38011\|GBLP_YEAST	Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4	41	304	3.0E-20
sp\|Q92636\|FAN_HUMAN	Protein FAN OS=Homo sapiens GN=NSMAF PE=1 SV=2	62	303	3.0E-20
sp\|Q8C4J7\|TBL3_MOUSE	Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1	57	344	3.0E-20
sp\|D3TLL6\|LIS1_GLOMM	Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1	55	212	4.0E-20
sp\|O14170\|POP2_SCHPO	WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1	73	344	4.0E-20
sp\|P0CS46\|PFS2_CRYNJ	Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PFS2 PE=3 SV=1	57	222	4.0E-20
sp\|P35606\|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2	61	289	4.0E-20
sp\|P0CS47\|PFS2_CRYNB	Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFS2 PE=3 SV=1	57	222	4.0E-20
sp\|P35605\|COPB2_BOVIN	Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3	61	289	4.0E-20
sp\|O55029\|COPB2_MOUSE	Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2	61	289	4.0E-20
sp\|Q5R664\|COPB2_PONAB	Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1	61	289	4.0E-20
sp\|Q6ZMY6\|WDR88_HUMAN	WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2	57	214	5.0E-20
sp\|Q01277\|SCONB_NEUCR	Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1	53	221	5.0E-20
sp\|O42249\|GBLP_ORENI	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1	50	254	5.0E-20
sp\|Q9I9H8\|APAF_DANRE	Apoptotic protease-activating factor 1 OS=Danio rerio GN=apaf1 PE=2 SV=1	54	331	5.0E-20
sp\|Q25189\|GBLP_HYDVU	Guanine nucleotide-binding protein subunit beta-like protein OS=Hydra vulgaris GN=RACK1 PE=2 SV=1	95	333	5.0E-20
sp\|Q9UNX4\|WDR3_HUMAN	WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1	35	212	5.0E-20
sp\|Q93794\|SEL10_CAEEL	F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3	54	227	6.0E-20
sp\|Q05946\|UTP13_YEAST	U3 small nucleolar RNA-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP13 PE=1 SV=1	6	254	6.0E-20
sp\|Q17GR9\|CIAO1_AEDAE	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1	54	344	6.0E-20
sp\|O24456\|GBLPA_ARATH	Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2	95	344	6.0E-20
sp\|Q9ERF3\|WDR61_MOUSE	WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1	47	301	6.0E-20
sp\|Q7ZUV2\|KTNB1_DANRE	Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1	118	344	7.0E-20
sp\|Q9I9H8\|APAF_DANRE	Apoptotic protease-activating factor 1 OS=Danio rerio GN=apaf1 PE=2 SV=1	55	302	7.0E-20
sp\|Q921C3\|BRWD1_MOUSE	Bromodomain and WD repeat-containing protein 1 OS=Mus musculus GN=Brwd1 PE=1 SV=2	56	344	7.0E-20
sp\|Q7T394\|LIS1A_DANRE	Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3	54	212	8.0E-20
sp\|B6QC56\|LIS11_TALMQ	Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1	94	344	9.0E-20
sp\|Q7ZUV2\|KTNB1_DANRE	Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1	52	225	9.0E-20
sp\|Q15269\|PWP2_HUMAN	Periodic tryptophan protein 2 homolog OS=Homo sapiens GN=PWP2 PE=2 SV=2	56	255	9.0E-20
sp\|Q9PTR5\|LIS1_CHICK	Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3	54	212	1.0E-19
sp\|Q8HXX0\|LIS1_MACFA	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3	54	212	1.0E-19
sp\|Q5REG7\|LIS1_PONAB	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3	54	212	1.0E-19
sp\|Q9VPR4\|NLE_DROME	Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2	54	256	1.0E-19
sp\|Q5BE22\|PRP46_EMENI	Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1	51	301	1.0E-19
sp\|Q6L4F8\|GBLPB_ORYSJ	Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1	88	344	1.0E-19
sp\|Q6PBD6\|WDR61_XENTR	WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1	65	268	1.0E-19
sp\|Q5ZIU8\|KTNB1_CHICK	Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2	54	300	1.0E-19
sp\|Q5ZJH5\|WDR61_CHICK	WD repeat-containing protein 61 OS=Gallus gallus GN=WDR61 PE=2 SV=1	49	212	1.0E-19
sp\|Q01277\|SCONB_NEUCR	Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1	132	325	1.0E-19
sp\|B6GZA1\|SCONB_PENRW	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sconB PE=3 SV=1	54	329	1.0E-19
sp\|Q4R4I8\|COPB2_MACFA	Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1	61	334	1.0E-19
sp\|P41811\|COPB2_YEAST	Coatomer subunit beta' OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC27 PE=1 SV=1	61	312	1.0E-19
sp\|Q91WM3\|U3IP2_MOUSE	U3 small nucleolar RNA-interacting protein 2 OS=Mus musculus GN=Rrp9 PE=1 SV=1	55	300	1.0E-19
sp\|O43818\|U3IP2_HUMAN	U3 small nucleolar RNA-interacting protein 2 OS=Homo sapiens GN=RRP9 PE=1 SV=1	56	300	1.0E-19
sp\|O43818\|U3IP2_HUMAN	U3 small nucleolar RNA-interacting protein 2 OS=Homo sapiens GN=RRP9 PE=1 SV=1	53	255	1.0E-19
sp\|Q3SZK1\|AAMP_BOVIN	Angio-associated migratory cell protein OS=Bos taurus GN=AAMP PE=2 SV=1	141	336	1.0E-19
sp\|C3XVT5\|LIS1_BRAFL	Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1	54	212	2.0E-19
sp\|Q9GL51\|LIS1_PIG	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3	54	212	2.0E-19
sp\|P63004\|LIS1_RAT	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2	54	212	2.0E-19
sp\|P63005\|LIS1_MOUSE	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2	54	212	2.0E-19
sp\|P43034\|LIS1_HUMAN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2	54	212	2.0E-19
sp\|B0LSW3\|LIS1_FELCA	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1	54	212	2.0E-19
sp\|P43033\|LIS1_BOVIN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2	54	212	2.0E-19
sp\|O74855\|NLE1_SCHPO	Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1	52	256	2.0E-19
sp\|Q00659\|SCONB_EMENI	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2	132	325	2.0E-19
sp\|O74319\|TAF73_SCHPO	Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1	52	319	2.0E-19
sp\|P16649\|TUP1_YEAST	General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2	57	344	2.0E-19
sp\|Q9BVA0\|KTNB1_HUMAN	Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1	70	300	2.0E-19
sp\|Q8BG40\|KTNB1_MOUSE	Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1	54	300	2.0E-19
sp\|Q6GMD2\|WDR61_XENLA	WD repeat-containing protein 61 OS=Xenopus laevis GN=wdr61 PE=2 SV=1	60	338	2.0E-19
sp\|Q7PS24\|CIAO1_ANOGA	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3	54	344	2.0E-19
sp\|Q9W5Z5\|WSB1_TAKRU	WD repeat and SOCS box-containing protein 1 OS=Takifugu rubripes GN=wsb1 PE=2 SV=1	64	300	2.0E-19
sp\|P54319\|PLAP_RAT	Phospholipase A-2-activating protein OS=Rattus norvegicus GN=Plaa PE=1 SV=3	42	293	2.0E-19
sp\|Q7YR70\|AAMP_CANLF	Angio-associated migratory cell protein OS=Canis lupus familiaris GN=AAMP PE=3 SV=1	141	336	2.0E-19
sp\|O62621\|COPB2_DROME	Coatomer subunit beta' OS=Drosophila melanogaster GN=beta'COP PE=2 SV=2	61	255	2.0E-19
sp\|Q5RCG7\|AAMP_PONAB	Angio-associated migratory cell protein OS=Pongo abelii GN=AAMP PE=2 SV=2	141	324	2.0E-19
sp\|P42527\|MHCKA_DICDI	Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2	15	344	2.0E-19
sp\|B0X2V9\|WDR48_CULQU	WD repeat-containing protein 48 homolog OS=Culex quinquefasciatus GN=CPIJ014111 PE=3 SV=1	57	303	2.0E-19
sp\|Q9W7F2\|WDR1A_XENLA	WD repeat-containing protein 1-A OS=Xenopus laevis GN=wdr1-a PE=2 SV=2	46	217	2.0E-19
sp\|O42248\|GBLP_DANRE	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1	50	254	2.0E-19
sp\|Q9CAA0\|COB21_ARATH	Coatomer subunit beta'-1 OS=Arabidopsis thaliana GN=At1g79990 PE=2 SV=2	53	222	2.0E-19
sp\|Q6NNP0\|ATG16_ARATH	Autophagy-related protein 16 OS=Arabidopsis thaliana GN=ATG16 PE=2 SV=1	54	319	2.0E-19
sp\|Q5R8K2\|CSTF1_PONAB	Cleavage stimulation factor subunit 1 OS=Pongo abelii GN=CSTF1 PE=2 SV=1	39	267	2.0E-19
sp\|Q8NBT0\|POC1A_HUMAN	POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2	136	344	3.0E-19
sp\|Q9VU65\|POC1_DROME	POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1	61	214	3.0E-19
sp\|O24076\|GBLP_MEDSA	Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1	95	344	3.0E-19
sp\|Q9BVA0\|KTNB1_HUMAN	Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1	52	263	3.0E-19
sp\|Q09855\|POF11_SCHPO	F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2	23	216	3.0E-19
sp\|P83774\|GBLP_CANAL	Guanine nucleotide-binding protein subunit beta-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASC1 PE=1 SV=2	95	343	3.0E-19
sp\|Q54YD8\|COPB2_DICDI	Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1	54	253	3.0E-19
sp\|Q54S79\|WDR3_DICDI	WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1	58	217	3.0E-19
sp\|Q4V7A0\|WDR61_RAT	WD repeat-containing protein 61 OS=Rattus norvegicus GN=Wdr61 PE=1 SV=1	47	301	3.0E-19
sp\|Q91WM3\|U3IP2_MOUSE	U3 small nucleolar RNA-interacting protein 2 OS=Mus musculus GN=Rrp9 PE=1 SV=1	53	255	3.0E-19
sp\|O42248\|GBLP_DANRE	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1	45	344	3.0E-19
sp\|Q5IS43\|LIS1_PANTR	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3	54	212	4.0E-19
sp\|B3S4I5\|LIS1_TRIAD	Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1	44	212	4.0E-19
sp\|B6QC06\|LIS12_TALMQ	Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1	136	344	4.0E-19
sp\|B6Q4Z5\|SCONB_TALMQ	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1	132	325	4.0E-19
sp\|A1DHW6\|SCONB_NEOFI	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1	93	271	4.0E-19
sp\|P25382\|NLE1_YEAST	Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3	51	256	4.0E-19
sp\|O15736\|TIPD_DICDI	Protein tipD OS=Dictyostelium discoideum GN=tipD PE=3 SV=1	128	326	4.0E-19
sp\|Q8H0T9\|KTNB1_ARATH	Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3	129	344	4.0E-19
sp\|Q8C4J7\|TBL3_MOUSE	Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1	53	301	4.0E-19
sp\|O13615\|PRP46_SCHPO	Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1	51	260	5.0E-19
sp\|C5FP68\|SCONB_ARTOC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1	96	271	5.0E-19
sp\|Q4V7Y7\|KTNB1_XENLA	Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1	70	300	5.0E-19
sp\|Q9ERF3\|WDR61_MOUSE	WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1	73	338	5.0E-19
sp\|Q25189\|GBLP_HYDVU	Guanine nucleotide-binding protein subunit beta-like protein OS=Hydra vulgaris GN=RACK1 PE=2 SV=1	47	311	5.0E-19
sp\|B5X3Z6\|LIS1A_SALSA	Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1	54	212	6.0E-19
sp\|C5JD40\|LIS1_AJEDS	Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1	138	344	6.0E-19
sp\|C5GVJ9\|LIS1_AJEDR	Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1	138	344	6.0E-19
sp\|Q8N0X2\|SPG16_HUMAN	Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2	8	344	6.0E-19
sp\|Q4V7Y7\|KTNB1_XENLA	Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1	87	332	6.0E-19
sp\|Q6NVM2\|KTNB1_XENTR	Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1	87	333	6.0E-19
sp\|A7EKM8\|LIS1_SCLS1	Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1	129	344	7.0E-19
sp\|Q0D0X6\|LIS1_ASPTN	Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1	54	236	7.0E-19
sp\|Q8BG40\|KTNB1_MOUSE	Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1	52	169	7.0E-19
sp\|B4JW81\|CIAO1_DROGR	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila grimshawi GN=Ciao1 PE=3 SV=1	54	254	7.0E-19
sp\|O80990\|CIA1_ARATH	Protein CIA1 OS=Arabidopsis thaliana GN=CIA1 PE=1 SV=2	54	344	7.0E-19
sp\|Q9HAV0\|GBB4_HUMAN	Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3	66	301	7.0E-19
sp\|Q32LN7\|WDR61_BOVIN	WD repeat-containing protein 61 OS=Bos taurus GN=WDR61 PE=2 SV=1	73	341	7.0E-19
sp\|Q9GZS3\|WDR61_HUMAN	WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1	73	341	8.0E-19
sp\|B4LQ21\|LIS1_DROVI	Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1	55	212	9.0E-19
sp\|B4JWA1\|LIS1_DROGR	Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1	55	212	9.0E-19
sp\|O74319\|TAF73_SCHPO	Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1	44	177	9.0E-19
sp\|P49026\|GBLP_TOBAC	Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1	95	344	9.0E-19
sp\|Q39336\|GBLP_BRANA	Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1	115	344	9.0E-19
sp\|B5X3C4\|LIS1B_SALSA	Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1	54	212	1.0E-18
sp\|Q17N69\|LIS1_AEDAE	Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2	54	212	1.0E-18
sp\|Q0CY32\|SCONB_ASPTN	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1	132	325	1.0E-18
sp\|Q01369\|GBLP_NEUCR	Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1	47	311	1.0E-18
sp\|Q5ZIU8\|KTNB1_CHICK	Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2	52	203	1.0E-18
sp\|B4KTK4\|CIAO1_DROMO	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1	54	290	1.0E-18
sp\|Q4V7A0\|WDR61_RAT	WD repeat-containing protein 61 OS=Rattus norvegicus GN=Wdr61 PE=1 SV=1	73	338	1.0E-18
sp\|Q00808\|HETE1_PODAS	Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1	161	344	2.0E-18
sp\|O13282\|TAF5_SCHPO	Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1	61	344	2.0E-18
sp\|A2QCU8\|SCONB_ASPNC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1	132	325	2.0E-18
sp\|Q7ZUV2\|KTNB1_DANRE	Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1	54	300	2.0E-18
sp\|Q6PH57\|GBB1_DANRE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1	54	255	2.0E-18
sp\|Q6NVM2\|KTNB1_XENTR	Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1	70	300	2.0E-18
sp\|O42249\|GBLP_ORENI	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1	45	311	2.0E-18
sp\|B4QHG6\|LIS1_DROSI	Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1	55	212	3.0E-18
sp\|B4HSL3\|LIS1_DROSE	Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1	55	212	3.0E-18
sp\|Q7KNS3\|LIS1_DROME	Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2	55	212	3.0E-18
sp\|B4P6P9\|LIS1_DROYA	Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1	55	212	3.0E-18
sp\|B3NPW0\|LIS1_DROER	Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1	55	212	3.0E-18
sp\|Q9NDC9\|LIS1_CAEEL	Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1	52	212	3.0E-18
sp\|A1CF18\|LIS12_ASPCL	Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1	72	305	3.0E-18
sp\|D4D8P3\|SCONB_TRIVH	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1	96	271	3.0E-18
sp\|D4AM37\|SCONB_ARTBC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1	96	271	3.0E-18
sp\|B3NQR5\|CIAO1_DROER	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila erecta GN=Ciao1 PE=3 SV=1	54	255	3.0E-18
sp\|Q26544\|WSL17_SCHMA	WD repeat-containing protein SL1-17 OS=Schistosoma mansoni PE=2 SV=1	57	344	3.0E-18
sp\|Q5ZMA2\|PRP19_CHICK	Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1	23	344	3.0E-18
sp\|B4MY65\|LIS1_DROWI	Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1	55	212	4.0E-18
sp\|Q55563\|Y163_SYNY3	Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1	49	177	4.0E-18
sp\|B8M7Q5\|SCONB_TALSN	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1	132	347	4.0E-18
sp\|Q95RJ9\|EBI_DROME	F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2	49	212	4.0E-18
sp\|B4LJT7\|CIAO1_DROVI	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila virilis GN=Ciao1 PE=3 SV=1	54	254	4.0E-18
sp\|Q291L9\|LIS1_DROPS	Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1	55	212	5.0E-18
sp\|B4GAJ1\|LIS1_DROPE	Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1	55	212	5.0E-18
sp\|Q7S7L4\|LIS12_NEUCR	Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2	138	344	5.0E-18
sp\|Q9QXE7\|TBL1X_MOUSE	F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2	49	212	5.0E-18
sp\|Q09990\|LIN23_CAEEL	F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2	145	344	5.0E-18
sp\|Q9UNX4\|WDR3_HUMAN	WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1	25	344	5.0E-18
sp\|B4KT48\|LIS1_DROMO	Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1	55	212	6.0E-18
sp\|A9V790\|LIS1_MONBE	Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1	54	214	6.0E-18
sp\|Q91WQ5\|TAF5L_MOUSE	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1	89	335	6.0E-18
sp\|A1C7E4\|SCONB_ASPCL	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1	132	325	6.0E-18
sp\|Q05946\|UTP13_YEAST	U3 small nucleolar RNA-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP13 PE=1 SV=1	30	346	6.0E-18
sp\|P54313\|GBB2_RAT	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4	54	255	6.0E-18
sp\|P62880\|GBB2_MOUSE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3	54	255	6.0E-18
sp\|P62879\|GBB2_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3	54	255	6.0E-18
sp\|P11017\|GBB2_BOVIN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3	54	255	6.0E-18
sp\|P25387\|GBLP_CHLRE	Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1	51	300	6.0E-18
sp\|Q9UNX4\|WDR3_HUMAN	WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1	61	212	6.0E-18
sp\|Q95RJ9\|EBI_DROME	F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2	136	344	7.0E-18
sp\|B3MEY6\|LIS1_DROAN	Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1	55	212	8.0E-18
sp\|Q9BQ87\|TBL1Y_HUMAN	F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1	50	212	8.0E-18
sp\|P74442\|Y143_SYNY3	Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1	53	212	9.0E-18
sp\|B8NGT5\|SCONB_ASPFN	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1	132	325	9.0E-18
sp\|Q2KID6\|PLRG1_BOVIN	Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1	44	256	9.0E-18
sp\|Q2UFN8\|SCONB_ASPOR	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1	132	325	1.0E-17
sp\|A1DHW6\|SCONB_NEOFI	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1	132	325	1.0E-17
sp\|Q8BHJ5\|TBL1R_MOUSE	F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1	47	212	1.0E-17
sp\|Q9BZK7\|TBL1R_HUMAN	F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1	47	212	1.0E-17
sp\|Q25306\|GBLP_LEIMA	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1	54	344	1.0E-17
sp\|P53699\|CDC4_CANAX	Cell division control protein 4 OS=Candida albicans GN=CDC4 PE=3 SV=1	53	303	1.0E-17
sp\|B4P7Q3\|CIAO1_DROYA	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1	54	254	1.0E-17
sp\|B3MC74\|CIAO1_DROAN	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila ananassae GN=Ciao1 PE=3 SV=1	54	255	1.0E-17
sp\|Q6NLV4\|FY_ARATH	Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1	10	344	1.0E-17
sp\|Q7YR70\|AAMP_CANLF	Angio-associated migratory cell protein OS=Canis lupus familiaris GN=AAMP PE=3 SV=1	52	322	1.0E-17
sp\|C4YFX2\|TUP1_CANAW	Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1	53	256	2.0E-17
sp\|P0CY34\|TUP1_CANAL	Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1	53	256	2.0E-17
sp\|C5PFX0\|LIS1_COCP7	Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2	134	344	2.0E-17
sp\|Q7SZM9\|TB1RA_XENLA	F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1	47	212	2.0E-17
sp\|Q6GPC6\|TB1RB_XENLA	F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1	47	212	2.0E-17
sp\|P62884\|GBLP_LEIIN	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1	54	344	2.0E-17
sp\|P62883\|GBLP_LEICH	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1	54	344	2.0E-17
sp\|O60907\|TBL1X_HUMAN	F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3	49	212	2.0E-17
sp\|Q4R8H1\|TBL1X_MACFA	F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1	49	212	2.0E-17
sp\|Q86TI4\|WDR86_HUMAN	WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3	99	345	2.0E-17
sp\|Q9JMJ4\|PRP19_RAT	Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2	69	344	2.0E-17
sp\|Q99KP6\|PRP19_MOUSE	Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1	69	344	2.0E-17
sp\|Q8BHB4\|WDR3_MOUSE	WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1	61	212	2.0E-17
sp\|Q8TED0\|UTP15_HUMAN	U3 small nucleolar RNA-associated protein 15 homolog OS=Homo sapiens GN=UTP15 PE=1 SV=3	49	265	2.0E-17
sp\|Q3SZK1\|AAMP_BOVIN	Angio-associated migratory cell protein OS=Bos taurus GN=AAMP PE=2 SV=1	52	322	2.0E-17
sp\|Q5RCG7\|AAMP_PONAB	Angio-associated migratory cell protein OS=Pongo abelii GN=AAMP PE=2 SV=2	52	322	2.0E-17
sp\|Q4R8E7\|DAW1_MACFA	Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1	116	344	3.0E-17
sp\|Q4X0A9\|SCONB_ASPFU	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1	132	325	3.0E-17
sp\|B0XTS1\|SCONB_ASPFC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1	132	325	3.0E-17
sp\|Q9USN3\|UTP13_SCHPO	Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3	54	344	3.0E-17
sp\|P39014\|MET30_YEAST	F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1	127	321	3.0E-17
sp\|P07834\|CDC4_YEAST	Cell division control protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC4 PE=1 SV=2	46	301	3.0E-17
sp\|Q9UMS4\|PRP19_HUMAN	Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1	110	311	3.0E-17
sp\|O48847\|LUH_ARATH	Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana GN=LUH PE=1 SV=1	57	300	3.0E-17
sp\|P35606\|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2	54	323	3.0E-17
sp\|P35605\|COPB2_BOVIN	Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3	54	323	3.0E-17
sp\|O55029\|COPB2_MOUSE	Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2	54	323	3.0E-17
sp\|Q5R664\|COPB2_PONAB	Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1	54	323	3.0E-17
sp\|Q4R4I8\|COPB2_MACFA	Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1	54	323	3.0E-17
sp\|Q7K1Y4\|CIAO1_DROME	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila melanogaster GN=Ciao1 PE=1 SV=1	54	254	4.0E-17
sp\|Q20168\|COPB2_CAEEL	Probable coatomer subunit beta' OS=Caenorhabditis elegans GN=copb-2 PE=3 SV=3	114	344	4.0E-17
sp\|Q08E38\|PRP19_BOVIN	Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1	110	311	4.0E-17
sp\|Q8BHB4\|WDR3_MOUSE	WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1	95	344	4.0E-17
sp\|Q9CAA0\|COB21_ARATH	Coatomer subunit beta'-1 OS=Arabidopsis thaliana GN=At1g79990 PE=2 SV=2	61	322	4.0E-17
sp\|D3TLL6\|LIS1_GLOMM	Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1	54	170	5.0E-17
sp\|B4QFZ8\|CIAO1_DROSI	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila simulans GN=Ciao1 PE=3 SV=1	54	254	5.0E-17
sp\|B4HRQ6\|CIAO1_DROSE	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila sechellia GN=Ciao1 PE=3 SV=1	54	254	5.0E-17
sp\|P07834\|CDC4_YEAST	Cell division control protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC4 PE=1 SV=2	137	344	5.0E-17
sp\|Q08E38\|PRP19_BOVIN	Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1	69	344	5.0E-17
sp\|Q9UNX4\|WDR3_HUMAN	WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1	70	255	5.0E-17
sp\|Q6FJZ9\|PRP46_CANGA	Pre-mRNA-splicing factor PRP46 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP46 PE=3 SV=1	49	265	6.0E-17
sp\|Q05946\|UTP13_YEAST	U3 small nucleolar RNA-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP13 PE=1 SV=1	20	300	7.0E-17
sp\|O24076\|GBLP_MEDSA	Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1	51	255	7.0E-17
sp\|Q922V4\|PLRG1_MOUSE	Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1	44	256	7.0E-17
sp\|Q9SJT9\|COPA2_ARATH	Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1	96	344	7.0E-17
sp\|Q8BHB4\|WDR3_MOUSE	WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1	46	344	7.0E-17
sp\|B4MY77\|CIAO1_DROWI	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1	54	254	8.0E-17
sp\|Q25189\|GBLP_HYDVU	Guanine nucleotide-binding protein subunit beta-like protein OS=Hydra vulgaris GN=RACK1 PE=2 SV=1	129	344	8.0E-17
sp\|Q9UMS4\|PRP19_HUMAN	Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1	69	344	9.0E-17
sp\|Q9JMJ4\|PRP19_RAT	Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2	110	311	9.0E-17
sp\|Q99KP6\|PRP19_MOUSE	Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1	110	311	9.0E-17
sp\|P93340\|GBLP_NICPL	Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1	137	344	1.0E-16
sp\|P49027\|GBLPA_ORYSJ	Guanine nucleotide-binding protein subunit beta-like protein A OS=Oryza sativa subsp. japonica GN=RACK1A PE=1 SV=1	88	344	1.0E-16
sp\|Q4V7Y7\|KTNB1_XENLA	Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1	52	263	1.0E-16
sp\|Q5U2W5\|TBL3_RAT	Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1	57	211	1.0E-16
sp\|Q32LN7\|WDR61_BOVIN	WD repeat-containing protein 61 OS=Bos taurus GN=WDR61 PE=2 SV=1	64	257	1.0E-16
sp\|Q9GZS3\|WDR61_HUMAN	WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1	64	257	1.0E-16
sp\|Q9ERF3\|WDR61_MOUSE	WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1	64	257	1.0E-16
sp\|Q9CAA0\|COB21_ARATH	Coatomer subunit beta'-1 OS=Arabidopsis thaliana GN=At1g79990 PE=2 SV=2	123	344	1.0E-16
sp\|Q8YRI1\|YY46_NOSS1	Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1	49	139	2.0E-16
sp\|Q292E8\|CIAO1_DROPS	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila pseudoobscura pseudoobscura GN=Ciao1 PE=3 SV=1	54	254	2.0E-16
sp\|B4GDM7\|CIAO1_DROPE	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila persimilis GN=Ciao1 PE=3 SV=2	54	254	2.0E-16
sp\|Q55FR9\|COPA_DICDI	Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1	92	344	2.0E-16
sp\|P90648\|MHCKB_DICDI	Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1	128	344	2.0E-16
sp\|Q9C270\|PWP2_NEUCR	Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B18D24.40 PE=3 SV=1	44	255	2.0E-16
sp\|Q8C4J7\|TBL3_MOUSE	Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1	64	344	2.0E-16
sp\|Q9I9H8\|APAF_DANRE	Apoptotic protease-activating factor 1 OS=Danio rerio GN=apaf1 PE=2 SV=1	56	344	2.0E-16
sp\|P93107\|PF20_CHLRE	Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1	136	344	3.0E-16
sp\|Q94A40\|COPA1_ARATH	Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2	96	344	3.0E-16
sp\|Q8CIE6\|COPA_MOUSE	Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2	53	200	3.0E-16
sp\|Q27954\|COPA_BOVIN	Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1	53	200	3.0E-16
sp\|B3NSK1\|WDR48_DROER	WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1	99	321	3.0E-16
sp\|Q10281\|GBLP_SCHPO	Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3	129	344	3.0E-16
sp\|Q9FLX9\|NLE1_ARATH	Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1	59	322	4.0E-16
sp\|B4P7H8\|WDR48_DROYA	WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1	99	321	4.0E-16
sp\|P53621\|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2	53	200	4.0E-16
sp\|P26308\|GBB1_DROME	Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster GN=Gbeta13F PE=1 SV=1	54	255	4.0E-16
sp\|Q5R664\|COPB2_PONAB	Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1	53	169	4.0E-16
sp\|Q9AUR7\|COPA2_ORYSJ	Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1	96	344	5.0E-16
sp\|P17343\|GBB1_CAEEL	Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2	54	255	5.0E-16
sp\|Q61ZF6\|GBB1_CAEBR	Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1	54	255	5.0E-16
sp\|Q9EPV5\|APAF_RAT	Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1	56	222	5.0E-16
sp\|Q2KJJ5\|TBL3_BOVIN	Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1	57	211	5.0E-16
sp\|Q54YD8\|COPB2_DICDI	Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1	53	180	5.0E-16
sp\|Q4V7A0\|WDR61_RAT	WD repeat-containing protein 61 OS=Rattus norvegicus GN=Wdr61 PE=1 SV=1	64	257	5.0E-16
sp\|P0CS46\|PFS2_CRYNJ	Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PFS2 PE=3 SV=1	64	344	5.0E-16
sp\|P35606\|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2	53	169	5.0E-16
sp\|P35605\|COPB2_BOVIN	Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3	53	169	5.0E-16
sp\|O55029\|COPB2_MOUSE	Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2	53	169	5.0E-16
sp\|Q4R4I8\|COPB2_MACFA	Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1	53	169	5.0E-16
sp\|Q39836\|GBLP_SOYBN	Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1	51	225	6.0E-16
sp\|B4QB64\|WDR48_DROSI	WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1	99	321	6.0E-16
sp\|B4HND9\|WDR48_DROSE	WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1	99	321	6.0E-16
sp\|Q1LZ08\|WDR48_DROME	WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1	99	321	6.0E-16
sp\|P0CS47\|PFS2_CRYNB	Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFS2 PE=3 SV=1	64	344	6.0E-16
sp\|Q2KJJ5\|TBL3_BOVIN	Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1	55	255	7.0E-16
sp\|Q9C270\|PWP2_NEUCR	Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B18D24.40 PE=3 SV=1	61	344	7.0E-16
sp\|P35606\|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2	53	222	7.0E-16
sp\|P35605\|COPB2_BOVIN	Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3	53	222	7.0E-16
sp\|O55029\|COPB2_MOUSE	Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2	53	222	7.0E-16
sp\|Q5R664\|COPB2_PONAB	Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1	53	222	7.0E-16
sp\|P25635\|PWP2_YEAST	Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2	44	318	8.0E-16
sp\|Q5U2W5\|TBL3_RAT	Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1	70	344	8.0E-16
sp\|Q4R4I8\|COPB2_MACFA	Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1	53	222	8.0E-16
sp\|O55029\|COPB2_MOUSE	Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2	123	344	9.0E-16
sp\|Q5REG7\|LIS1_PONAB	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3	171	344	1.0E-15
sp\|F6ZT52\|POC1B_XENTR	POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1	128	344	1.0E-15
sp\|Q6ZMY6\|WDR88_HUMAN	WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2	61	255	1.0E-15
sp\|P16649\|TUP1_YEAST	General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2	44	256	1.0E-15
sp\|Q0J3D9\|COPA3_ORYSJ	Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1	96	344	1.0E-15
sp\|Q9AUR8\|COPA1_ORYSJ	Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1	96	344	1.0E-15
sp\|Q9USN3\|UTP13_SCHPO	Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3	56	325	1.0E-15
sp\|Q12788\|TBL3_HUMAN	Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2	57	211	1.0E-15
sp\|O45040\|GBB1_HOMAM	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1	54	255	1.0E-15
sp\|Q54S79\|WDR3_DICDI	WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1	54	255	1.0E-15
sp\|P35606\|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2	123	344	1.0E-15
sp\|P35605\|COPB2_BOVIN	Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3	123	344	1.0E-15
sp\|Q5R664\|COPB2_PONAB	Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1	123	344	1.0E-15
sp\|Q4R4I8\|COPB2_MACFA	Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1	123	344	1.0E-15
sp\|O62621\|COPB2_DROME	Coatomer subunit beta' OS=Drosophila melanogaster GN=beta'COP PE=2 SV=2	54	211	1.0E-15
sp\|Q9PTR5\|LIS1_CHICK	Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3	171	344	2.0E-15
sp\|P63004\|LIS1_RAT	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2	171	344	2.0E-15
sp\|P63005\|LIS1_MOUSE	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2	171	344	2.0E-15
sp\|P43034\|LIS1_HUMAN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2	171	344	2.0E-15
sp\|B0LSW3\|LIS1_FELCA	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1	171	344	2.0E-15
sp\|P43033\|LIS1_BOVIN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2	171	344	2.0E-15
sp\|Q5IS43\|LIS1_PANTR	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3	171	344	2.0E-15
sp\|Q6PBD6\|WDR61_XENTR	WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1	99	325	2.0E-15
sp\|O88879\|APAF_MOUSE	Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3	56	216	2.0E-15
sp\|Q5GIS3\|GBB_PINFU	Guanine nucleotide-binding protein subunit beta OS=Pinctada fucata PE=1 SV=1	54	255	2.0E-15
sp\|Q26544\|WSL17_SCHMA	WD repeat-containing protein SL1-17 OS=Schistosoma mansoni PE=2 SV=1	53	172	2.0E-15
sp\|A7S338\|LIS1_NEMVE	Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1	40	170	3.0E-15
sp\|Q90ZL4\|LIS1_XENLA	Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3	171	344	3.0E-15
sp\|Q6NZH4\|LIS1_XENTR	Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3	171	344	3.0E-15
sp\|P93107\|PF20_CHLRE	Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1	44	211	3.0E-15
sp\|Q9WUC8\|PLRG1_RAT	Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1	135	333	3.0E-15
sp\|Q7T2F6\|WSB1_DANRE	WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1	27	314	3.0E-15
sp\|Q12788\|TBL3_HUMAN	Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2	47	255	3.0E-15
sp\|Q54YD8\|COPB2_DICDI	Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1	121	344	3.0E-15
sp\|Q08706\|GBB_LYMST	Guanine nucleotide-binding protein subunit beta OS=Lymnaea stagnalis PE=2 SV=1	54	255	3.0E-15
sp\|Q9HAV0\|GBB4_HUMAN	Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3	54	212	3.0E-15
sp\|Q9GL51\|LIS1_PIG	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3	171	344	4.0E-15
sp\|Q8HXX0\|LIS1_MACFA	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3	171	344	4.0E-15
sp\|Q9NDC9\|LIS1_CAEEL	Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1	51	170	4.0E-15
sp\|Q5JTN6\|WDR38_HUMAN	WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1	175	344	4.0E-15
sp\|B4QB64\|WDR48_DROSI	WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1	54	257	4.0E-15
sp\|B4HND9\|WDR48_DROSE	WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1	54	257	4.0E-15
sp\|Q8H0T9\|KTNB1_ARATH	Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3	115	344	4.0E-15
sp\|O14727\|APAF_HUMAN	Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2	47	222	4.0E-15
sp\|O08653\|TEP1_RAT	Telomerase protein component 1 OS=Rattus norvegicus GN=Tep1 PE=1 SV=1	114	344	4.0E-15
sp\|Q9SZQ5\|VIP3_ARATH	WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1	43	196	4.0E-15
sp\|Q91WM3\|U3IP2_MOUSE	U3 small nucleolar RNA-interacting protein 2 OS=Mus musculus GN=Rrp9 PE=1 SV=1	93	306	4.0E-15
sp\|Q803D2\|LIS1B_DANRE	Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3	171	344	5.0E-15
sp\|Q7T394\|LIS1A_DANRE	Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3	171	344	5.0E-15
sp\|Q01369\|GBLP_NEUCR	Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1	129	344	5.0E-15
sp\|B4J8H6\|WDR48_DROGR	WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1	54	302	5.0E-15
sp\|Q8C4J7\|TBL3_MOUSE	Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1	47	255	5.0E-15
sp\|Q922V4\|PLRG1_MOUSE	Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1	135	325	6.0E-15
sp\|P69104\|GBLP_TRYBR	Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1	139	344	6.0E-15
sp\|P69103\|GBLP_TRYBB	Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1	139	344	6.0E-15
sp\|B4P7H8\|WDR48_DROYA	WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1	54	257	7.0E-15
sp\|Q9I9H8\|APAF_DANRE	Apoptotic protease-activating factor 1 OS=Danio rerio GN=apaf1 PE=2 SV=1	44	276	7.0E-15
sp\|Q9USN3\|UTP13_SCHPO	Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3	106	334	8.0E-15
sp\|P83774\|GBLP_CANAL	Guanine nucleotide-binding protein subunit beta-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASC1 PE=1 SV=2	137	344	8.0E-15
sp\|Q28YY2\|WDR48_DROPS	WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2	54	257	8.0E-15
sp\|B4GIJ0\|WDR48_DROPE	WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1	54	257	8.0E-15
sp\|O62621\|COPB2_DROME	Coatomer subunit beta' OS=Drosophila melanogaster GN=beta'COP PE=2 SV=2	53	169	8.0E-15
sp\|A7S338\|LIS1_NEMVE	Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1	171	344	9.0E-15
sp\|Q12417\|PRP46_YEAST	Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1	136	344	9.0E-15
sp\|B3NSK1\|WDR48_DROER	WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1	54	257	9.0E-15
sp\|Q1LZ08\|WDR48_DROME	WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1	54	257	9.0E-15
sp\|B4MFM2\|WDR48_DROVI	WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1	54	257	9.0E-15
sp\|B4KRQ4\|WDR48_DROMO	WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1	54	257	9.0E-15
sp\|Q4RJN5\|LIS1_TETNG	Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1	171	344	1.0E-14
sp\|B5X3Z6\|LIS1A_SALSA	Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1	171	344	1.0E-14
sp\|Q55DA2\|CIAO1_DICDI	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Dictyostelium discoideum GN=ciao1 PE=3 SV=1	44	212	1.0E-14
sp\|B3MET8\|WDR48_DROAN	WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1	54	257	1.0E-14
sp\|P38011\|GBLP_YEAST	Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4	137	344	1.0E-14
sp\|P41811\|COPB2_YEAST	Coatomer subunit beta' OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC27 PE=1 SV=1	61	326	1.0E-14
sp\|O62621\|COPB2_DROME	Coatomer subunit beta' OS=Drosophila melanogaster GN=beta'COP PE=2 SV=2	54	323	1.0E-14
sp\|Q8YTC2\|Y2800_NOSS1	Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1	26	139	2.0E-14
sp\|B5X3C4\|LIS1B_SALSA	Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1	171	344	2.0E-14
sp\|A8NEG8\|LIS1_COPC7	Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3	49	169	2.0E-14
sp\|Q4P9P9\|LIS1_USTMA	Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1	54	192	2.0E-14
sp\|Q6GMD2\|WDR61_XENLA	WD repeat-containing protein 61 OS=Xenopus laevis GN=wdr61 PE=2 SV=1	99	325	2.0E-14
sp\|Q12788\|TBL3_HUMAN	Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2	46	176	2.0E-14
sp\|Q8CIE6\|COPA_MOUSE	Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2	96	344	2.0E-14
sp\|Q27954\|COPA_BOVIN	Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1	96	344	2.0E-14
sp\|P53621\|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2	96	344	2.0E-14
sp\|P97499\|TEP1_MOUSE	Telomerase protein component 1 OS=Mus musculus GN=Tep1 PE=1 SV=1	52	344	2.0E-14
sp\|O08653\|TEP1_RAT	Telomerase protein component 1 OS=Rattus norvegicus GN=Tep1 PE=1 SV=1	52	344	2.0E-14
sp\|Q2KJJ5\|TBL3_BOVIN	Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1	54	344	2.0E-14
sp\|Q2KJJ5\|TBL3_BOVIN	Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1	53	344	2.0E-14
sp\|Q5U2W5\|TBL3_RAT	Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1	46	176	2.0E-14
sp\|Q8RXA7\|SCD1_ARATH	DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana GN=SCD1 PE=1 SV=1	26	321	2.0E-14
sp\|Q54S79\|WDR3_DICDI	WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1	98	344	2.0E-14
sp\|P0CS49\|PRP46_CRYNB	Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1	136	333	3.0E-14
sp\|Q20168\|COPB2_CAEEL	Probable coatomer subunit beta' OS=Caenorhabditis elegans GN=copb-2 PE=3 SV=3	54	222	3.0E-14
sp\|O13286\|SRW1_SCHPO	WD repeat-containing protein srw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srw1 PE=1 SV=1	103	344	3.0E-14
sp\|O43818\|U3IP2_HUMAN	U3 small nucleolar RNA-interacting protein 2 OS=Homo sapiens GN=RRP9 PE=1 SV=1	93	306	3.0E-14
sp\|P0CS48\|PRP46_CRYNJ	Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1	136	333	4.0E-14
sp\|O13615\|PRP46_SCHPO	Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1	135	333	4.0E-14
sp\|P25635\|PWP2_YEAST	Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2	28	344	4.0E-14
sp\|Q5R5W8\|GBB1_PONAB	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Pongo abelii GN=GNB1 PE=2 SV=3	57	212	4.0E-14
sp\|Q99973\|TEP1_HUMAN	Telomerase protein component 1 OS=Homo sapiens GN=TEP1 PE=1 SV=2	56	344	4.0E-14
sp\|Q6NNP0\|ATG16_ARATH	Autophagy-related protein 16 OS=Arabidopsis thaliana GN=ATG16 PE=2 SV=1	138	322	4.0E-14
sp\|Q96WV5\|COPA_SCHPO	Putative coatomer subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPJ4664.04 PE=1 SV=1	91	344	5.0E-14
sp\|O54929\|WSB2_MOUSE	WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2	53	213	5.0E-14
sp\|Q39336\|GBLP_BRANA	Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1	56	211	5.0E-14
sp\|Q9UNX4\|WDR3_HUMAN	WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1	124	309	5.0E-14
sp\|C4Q0P6\|LIS1_SCHMA	Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1	51	170	6.0E-14
sp\|Q9USN3\|UTP13_SCHPO	Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3	73	344	7.0E-14
sp\|Q0V8J1\|WSB2_BOVIN	WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1	53	213	7.0E-14
sp\|Q8C4J7\|TBL3_MOUSE	Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1	46	176	7.0E-14
sp\|O14727\|APAF_HUMAN	Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2	44	344	8.0E-14
sp\|O61585\|KTNB1_STRPU	Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1	52	170	9.0E-14
sp\|Q5U2W5\|TBL3_RAT	Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1	55	255	9.0E-14
sp\|Q9NYS7\|WSB2_HUMAN	WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1	53	213	1.0E-13
sp\|Q9Y6I7\|WSB1_HUMAN	WD repeat and SOCS box-containing protein 1 OS=Homo sapiens GN=WSB1 PE=1 SV=1	64	344	1.0E-13
sp\|Q12788\|TBL3_HUMAN	Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2	75	346	1.0E-13
sp\|Q5U2W5\|TBL3_RAT	Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1	53	346	1.0E-13
sp\|Q8C4J7\|TBL3_MOUSE	Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1	47	318	1.0E-13
sp\|Q9EPV5\|APAF_RAT	Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1	44	344	2.0E-13
sp\|Q12788\|TBL3_HUMAN	Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2	53	344	2.0E-13
sp\|P54311\|GBB1_RAT	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Rattus norvegicus GN=Gnb1 PE=1 SV=4	57	212	2.0E-13
sp\|P62874\|GBB1_MOUSE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus GN=Gnb1 PE=1 SV=3	57	212	2.0E-13
sp\|P62873\|GBB1_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens GN=GNB1 PE=1 SV=3	57	212	2.0E-13
sp\|P62872\|GBB1_CANLF	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Canis lupus familiaris GN=GNB1 PE=2 SV=3	57	212	2.0E-13
sp\|P62871\|GBB1_BOVIN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Bos taurus GN=GNB1 PE=1 SV=3	57	212	2.0E-13
sp\|Q6TMK6\|GBB1_CRIGR	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Cricetulus griseus GN=GNB1 PE=2 SV=3	57	212	2.0E-13
sp\|P97499\|TEP1_MOUSE	Telomerase protein component 1 OS=Mus musculus GN=Tep1 PE=1 SV=1	60	344	2.0E-13
sp\|P97499\|TEP1_MOUSE	Telomerase protein component 1 OS=Mus musculus GN=Tep1 PE=1 SV=1	62	301	2.0E-13
sp\|Q2KJJ5\|TBL3_BOVIN	Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1	44	346	2.0E-13
sp\|B6GZA1\|SCONB_PENRW	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sconB PE=3 SV=1	131	325	2.0E-13
sp\|Q15269\|PWP2_HUMAN	Periodic tryptophan protein 2 homolog OS=Homo sapiens GN=PWP2 PE=2 SV=2	44	255	2.0E-13
sp\|O88879\|APAF_MOUSE	Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3	44	318	3.0E-13
sp\|Q8BHB4\|WDR3_MOUSE	WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1	124	308	3.0E-13
sp\|P0CS46\|PFS2_CRYNJ	Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PFS2 PE=3 SV=1	54	211	3.0E-13
sp\|P0CS47\|PFS2_CRYNB	Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFS2 PE=3 SV=1	54	211	3.0E-13
sp\|Q9UNX4\|WDR3_HUMAN	WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1	54	186	3.0E-13
sp\|B8P4B0\|LIS11_POSPM	Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1	70	169	4.0E-13
sp\|P0CS42\|LIS1_CRYNJ	Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1	51	169	5.0E-13
sp\|P0CS43\|LIS1_CRYNB	Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1	51	169	5.0E-13
sp\|A7RWD2\|CIAO1_NEMVE	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1	47	256	5.0E-13
sp\|Q9NSI6\|BRWD1_HUMAN	Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens GN=BRWD1 PE=1 SV=4	54	302	5.0E-13
sp\|O74855\|NLE1_SCHPO	Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1	137	323	6.0E-13
sp\|Q8BHB4\|WDR3_MOUSE	WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1	51	173	6.0E-13
sp\|O62621\|COPB2_DROME	Coatomer subunit beta' OS=Drosophila melanogaster GN=beta'COP PE=2 SV=2	150	344	7.0E-13
sp\|Q8BHD1\|POC1B_MOUSE	POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1	136	344	8.0E-13
sp\|P74598\|Y1491_SYNY3	Uncharacterized WD repeat-containing protein sll1491 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1491 PE=3 SV=1	54	212	8.0E-13
sp\|Q9UNX4\|WDR3_HUMAN	WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1	51	173	8.0E-13
sp\|O74319\|TAF73_SCHPO	Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1	103	344	1.0E-12
sp\|Q94A40\|COPA1_ARATH	Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2	53	200	1.0E-12
sp\|Q05B17\|WDR48_XENTR	WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1	143	344	1.0E-12
sp\|Q10281\|GBLP_SCHPO	Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3	56	211	1.0E-12
sp\|Q8BH57\|WDR48_MOUSE	WD repeat-containing protein 48 OS=Mus musculus GN=Wdr48 PE=1 SV=1	143	344	1.0E-12
sp\|D1ZEM6\|LIS12_SORMK	Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1	138	344	2.0E-12
sp\|G0SC29\|NLE1_CHATD	Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2	122	322	2.0E-12
sp\|B6Q4Z5\|SCONB_TALMQ	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1	49	256	2.0E-12
sp\|P79959\|GBB1_XENLA	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Xenopus laevis GN=gnb1 PE=2 SV=1	54	255	2.0E-12
sp\|P23232\|GBB_LOLFO	Guanine nucleotide-binding protein subunit beta OS=Loligo forbesi PE=2 SV=1	54	255	2.0E-12
sp\|Q9NSI6\|BRWD1_HUMAN	Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens GN=BRWD1 PE=1 SV=4	50	269	2.0E-12
sp\|P42527\|MHCKA_DICDI	Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2	57	212	2.0E-12
sp\|P46800\|GBLP_DICDI	Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2	51	215	3.0E-12
sp\|Q55FR9\|COPA_DICDI	Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1	54	208	3.0E-12
sp\|Q8BH57\|WDR48_MOUSE	WD repeat-containing protein 48 OS=Mus musculus GN=Wdr48 PE=1 SV=1	99	337	3.0E-12
sp\|Q9SJT9\|COPA2_ARATH	Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1	52	222	4.0E-12
sp\|Q54YD8\|COPB2_DICDI	Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1	50	175	4.0E-12
sp\|Q9C270\|PWP2_NEUCR	Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B18D24.40 PE=3 SV=1	56	217	4.0E-12
sp\|B7FNU7\|LIS1_PHATC	Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1	57	214	5.0E-12
sp\|P53622\|COPA_YEAST	Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2	175	344	5.0E-12
sp\|Q6P1V3\|WSB1_XENTR	WD repeat and SOCS box-containing protein 1 OS=Xenopus tropicalis GN=wsb1 PE=2 SV=1	30	301	5.0E-12
sp\|Q96WV5\|COPA_SCHPO	Putative coatomer subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPJ4664.04 PE=1 SV=1	53	173	5.0E-12
sp\|O88879\|APAF_MOUSE	Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3	55	344	5.0E-12
sp\|O14727\|APAF_HUMAN	Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2	55	344	5.0E-12
sp\|A0AUS0\|WSDU1_DANRE	WD repeat, SAM and U-box domain-containing protein 1 OS=Danio rerio GN=wdsub1 PE=2 SV=1	56	181	5.0E-12
sp\|Q6PFM9\|WDR48_DANRE	WD repeat-containing protein 48 OS=Danio rerio GN=wdr48 PE=2 SV=2	99	337	5.0E-12
sp\|Q91WM3\|U3IP2_MOUSE	U3 small nucleolar RNA-interacting protein 2 OS=Mus musculus GN=Rrp9 PE=1 SV=1	52	254	5.0E-12
sp\|B0X2V9\|WDR48_CULQU	WD repeat-containing protein 48 homolog OS=Culex quinquefasciatus GN=CPIJ014111 PE=3 SV=1	54	211	5.0E-12
sp\|Q96WV5\|COPA_SCHPO	Putative coatomer subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPJ4664.04 PE=1 SV=1	51	315	6.0E-12
sp\|B4P7Q3\|CIAO1_DROYA	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1	94	300	7.0E-12
sp\|Q15269\|PWP2_HUMAN	Periodic tryptophan protein 2 homolog OS=Homo sapiens GN=PWP2 PE=2 SV=2	92	302	7.0E-12
sp\|Q9USN3\|UTP13_SCHPO	Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3	61	222	8.0E-12
sp\|Q54S79\|WDR3_DICDI	WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1	63	301	8.0E-12
sp\|Q5F3K4\|WDR48_CHICK	WD repeat-containing protein 48 OS=Gallus gallus GN=WDR48 PE=2 SV=1	99	337	8.0E-12
sp\|Q9AUR7\|COPA2_ORYSJ	Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1	52	222	9.0E-12
sp\|Q9SZQ5\|VIP3_ARATH	WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1	55	275	9.0E-12
sp\|Q6PFM9\|WDR48_DANRE	WD repeat-containing protein 48 OS=Danio rerio GN=wdr48 PE=2 SV=2	143	344	9.0E-12
sp\|Q55DA2\|CIAO1_DICDI	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Dictyostelium discoideum GN=ciao1 PE=3 SV=1	42	215	1.0E-11
sp\|Q7PS24\|CIAO1_ANOGA	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3	47	256	1.0E-11
sp\|P16520\|GBB3_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens GN=GNB3 PE=1 SV=1	44	212	1.0E-11
sp\|P69104\|GBLP_TRYBR	Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1	47	211	1.0E-11
sp\|P69103\|GBLP_TRYBB	Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1	47	211	1.0E-11
sp\|Q54S79\|WDR3_DICDI	WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1	55	344	1.0E-11
sp\|Q54S79\|WDR3_DICDI	WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1	44	170	1.0E-11
sp\|Q4R2Z6\|WDR48_MACFA	WD repeat-containing protein 48 OS=Macaca fascicularis GN=WDR48 PE=2 SV=1	99	337	1.0E-11
sp\|Q8TAF3\|WDR48_HUMAN	WD repeat-containing protein 48 OS=Homo sapiens GN=WDR48 PE=1 SV=1	99	337	1.0E-11
sp\|Q8TAF3\|WDR48_HUMAN	WD repeat-containing protein 48 OS=Homo sapiens GN=WDR48 PE=1 SV=1	143	344	1.0E-11
sp\|Q5RAW8\|WDR48_PONAB	WD repeat-containing protein 48 OS=Pongo abelii GN=WDR48 PE=2 SV=1	99	337	1.0E-11
sp\|Q32PG3\|WDR48_BOVIN	WD repeat-containing protein 48 OS=Bos taurus GN=WDR48 PE=2 SV=1	99	337	1.0E-11
sp\|Q921C3\|BRWD1_MOUSE	Bromodomain and WD repeat-containing protein 1 OS=Mus musculus GN=Brwd1 PE=1 SV=2	50	269	1.0E-11
sp\|Q2HJH6\|SNR40_BOVIN	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1	44	171	2.0E-11
sp\|P53622\|COPA_YEAST	Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2	52	305	2.0E-11
sp\|Q9AUR8\|COPA1_ORYSJ	Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1	52	222	2.0E-11
sp\|Q9USN3\|UTP13_SCHPO	Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3	64	321	2.0E-11
sp\|Q9QXE7\|TBL1X_MOUSE	F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2	54	173	2.0E-11
sp\|P39014\|MET30_YEAST	F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1	52	222	2.0E-11
sp\|Q94A40\|COPA1_ARATH	Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2	52	222	2.0E-11
sp\|B4QFZ8\|CIAO1_DROSI	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila simulans GN=Ciao1 PE=3 SV=1	94	300	2.0E-11
sp\|Q7K1Y4\|CIAO1_DROME	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila melanogaster GN=Ciao1 PE=1 SV=1	94	300	2.0E-11
sp\|B3NQR5\|CIAO1_DROER	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila erecta GN=Ciao1 PE=3 SV=1	94	301	2.0E-11
sp\|Q17GR9\|CIAO1_AEDAE	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1	91	333	2.0E-11
sp\|B3MC74\|CIAO1_DROAN	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila ananassae GN=Ciao1 PE=3 SV=1	94	301	2.0E-11
sp\|O08653\|TEP1_RAT	Telomerase protein component 1 OS=Rattus norvegicus GN=Tep1 PE=1 SV=1	62	325	2.0E-11
sp\|Q08E38\|PRP19_BOVIN	Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1	53	211	2.0E-11
sp\|Q05B17\|WDR48_XENTR	WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1	99	337	2.0E-11
sp\|Q9UMS4\|PRP19_HUMAN	Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1	53	211	2.0E-11
sp\|Q9JMJ4\|PRP19_RAT	Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2	53	211	2.0E-11
sp\|Q99KP6\|PRP19_MOUSE	Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1	53	211	2.0E-11
sp\|O60508\|PRP17_HUMAN	Pre-mRNA-processing factor 17 OS=Homo sapiens GN=CDC40 PE=1 SV=1	93	305	2.0E-11
sp\|Q54S79\|WDR3_DICDI	WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1	48	171	2.0E-11
sp\|O48847\|LUH_ARATH	Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana GN=LUH PE=1 SV=1	138	344	2.0E-11
sp\|Q5F3K4\|WDR48_CHICK	WD repeat-containing protein 48 OS=Gallus gallus GN=WDR48 PE=2 SV=1	143	344	2.0E-11
sp\|Q4R2Z6\|WDR48_MACFA	WD repeat-containing protein 48 OS=Macaca fascicularis GN=WDR48 PE=2 SV=1	143	344	2.0E-11
sp\|Q5RAW8\|WDR48_PONAB	WD repeat-containing protein 48 OS=Pongo abelii GN=WDR48 PE=2 SV=1	143	344	2.0E-11
sp\|Q32PG3\|WDR48_BOVIN	WD repeat-containing protein 48 OS=Bos taurus GN=WDR48 PE=2 SV=1	143	344	2.0E-11
sp\|Q0J3D9\|COPA3_ORYSJ	Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1	52	222	3.0E-11
sp\|P49026\|GBLP_TOBAC	Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1	57	214	3.0E-11
sp\|B4HRQ6\|CIAO1_DROSE	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila sechellia GN=Ciao1 PE=3 SV=1	94	300	3.0E-11
sp\|B4MY77\|CIAO1_DROWI	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1	94	300	3.0E-11
sp\|Q5ZJH5\|WDR61_CHICK	WD repeat-containing protein 61 OS=Gallus gallus GN=WDR61 PE=2 SV=1	87	325	3.0E-11
sp\|B4KTK4\|CIAO1_DROMO	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1	94	300	3.0E-11
sp\|B4JW81\|CIAO1_DROGR	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila grimshawi GN=Ciao1 PE=3 SV=1	94	300	3.0E-11
sp\|Q9W5Z5\|WSB1_TAKRU	WD repeat and SOCS box-containing protein 1 OS=Takifugu rubripes GN=wsb1 PE=2 SV=1	59	314	3.0E-11
sp\|P41811\|COPB2_YEAST	Coatomer subunit beta' OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC27 PE=1 SV=1	54	222	3.0E-11
sp\|O43818\|U3IP2_HUMAN	U3 small nucleolar RNA-interacting protein 2 OS=Homo sapiens GN=RRP9 PE=1 SV=1	52	254	3.0E-11
sp\|B8NGT5\|SCONB_ASPFN	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1	49	256	4.0E-11
sp\|A2QCU8\|SCONB_ASPNC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1	53	258	4.0E-11
sp\|Q6PFM9\|WDR48_DANRE	WD repeat-containing protein 48 OS=Danio rerio GN=wdr48 PE=2 SV=2	54	260	4.0E-11
sp\|Q2UFN8\|SCONB_ASPOR	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1	49	256	5.0E-11
sp\|Q5BE22\|PRP46_EMENI	Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1	91	314	6.0E-11
sp\|Q55DA2\|CIAO1_DICDI	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Dictyostelium discoideum GN=ciao1 PE=3 SV=1	97	302	6.0E-11
sp\|O60907\|TBL1X_HUMAN	F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3	54	173	6.0E-11
sp\|Q4R2Z6\|WDR48_MACFA	WD repeat-containing protein 48 OS=Macaca fascicularis GN=WDR48 PE=2 SV=1	54	260	6.0E-11
sp\|Q4R8H1\|TBL1X_MACFA	F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1	54	173	7.0E-11
sp\|Q292E8\|CIAO1_DROPS	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila pseudoobscura pseudoobscura GN=Ciao1 PE=3 SV=1	94	300	7.0E-11
sp\|B4GDM7\|CIAO1_DROPE	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila persimilis GN=Ciao1 PE=3 SV=2	94	300	7.0E-11
sp\|Q9DC48\|PRP17_MOUSE	Pre-mRNA-processing factor 17 OS=Mus musculus GN=Cdc40 PE=2 SV=1	93	305	7.0E-11
sp\|O42249\|GBLP_ORENI	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1	51	216	7.0E-11
sp\|Q15269\|PWP2_HUMAN	Periodic tryptophan protein 2 homolog OS=Homo sapiens GN=PWP2 PE=2 SV=2	52	344	7.0E-11
sp\|O54929\|WSB2_MOUSE	WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2	64	344	8.0E-11
sp\|Q86TI4\|WDR86_HUMAN	WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3	54	212	8.0E-11
sp\|Q9EPV5\|APAF_RAT	Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1	55	344	8.0E-11
sp\|B4LJT7\|CIAO1_DROVI	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila virilis GN=Ciao1 PE=3 SV=1	94	300	8.0E-11
sp\|Q8TAF3\|WDR48_HUMAN	WD repeat-containing protein 48 OS=Homo sapiens GN=WDR48 PE=1 SV=1	54	260	8.0E-11
sp\|Q32PG3\|WDR48_BOVIN	WD repeat-containing protein 48 OS=Bos taurus GN=WDR48 PE=2 SV=1	54	260	8.0E-11
sp\|O13615\|PRP46_SCHPO	Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1	92	318	9.0E-11
sp\|Q39836\|GBLP_SOYBN	Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1	57	211	9.0E-11
sp\|Q0V8J1\|WSB2_BOVIN	WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1	64	344	9.0E-11
sp\|Q94A40\|COPA1_ARATH	Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2	51	311	9.0E-11
sp\|Q9VPR4\|NLE_DROME	Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2	137	322	1.0E-10
sp\|Q55AR8\|SNR40_DICDI	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Dictyostelium discoideum GN=snrnp40 PE=3 SV=1	47	171	1.0E-10
sp\|B8M7Q5\|SCONB_TALSN	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1	49	229	1.0E-10
sp\|P93340\|GBLP_NICPL	Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1	57	211	1.0E-10
sp\|Q9USN3\|UTP13_SCHPO	Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3	53	344	1.0E-10
sp\|Q8BHJ5\|TBL1R_MOUSE	F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1	54	173	1.0E-10
sp\|Q9BZK7\|TBL1R_HUMAN	F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1	54	173	1.0E-10
sp\|Q7SZM9\|TB1RA_XENLA	F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1	54	173	1.0E-10
sp\|Q6GPC6\|TB1RB_XENLA	F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1	54	173	1.0E-10
sp\|Q54LT8\|STRAP_DICDI	Serine-threonine kinase receptor-associated protein OS=Dictyostelium discoideum GN=strap PE=3 SV=1	50	211	1.0E-10
sp\|Q54YD8\|COPB2_DICDI	Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1	178	344	1.0E-10
sp\|Q05B17\|WDR48_XENTR	WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1	54	171	1.0E-10
sp\|B0X2V9\|WDR48_CULQU	WD repeat-containing protein 48 homolog OS=Culex quinquefasciatus GN=CPIJ014111 PE=3 SV=1	54	254	1.0E-10
sp\|Q05946\|UTP13_YEAST	U3 small nucleolar RNA-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP13 PE=1 SV=1	26	331	2.0E-10
sp\|Q9AUR7\|COPA2_ORYSJ	Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1	51	175	2.0E-10
sp\|Q95RJ9\|EBI_DROME	F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2	54	173	2.0E-10
sp\|Q17GR9\|CIAO1_AEDAE	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1	47	210	2.0E-10
sp\|Q9SJT9\|COPA2_ARATH	Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1	51	175	2.0E-10
sp\|B4P7Q3\|CIAO1_DROYA	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1	13	210	2.0E-10
sp\|Q6PBD6\|WDR61_XENTR	WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1	135	333	2.0E-10
sp\|A0AUS0\|WSDU1_DANRE	WD repeat, SAM and U-box domain-containing protein 1 OS=Danio rerio GN=wdsub1 PE=2 SV=1	61	235	2.0E-10
sp\|O60508\|PRP17_HUMAN	Pre-mRNA-processing factor 17 OS=Homo sapiens GN=CDC40 PE=1 SV=1	175	344	2.0E-10
sp\|Q5F3K4\|WDR48_CHICK	WD repeat-containing protein 48 OS=Gallus gallus GN=WDR48 PE=2 SV=1	54	260	2.0E-10
sp\|Q9ERF3\|WDR61_MOUSE	WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1	97	325	2.0E-10
sp\|Q5RAW8\|WDR48_PONAB	WD repeat-containing protein 48 OS=Pongo abelii GN=WDR48 PE=2 SV=1	54	260	2.0E-10
sp\|P35606\|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2	50	164	2.0E-10
sp\|P35605\|COPB2_BOVIN	Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3	50	164	2.0E-10
sp\|O55029\|COPB2_MOUSE	Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2	50	164	2.0E-10
sp\|Q5R664\|COPB2_PONAB	Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1	50	164	2.0E-10
sp\|Q9NYS7\|WSB2_HUMAN	WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1	64	344	3.0E-10
sp\|Q9BQ87\|TBL1Y_HUMAN	F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1	54	171	3.0E-10
sp\|P49027\|GBLPA_ORYSJ	Guanine nucleotide-binding protein subunit beta-like protein A OS=Oryza sativa subsp. japonica GN=RACK1A PE=1 SV=1	57	211	3.0E-10
sp\|Q7PS24\|CIAO1_ANOGA	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3	129	344	3.0E-10
sp\|B4QFZ8\|CIAO1_DROSI	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila simulans GN=Ciao1 PE=3 SV=1	42	210	3.0E-10
sp\|B4HRQ6\|CIAO1_DROSE	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila sechellia GN=Ciao1 PE=3 SV=1	42	210	3.0E-10
sp\|Q1LZ08\|WDR48_DROME	WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1	51	171	3.0E-10
sp\|Q05B17\|WDR48_XENTR	WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1	54	254	3.0E-10
sp\|Q9DC48\|PRP17_MOUSE	Pre-mRNA-processing factor 17 OS=Mus musculus GN=Cdc40 PE=2 SV=1	175	344	3.0E-10
sp\|Q8BH57\|WDR48_MOUSE	WD repeat-containing protein 48 OS=Mus musculus GN=Wdr48 PE=1 SV=1	54	260	3.0E-10
sp\|P74442\|Y143_SYNY3	Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1	45	341	4.0E-10
sp\|Q9AUR8\|COPA1_ORYSJ	Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1	51	175	4.0E-10
sp\|Q7K1Y4\|CIAO1_DROME	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila melanogaster GN=Ciao1 PE=1 SV=1	42	210	4.0E-10
sp\|Q9W7F2\|WDR1A_XENLA	WD repeat-containing protein 1-A OS=Xenopus laevis GN=wdr1-a PE=2 SV=2	44	222	4.0E-10
sp\|P38123\|SWD3_YEAST	COMPASS component SWD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWD3 PE=1 SV=1	56	222	5.0E-10
sp\|P74598\|Y1491_SYNY3	Uncharacterized WD repeat-containing protein sll1491 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1491 PE=3 SV=1	61	172	5.0E-10
sp\|B3NQR5\|CIAO1_DROER	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila erecta GN=Ciao1 PE=3 SV=1	42	210	5.0E-10
sp\|Q99KN2\|CIAO1_MOUSE	Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1	47	212	5.0E-10
sp\|Q54S79\|WDR3_DICDI	WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1	157	344	5.0E-10
sp\|Q4V7A0\|WDR61_RAT	WD repeat-containing protein 61 OS=Rattus norvegicus GN=Wdr61 PE=1 SV=1	97	325	5.0E-10
sp\|C5FWH1\|LIS1_ARTOC	Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1	134	344	6.0E-10
sp\|Q7PS24\|CIAO1_ANOGA	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3	91	301	6.0E-10
sp\|Q20168\|COPB2_CAEEL	Probable coatomer subunit beta' OS=Caenorhabditis elegans GN=copb-2 PE=3 SV=3	50	164	6.0E-10
sp\|Q9LV28\|GPLPC_ARATH	Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1	171	344	7.0E-10
sp\|O54927\|WSB1_MOUSE	WD repeat and SOCS box-containing protein 1 OS=Mus musculus GN=Wsb1 PE=1 SV=1	64	344	7.0E-10
sp\|Q5M7T1\|CIAO1_RAT	Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1	47	212	7.0E-10
sp\|Q0J3D9\|COPA3_ORYSJ	Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1	51	175	9.0E-10
sp\|A2QCU8\|SCONB_ASPNC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1	177	344	1.0E-09
sp\|P63245\|GBLP_RAT	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3	51	216	1.0E-09
sp\|P63246\|GBLP_PIG	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3	51	216	1.0E-09
sp\|P68040\|GBLP_MOUSE	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3	51	216	1.0E-09
sp\|Q4R7Y4\|GBLP_MACFA	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3	51	216	1.0E-09
sp\|P63244\|GBLP_HUMAN	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3	51	216	1.0E-09
sp\|P63247\|GBLP_CHICK	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1	51	216	1.0E-09
sp\|P63243\|GBLP_BOVIN	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3	51	216	1.0E-09
sp\|Q9SZQ5\|VIP3_ARATH	WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1	26	161	1.0E-09
sp\|Q6NNP0\|ATG16_ARATH	Autophagy-related protein 16 OS=Arabidopsis thaliana GN=ATG16 PE=2 SV=1	66	211	1.0E-09
sp\|B2VWG7\|LIS1_PYRTR	Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1	44	153	2.0E-09
sp\|C4JZS6\|LIS11_UNCRE	Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1	49	164	2.0E-09
sp\|Q6P1V3\|WSB1_XENTR	WD repeat and SOCS box-containing protein 1 OS=Xenopus tropicalis GN=wsb1 PE=2 SV=1	192	344	2.0E-09
sp\|Q9USN3\|UTP13_SCHPO	Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3	148	344	2.0E-09
sp\|Q292E8\|CIAO1_DROPS	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila pseudoobscura pseudoobscura GN=Ciao1 PE=3 SV=1	42	169	2.0E-09
sp\|B4GDM7\|CIAO1_DROPE	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila persimilis GN=Ciao1 PE=3 SV=2	42	169	2.0E-09
sp\|Q55FR9\|COPA_DICDI	Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1	51	179	2.0E-09
sp\|Q01277\|SCONB_NEUCR	Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1	54	343	2.0E-09
sp\|Q01277\|SCONB_NEUCR	Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1	49	256	2.0E-09
sp\|Q25189\|GBLP_HYDVU	Guanine nucleotide-binding protein subunit beta-like protein OS=Hydra vulgaris GN=RACK1 PE=2 SV=1	56	211	2.0E-09
sp\|Q4R4I8\|COPB2_MACFA	Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1	50	148	2.0E-09
sp\|Q3SZK1\|AAMP_BOVIN	Angio-associated migratory cell protein OS=Bos taurus GN=AAMP PE=2 SV=1	95	308	2.0E-09
sp\|O42248\|GBLP_DANRE	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1	57	216	2.0E-09
sp\|A1DHW6\|SCONB_NEOFI	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1	53	256	3.0E-09
sp\|Q8L4J2\|CTF50_ARATH	Cleavage stimulation factor subunit 50 OS=Arabidopsis thaliana GN=CSTF50 PE=1 SV=1	136	319	3.0E-09
sp\|B4MY77\|CIAO1_DROWI	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1	42	169	3.0E-09
sp\|O15736\|TIPD_DICDI	Protein tipD OS=Dictyostelium discoideum GN=tipD PE=3 SV=1	54	300	3.0E-09
sp\|Q55FR9\|COPA_DICDI	Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1	52	212	3.0E-09
sp\|Q5M7T1\|CIAO1_RAT	Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1	180	347	3.0E-09
sp\|Q7YR70\|AAMP_CANLF	Angio-associated migratory cell protein OS=Canis lupus familiaris GN=AAMP PE=3 SV=1	95	308	3.0E-09
sp\|B7QKS1\|CIAO1_IXOSC	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Ixodes scapularis GN=ISCW023049 PE=3 SV=1	176	347	4.0E-09
sp\|Q7T2F6\|WSB1_DANRE	WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1	192	344	4.0E-09
sp\|Q99KN2\|CIAO1_MOUSE	Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1	180	347	4.0E-09
sp\|Q9I9H8\|APAF_DANRE	Apoptotic protease-activating factor 1 OS=Danio rerio GN=apaf1 PE=2 SV=1	128	270	4.0E-09
sp\|Q5RCG7\|AAMP_PONAB	Angio-associated migratory cell protein OS=Pongo abelii GN=AAMP PE=2 SV=2	95	308	4.0E-09
sp\|A1C7E4\|SCONB_ASPCL	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1	53	258	5.0E-09
sp\|P53622\|COPA_YEAST	Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2	51	213	5.0E-09
sp\|Q9C270\|PWP2_NEUCR	Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B18D24.40 PE=3 SV=1	51	185	5.0E-09
sp\|P16649\|TUP1_YEAST	General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2	93	344	1.0E-08
sp\|B7QKS1\|CIAO1_IXOSC	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Ixodes scapularis GN=ISCW023049 PE=3 SV=1	48	214	1.0E-08
sp\|B6GZA1\|SCONB_PENRW	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sconB PE=3 SV=1	72	170	1.0E-08
sp\|Q9CAA0\|COB21_ARATH	Coatomer subunit beta'-1 OS=Arabidopsis thaliana GN=At1g79990 PE=2 SV=2	42	179	1.0E-08
sp\|A7EKM8\|LIS1_SCLS1	Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1	44	152	2.0E-08
sp\|P0CS48\|PRP46_CRYNJ	Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1	54	169	2.0E-08
sp\|P0CS49\|PRP46_CRYNB	Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1	54	169	2.0E-08
sp\|Q17GR9\|CIAO1_AEDAE	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1	129	344	2.0E-08
sp\|B3MC74\|CIAO1_DROAN	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila ananassae GN=Ciao1 PE=3 SV=1	42	169	2.0E-08
sp\|Q8CIE6\|COPA_MOUSE	Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2	51	175	2.0E-08
sp\|Q27954\|COPA_BOVIN	Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1	51	175	2.0E-08
sp\|P53621\|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2	51	175	2.0E-08
sp\|Q99KN2\|CIAO1_MOUSE	Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1	106	344	2.0E-08
sp\|Q9NSI6\|BRWD1_HUMAN	Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens GN=BRWD1 PE=1 SV=4	136	321	2.0E-08
sp\|Q921C3\|BRWD1_MOUSE	Bromodomain and WD repeat-containing protein 1 OS=Mus musculus GN=Brwd1 PE=1 SV=2	136	321	2.0E-08
sp\|O43818\|U3IP2_HUMAN	U3 small nucleolar RNA-interacting protein 2 OS=Homo sapiens GN=RRP9 PE=1 SV=1	135	344	2.0E-08
sp\|Q6ZMY6\|WDR88_HUMAN	WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2	53	131	3.0E-08
sp\|A8IZG4\|CIAO1_CHLRE	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1	177	344	3.0E-08
sp\|Q32PJ6\|CIAO1_BOVIN	Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1	190	347	3.0E-08
sp\|Q5M7T1\|CIAO1_RAT	Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1	106	344	3.0E-08
sp\|C4JPW9\|LIS12_UNCRE	Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1	180	344	4.0E-08
sp\|A8IZG4\|CIAO1_CHLRE	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1	47	211	4.0E-08
sp\|O62621\|COPB2_DROME	Coatomer subunit beta' OS=Drosophila melanogaster GN=beta'COP PE=2 SV=2	52	173	5.0E-08
sp\|Q42384\|PRL1_ARATH	Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1	52	235	6.0E-08
sp\|D4DG66\|LIS1_TRIVH	Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1	134	344	6.0E-08
sp\|D4AZ50\|LIS1_ARTBC	Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1	134	344	6.0E-08
sp\|Q91WM3\|U3IP2_MOUSE	U3 small nucleolar RNA-interacting protein 2 OS=Mus musculus GN=Rrp9 PE=1 SV=1	135	344	6.0E-08
sp\|B4JW81\|CIAO1_DROGR	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila grimshawi GN=Ciao1 PE=3 SV=1	180	343	7.0E-08
sp\|Q4ICM0\|LIS1_GIBZE	Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2	46	152	8.0E-08
sp\|Q9W5Z5\|WSB1_TAKRU	WD repeat and SOCS box-containing protein 1 OS=Takifugu rubripes GN=wsb1 PE=2 SV=1	192	344	8.0E-08
sp\|Q99973\|TEP1_HUMAN	Telomerase protein component 1 OS=Homo sapiens GN=TEP1 PE=1 SV=2	42	255	8.0E-08
sp\|Q9C1X0\|YN55_SCHPO	Uncharacterized WD repeat-containing protein C713.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC713.05 PE=3 SV=1	233	344	9.0E-08
sp\|Q99973\|TEP1_HUMAN	Telomerase protein component 1 OS=Homo sapiens GN=TEP1 PE=1 SV=2	62	301	9.0E-08
sp\|P0CS42\|LIS1_CRYNJ	Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1	180	344	1.0E-07
sp\|P0CS43\|LIS1_CRYNB	Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1	180	344	1.0E-07
sp\|Q9C4Z6\|GPLPB_ARATH	Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1	49	173	1.0E-07
sp\|Q7K1Y4\|CIAO1_DROME	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila melanogaster GN=Ciao1 PE=1 SV=1	180	347	1.0E-07
sp\|B3NQR5\|CIAO1_DROER	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila erecta GN=Ciao1 PE=3 SV=1	180	347	1.0E-07
sp\|Q292E8\|CIAO1_DROPS	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila pseudoobscura pseudoobscura GN=Ciao1 PE=3 SV=1	180	343	1.0E-07
sp\|B4GDM7\|CIAO1_DROPE	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila persimilis GN=Ciao1 PE=3 SV=2	180	343	1.0E-07
sp\|O13286\|SRW1_SCHPO	WD repeat-containing protein srw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srw1 PE=1 SV=1	53	211	1.0E-07
sp\|B4QFZ8\|CIAO1_DROSI	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila simulans GN=Ciao1 PE=3 SV=1	180	347	2.0E-07
sp\|B4P7Q3\|CIAO1_DROYA	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1	180	347	2.0E-07
sp\|O80990\|CIA1_ARATH	Protein CIA1 OS=Arabidopsis thaliana GN=CIA1 PE=1 SV=2	47	211	2.0E-07
sp\|A0AUS0\|WSDU1_DANRE	WD repeat, SAM and U-box domain-containing protein 1 OS=Danio rerio GN=wdsub1 PE=2 SV=1	54	131	2.0E-07
sp\|A1CUD6\|LIS11_ASPCL	Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1	44	152	3.0E-07
sp\|P0CS49\|PRP46_CRYNB	Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1	238	344	3.0E-07
sp\|Q4X0A9\|SCONB_ASPFU	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1	72	169	3.0E-07
sp\|B0XTS1\|SCONB_ASPFC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1	72	169	3.0E-07
sp\|Q8N0X2\|SPG16_HUMAN	Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2	130	344	3.0E-07
sp\|Q9WUC8\|PLRG1_RAT	Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1	54	241	3.0E-07
sp\|B4HRQ6\|CIAO1_DROSE	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila sechellia GN=Ciao1 PE=3 SV=1	180	347	3.0E-07
sp\|B4MY77\|CIAO1_DROWI	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1	180	343	3.0E-07
sp\|Q5ZMV7\|WDR82_CHICK	WD repeat-containing protein 82 OS=Gallus gallus GN=WDR82 PE=2 SV=1	56	255	3.0E-07
sp\|Q6GL39\|WDR82_XENTR	WD repeat-containing protein 82 OS=Xenopus tropicalis GN=wdr82 PE=2 SV=1	56	255	3.0E-07
sp\|Q922V4\|PLRG1_MOUSE	Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1	54	241	4.0E-07
sp\|B4KTK4\|CIAO1_DROMO	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1	180	343	4.0E-07
sp\|P0CS48\|PRP46_CRYNJ	Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1	248	344	5.0E-07
sp\|Q6L4F8\|GBLPB_ORYSJ	Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1	49	172	5.0E-07
sp\|B3MC74\|CIAO1_DROAN	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila ananassae GN=Ciao1 PE=3 SV=1	180	343	5.0E-07
sp\|Q58E77\|WD82B_XENLA	WD repeat-containing protein 82-B OS=Xenopus laevis GN=wdr82-b PE=2 SV=1	56	255	5.0E-07
sp\|Q6NV31\|WDR82_DANRE	WD repeat-containing protein 82 OS=Danio rerio GN=wdr82 PE=2 SV=1	56	254	5.0E-07
sp\|Q640J6\|WD82A_XENLA	WD repeat-containing protein 82-A OS=Xenopus laevis GN=wdr82-a PE=2 SV=1	56	255	5.0E-07
sp\|Q54H44\|WDR83_DICDI	WD repeat domain-containing protein 83 homolog OS=Dictyostelium discoideum GN=morg1 PE=3 SV=1	73	212	6.0E-07
sp\|P41811\|COPB2_YEAST	Coatomer subunit beta' OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC27 PE=1 SV=1	41	160	6.0E-07
sp\|B4LJT7\|CIAO1_DROVI	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila virilis GN=Ciao1 PE=3 SV=1	180	343	7.0E-07
sp\|B8M0Q1\|LIS1_TALSN	Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1	180	344	8.0E-07
sp\|Q292E8\|CIAO1_DROPS	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila pseudoobscura pseudoobscura GN=Ciao1 PE=3 SV=1	47	214	9.0E-07
sp\|Q9UTC7\|YIDC_SCHPO	Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1	129	344	1.0E-06
sp\|O15736\|TIPD_DICDI	Protein tipD OS=Dictyostelium discoideum GN=tipD PE=3 SV=1	51	170	1.0E-06
sp\|Q9M2Z2\|WDR5A_ARATH	COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1	9	132	2.0E-06
sp\|Q61FW2\|SEL10_CAEBR	F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1	53	138	2.0E-06
sp\|P74442\|Y143_SYNY3	Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1	57	177	2.0E-06
sp\|P74442\|Y143_SYNY3	Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1	49	255	2.0E-06
sp\|P62884\|GBLP_LEIIN	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1	52	172	2.0E-06
sp\|P62883\|GBLP_LEICH	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1	52	172	2.0E-06
sp\|Q25306\|GBLP_LEIMA	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1	52	172	2.0E-06
sp\|B4KTK4\|CIAO1_DROMO	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1	47	211	2.0E-06
sp\|B4GDM7\|CIAO1_DROPE	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila persimilis GN=Ciao1 PE=3 SV=2	47	211	3.0E-06
sp\|P93340\|GBLP_NICPL	Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1	49	173	4.0E-06
sp\|O24456\|GBLPA_ARATH	Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2	49	173	4.0E-06
sp\|Q8BHB4\|WDR3_MOUSE	WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1	143	344	4.0E-06
sp\|O62621\|COPB2_DROME	Coatomer subunit beta' OS=Drosophila melanogaster GN=beta'COP PE=2 SV=2	180	344	4.0E-06
sp\|Q9UUG8\|TUP12_SCHPO	Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2	54	131	5.0E-06
sp\|P20053\|PRP4_YEAST	U4/U6 small nuclear ribonucleoprotein PRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP4 PE=1 SV=1	142	344	5.0E-06
sp\|B4P7Q3\|CIAO1_DROYA	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1	47	211	6.0E-06
sp\|B4LJT7\|CIAO1_DROVI	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila virilis GN=Ciao1 PE=3 SV=1	47	211	6.0E-06
sp\|P74598\|Y1491_SYNY3	Uncharacterized WD repeat-containing protein sll1491 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1491 PE=3 SV=1	49	129	7.0E-06
sp\|O24076\|GBLP_MEDSA	Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1	7	173	7.0E-06
sp\|Q8BFQ4\|WDR82_MOUSE	WD repeat-containing protein 82 OS=Mus musculus GN=Wdr82 PE=1 SV=1	56	254	8.0E-06
sp\|Q6UXN9\|WDR82_HUMAN	WD repeat-containing protein 82 OS=Homo sapiens GN=WDR82 PE=1 SV=1	56	254	8.0E-06
sp\|O22212\|PRP4L_ARATH	U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1	49	128	9.0E-06
sp\|C5FP68\|SCONB_ARTOC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1	72	169	9.0E-06
sp\|Q9UKB1\|FBW1B_HUMAN	F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1	169	344	9.0E-06
sp\|Q09150\|REC14_SCHPO	Meiotic recombination protein rec14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rec14 PE=3 SV=1	157	341	9.0E-06

[Show less]

GO

GO Term	Description	Terminal node
GO:0005515	protein binding	Yes
GO:0003674	molecular_function	No
GO:0005488	binding	No

SignalP

[Help with interpreting these statistics]

SignalP signal predicted	Location (based on Ymax)	D score (significance: > 0.45)
No	1 - 53	0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequence	Sequence
Locus	Download genbank file of locus The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein	>Agabi119p4\|008130 MNATKDIEMKDATDDRTPPLKPSENSPNAQTATEPAMQENISPDTPQFKPRFLLSGHKRAVSCLKFSPDGTYLAS SSSDKSIKIWETETGQFVHTFEGHREGVSDVSWSSDGAFLASASDDKTVIIWSMEEREAFKTLRGHTNFVFCVNF NPDTNLLVSGGYDETIRVWDVARGRQLKVLPAHSDPVTAVSFNHDGSLIVSCAMDGLIRIWDADSGQCLKTLVDD DNPICSHARFSSNSKFVLVSTQDSTIRLWNYPSSHCAKTYVGHVNRTYCIPSCFLLYERGKFIVSGSEDNKVYIW NLQTRQVVQSLDGHRDTVLSVATHPSRGIMASAGMEKDKSIRLWFDE*
Coding	>Agabi119p4\|008130 ATGAACGCAACAAAAGACATTGAGATGAAAGATGCAACCGACGACAGGACACCCCCTCTCAAGCCTTCAGAAAAC TCCCCAAATGCGCAGACAGCGACTGAGCCAGCGATGCAGGAAAACATTAGTCCTGACACACCTCAATTCAAACCT CGCTTTCTTCTTAGTGGACACAAACGTGCTGTTTCATGCCTGAAATTTAGCCCTGACGGGACATACCTAGCCTCC TCTTCTTCGGATAAAAGTATTAAGATCTGGGAGACAGAGACAGGCCAATTTGTTCATACTTTTGAAGGTCATCGT GAGGGGGTATCAGACGTGTCCTGGTCAAGCGACGGTGCATTCCTAGCCTCGGCTTCCGATGATAAAACCGTCATC ATATGGAGTATGGAAGAGAGAGAGGCTTTCAAGACCCTCCGTGGACACACGAACTTTGTATTCTGCGTGAATTTC AACCCTGATACTAATTTACTCGTCTCGGGAGGATATGATGAGACCATACGCGTTTGGGACGTCGCAAGAGGCCGA CAGCTCAAGGTTCTCCCTGCTCATTCTGACCCAGTAACCGCGGTCAGCTTTAACCATGACGGTTCTCTGATTGTT TCTTGCGCGATGGACGGACTAATACGGATTTGGGATGCGGACTCGGGTCAATGTTTGAAGACCCTGGTAGACGAT GACAATCCCATATGCTCCCATGCACGCTTTTCGAGCAATTCGAAGTTTGTCCTCGTTTCAACGCAAGATTCAACA ATTCGGCTATGGAACTACCCTTCGTCACATTGTGCGAAGACATACGTAGGTCATGTCAACCGAACTTATTGTATT CCGTCATGTTTTCTTCTGTATGAACGGGGCAAATTTATTGTAAGCGGGAGTGAAGACAACAAGGTCTATATCTGG AATTTGCAAACACGGCAAGTGGTCCAGAGTCTCGATGGACACCGTGATACAGTCCTGTCTGTTGCGACACACCCT TCACGGGGAATCATGGCATCTGCGGGGATGGAGAAGGACAAGTCTATTCGGCTGTGGTTTGACGAGTAG
Transcript	>Agabi119p4\|008130 ATGAACGCAACAAAAGACATTGAGATGAAAGATGCAACCGACGACAGGACACCCCCTCTCAAGCCTTCAGAAAAC TCCCCAAATGCGCAGACAGCGACTGAGCCAGCGATGCAGGAAAACATTAGTCCTGACACACCTCAATTCAAACCT CGCTTTCTTCTTAGTGGACACAAACGTGCTGTTTCATGCCTGAAATTTAGCCCTGACGGGACATACCTAGCCTCC TCTTCTTCGGATAAAAGTATTAAGATCTGGGAGACAGAGACAGGCCAATTTGTTCATACTTTTGAAGGTCATCGT GAGGGGGTATCAGACGTGTCCTGGTCAAGCGACGGTGCATTCCTAGCCTCGGCTTCCGATGATAAAACCGTCATC ATATGGAGTATGGAAGAGAGAGAGGCTTTCAAGACCCTCCGTGGACACACGAACTTTGTATTCTGCGTGAATTTC AACCCTGATACTAATTTACTCGTCTCGGGAGGATATGATGAGACCATACGCGTTTGGGACGTCGCAAGAGGCCGA CAGCTCAAGGTTCTCCCTGCTCATTCTGACCCAGTAACCGCGGTCAGCTTTAACCATGACGGTTCTCTGATTGTT TCTTGCGCGATGGACGGACTAATACGGATTTGGGATGCGGACTCGGGTCAATGTTTGAAGACCCTGGTAGACGAT GACAATCCCATATGCTCCCATGCACGCTTTTCGAGCAATTCGAAGTTTGTCCTCGTTTCAACGCAAGATTCAACA ATTCGGCTATGGAACTACCCTTCGTCACATTGTGCGAAGACATACGTAGGTCATGTCAACCGAACTTATTGTATT CCGTCATGTTTTCTTCTGTATGAACGGGGCAAATTTATTGTAAGCGGGAGTGAAGACAACAAGGTCTATATCTGG AATTTGCAAACACGGCAAGTGGTCCAGAGTCTCGATGGACACCGTGATACAGTCCTGTCTGTTGCGACACACCCT TCACGGGGAATCATGGCATCTGCGGGGATGGAGAAGGACAAGTCTATTCGGCTGTGGTTTGACGAGTAG
Gene	>Agabi119p4\|008130 ATGAACGCAACAAAAGACATTGAGATGAAAGATGCAACCGACGACAGGACACCCCCTCTCAAGCCTTCAGAAAAC TCCCCAAATGCGCAGACAGCGACTGAGCCAGCGATGCAGGAAAACATTAGTCCTGACACACCTCAATTCAAACCT CGCTTTCTTCTTAGTGGACACAAACGTGCTGTTTCATGCCTGAAATTTAGCCCTGACGGGACATACCTAGCCTCC TCTTGTACGCCCGATCTTCCACATGACTTGACGGTGTCTTACCACTGAGAGAAAGCTTCGGATAAAAGTATTAAG ATCTGGGAGACAGAGACAGGCCAATTTGTTCATACTTTTGAAGGTCATCGTGAGGGGGTATCAGACGTGTCCTGG TCAAGCGACGGTGCATTCCTAGCCTCGGCTTCCGATGATAAAACCGTCATCATATGGAGTATGGAAGAGGTAAGG CGCTTGGTTATTCTTCTCTTTATTTGATCATTTTTCAAGGTGTACTGCAGAGAGAGGCTTTCAAGACCCTCCGTG GACACACGAACTTTGTATTCTGCGTGAATTTCAACCCTGATACTAATTTACTCGTCTCGGGAGGATATGATGAGA CCATACGCGTTTGGGACGTCGCAAGAGGTGCGTCATTATGCTCTATGTCCTTTCCTAGCTATCTCATCCTTTTAA GGCCGACAGCTCAAGGTTCTCCCTGCTCATTCTGACCCAGTAACCGCGGTCAGCTTTAACCATGACGGTTCTCTG ATTGTTTCTTGCGCGATGGACGGACTAATGTTGGTTGACCTATCCCAATCATGGATGAATATCTCTGACGCATCT GACAGACGGATTTGGGATGCGGACTCGGGTCAATGTTTGAAGACCCTGGTAGACGATGACAATCCCATATGGTTT GCACTCCGTATTCCGCAAGTCCACTGTTCTCATGATCGCCTCGTAGCTCCCATGCACGCTTTTCGAGCAATTCGA AGTTTGTCCTCGTTTCAACGCAAGATTCAACAATTCGGCTATGGAACTACCCTTCGTCACATTGTGCGAAGACAT ACGTAGGTCATGTCAACCGAACTTATTGTATTCCGTCATGTTTTCTTCTGTATGAACGGGGCAAATTTATTGTAA GCGGGAGTGAAGACAACAAGGTCTATATCTGGAATTTGCAAACACGGCAAGTGGTCCAGAGTCTCGATGGACACC GTGGTGCGTGGCGATAACAATTCCGTGGTGTATGTTCAATGACCACTCATTTGTATGAATCAGATACAGTCCTGT CTGTTGCGGCAAGTGAATATGCTCCGATGAGTAATTGTCGACTGACTGAGTATCCAGACACACCCTTCACGGGGA ATCATGGCATCTGCGGGGATGGAGAAGGACAAGTCTATTCGGCTGTGGTTTGACGAGTAG

Fungal Genomics

General Properties

PFAM Domains

Swissprot hits

GO

SignalP

Transmembrane Domains

Transcription Factor Class

Expression data

Sequences