Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|008090
Gene name
Locationscaffold_01a:1900565..1902730
Strand+
Gene length (bp)2165
Transcript length (bp)1644
Coding sequence length (bp)1644
Protein length (aa) 548

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10537 WAC_Acf1_DNA_bd ATP-utilising chromatin assembly and remodelling N-terminal 1.5E-34 29 129
PF02791 DDT DDT domain 1.1E-06 407 436

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53125|ITC1_YEAST Imitation switch two complex protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITC1 PE=1 SV=1 29 131 1.0E-17
sp|O88379|BAZ1A_MOUSE Bromodomain adjacent to zinc finger domain protein 1A OS=Mus musculus GN=Baz1a PE=1 SV=3 1 148 1.0E-13
sp|Q9NRL2|BAZ1A_HUMAN Bromodomain adjacent to zinc finger domain protein 1A OS=Homo sapiens GN=BAZ1A PE=1 SV=2 1 148 2.0E-13
sp|Q08964|YP216_YEAST Putative ISWI chromatin-remodeling complex subunit YPL216W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL216W PE=1 SV=1 33 131 3.0E-10
sp|Q54ST3|Y2237_DICDI DDT domain-containing protein DDB_G0282237 OS=Dictyostelium discoideum GN=DDB_G0282237 PE=3 SV=1 27 156 9.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
DDT

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|008090
MPTCRRKRVVLTEPTEELVRALETDPGREVFYLEETGEIFETYESYAARMSFYRLKQFQCEVTGKSGLDYFQAVE
SERQEARTMHARFSEPLKSPVLRAVQWQVMGRLDHLVEAVFDRFKDRYFKSEKVLVDIEGVKYYGLIEKVYPPRF
SADQQARDAFKDTDLSERTLDEEQPHLYGGDLNIPIQEANTKDNPELYYYWVHILELEKDKGEKSKVAKTATEKD
TKVIGSVMECQCNTLSRDRLSFSKSILRRFIRDCVDRDAAVASPWTVKPLIAKHYGVSSIMPEETRKGVEDIKKG
EIDKRKKVWEDREGPPTKKQKKMTAGQEGKVGRKEREAQEKAEKERLAKEEAEAERIAVEKKKKRPVRYPTEDLD
IRINDKDKKAGIHLQRPMAQRSGLPCNDSPNTFESMLLCWNFLNAYGEPLHVWHFTLDDLACEIHSNLIYNLRTV
PFTRHNATLSLLKLKETFGSEHEVFGVTVEQLMGALADVGNNWERVPLRHGEGREGWEDALVGCLKDHATLENFP
RLREILTQLFFSPPQDILFAVS*
Coding >Agabi119p4|008090
ATGCCTACTTGTCGCCGTAAGCGCGTAGTCCTCACCGAGCCCACGGAGGAGCTTGTCCGCGCTCTTGAAACAGAC
CCTGGGCGCGAGGTCTTCTACCTCGAGGAGACCGGCGAAATCTTCGAGACCTACGAGTCTTATGCTGCTCGCATG
TCCTTCTATCGGCTCAAGCAGTTCCAGTGCGAGGTCACCGGCAAAAGCGGTCTTGACTATTTTCAGGCAGTGGAA
AGTGAACGCCAGGAGGCCCGTACCATGCATGCTCGCTTCTCCGAACCCCTCAAGTCCCCTGTACTGAGAGCGGTG
CAATGGCAGGTCATGGGTCGTCTCGATCATCTTGTTGAAGCTGTCTTCGACCGCTTCAAGGATCGCTATTTTAAA
AGCGAGAAGGTGCTTGTAGATATTGAAGGCGTCAAATACTACGGTCTTATTGAAAAGGTCTATCCGCCTCGCTTT
AGTGCTGACCAGCAGGCAAGAGACGCCTTCAAGGACACTGATCTTTCCGAAAGAACTCTTGACGAAGAACAACCC
CATCTATATGGAGGCGACCTGAACATTCCAATACAGGAGGCAAATACGAAAGACAATCCCGAGTTATACTATTAC
TGGGTCCATATCCTCGAACTTGAGAAGGACAAGGGAGAAAAGAGTAAGGTGGCCAAAACAGCCACAGAAAAGGAC
ACCAAGGTCATTGGGAGTGTCATGGAGTGTCAGTGTAATACTTTAAGTCGCGACCGCTTATCCTTTTCAAAATCG
ATACTTCGTCGGTTTATTCGTGATTGCGTAGATCGCGATGCTGCTGTTGCTTCTCCCTGGACCGTCAAACCACTA
ATCGCCAAACATTATGGTGTGAGCTCTATCATGCCTGAAGAAACCCGCAAAGGGGTGGAAGATATTAAAAAGGGC
GAAATCGACAAACGGAAAAAAGTTTGGGAGGACAGAGAAGGTCCCCCGACTAAGAAACAAAAGAAAATGACGGCT
GGGCAAGAGGGCAAAGTTGGGAGGAAGGAACGCGAAGCTCAAGAAAAAGCGGAGAAGGAGAGACTGGCAAAAGAA
GAGGCAGAGGCAGAGCGTATAGCTGTCGAGAAAAAGAAGAAACGGCCTGTTCGCTACCCAACAGAAGACCTTGAT
ATCCGAATAAATGACAAAGATAAGAAAGCAGGTATTCATTTGCAACGCCCAATGGCTCAGCGGTCTGGTCTCCCT
TGCAATGATTCTCCGAATACCTTTGAGTCGATGCTGCTTTGTTGGAACTTCTTGAACGCTTACGGTGAACCCCTG
CATGTGTGGCATTTCACACTCGATGATCTGGCTTGCGAAATTCACTCGAATCTCATTTACAATCTTCGGACAGTG
CCCTTTACAAGGCATAATGCCACACTAAGCCTTCTGAAGCTCAAGGAAACCTTCGGCTCAGAACACGAGGTTTTT
GGTGTCACCGTAGAGCAGTTGATGGGCGCACTGGCCGACGTGGGTAACAACTGGGAACGAGTTCCTCTTCGTCAT
GGAGAGGGGCGCGAAGGTTGGGAGGATGCTTTGGTCGGTTGTTTGAAAGACCATGCTACCCTTGAAAATTTTCCT
CGCCTAAGGGAAATCCTAACACAATTGTTCTTTTCACCCCCTCAGGACATACTATTCGCTGTCTCCTGA
Transcript >Agabi119p4|008090
ATGCCTACTTGTCGCCGTAAGCGCGTAGTCCTCACCGAGCCCACGGAGGAGCTTGTCCGCGCTCTTGAAACAGAC
CCTGGGCGCGAGGTCTTCTACCTCGAGGAGACCGGCGAAATCTTCGAGACCTACGAGTCTTATGCTGCTCGCATG
TCCTTCTATCGGCTCAAGCAGTTCCAGTGCGAGGTCACCGGCAAAAGCGGTCTTGACTATTTTCAGGCAGTGGAA
AGTGAACGCCAGGAGGCCCGTACCATGCATGCTCGCTTCTCCGAACCCCTCAAGTCCCCTGTACTGAGAGCGGTG
CAATGGCAGGTCATGGGTCGTCTCGATCATCTTGTTGAAGCTGTCTTCGACCGCTTCAAGGATCGCTATTTTAAA
AGCGAGAAGGTGCTTGTAGATATTGAAGGCGTCAAATACTACGGTCTTATTGAAAAGGTCTATCCGCCTCGCTTT
AGTGCTGACCAGCAGGCAAGAGACGCCTTCAAGGACACTGATCTTTCCGAAAGAACTCTTGACGAAGAACAACCC
CATCTATATGGAGGCGACCTGAACATTCCAATACAGGAGGCAAATACGAAAGACAATCCCGAGTTATACTATTAC
TGGGTCCATATCCTCGAACTTGAGAAGGACAAGGGAGAAAAGAGTAAGGTGGCCAAAACAGCCACAGAAAAGGAC
ACCAAGGTCATTGGGAGTGTCATGGAGTGTCAGTGTAATACTTTAAGTCGCGACCGCTTATCCTTTTCAAAATCG
ATACTTCGTCGGTTTATTCGTGATTGCGTAGATCGCGATGCTGCTGTTGCTTCTCCCTGGACCGTCAAACCACTA
ATCGCCAAACATTATGGTGTGAGCTCTATCATGCCTGAAGAAACCCGCAAAGGGGTGGAAGATATTAAAAAGGGC
GAAATCGACAAACGGAAAAAAGTTTGGGAGGACAGAGAAGGTCCCCCGACTAAGAAACAAAAGAAAATGACGGCT
GGGCAAGAGGGCAAAGTTGGGAGGAAGGAACGCGAAGCTCAAGAAAAAGCGGAGAAGGAGAGACTGGCAAAAGAA
GAGGCAGAGGCAGAGCGTATAGCTGTCGAGAAAAAGAAGAAACGGCCTGTTCGCTACCCAACAGAAGACCTTGAT
ATCCGAATAAATGACAAAGATAAGAAAGCAGGTATTCATTTGCAACGCCCAATGGCTCAGCGGTCTGGTCTCCCT
TGCAATGATTCTCCGAATACCTTTGAGTCGATGCTGCTTTGTTGGAACTTCTTGAACGCTTACGGTGAACCCCTG
CATGTGTGGCATTTCACACTCGATGATCTGGCTTGCGAAATTCACTCGAATCTCATTTACAATCTTCGGACAGTG
CCCTTTACAAGGCATAATGCCACACTAAGCCTTCTGAAGCTCAAGGAAACCTTCGGCTCAGAACACGAGGTTTTT
GGTGTCACCGTAGAGCAGTTGATGGGCGCACTGGCCGACGTGGGTAACAACTGGGAACGAGTTCCTCTTCGTCAT
GGAGAGGGGCGCGAAGGTTGGGAGGATGCTTTGGTCGGTTGTTTGAAAGACCATGCTACCCTTGAAAATTTTCCT
CGCCTAAGGGAAATCCTAACACAATTGTTCTTTTCACCCCCTCAGGACATACTATTCGCTGTCTCCTGA
Gene >Agabi119p4|008090
ATGCCTACTTGTCGCCGTAAGCGCGTAGTCCTCACCGAGCCCACGGAGGAGCTTGTCCGCGCTCTTGAAACAGAC
CCTGGGCGCGAGGTCTTCTACCTCGAGGAGACCGGCGAAATCTTCGAGACCTACGAGTGCGTCCATCCTTCTTCT
CCTCATTACGCCTCATCTTACCTCTCTCGTACAGGTCTTATGCTGCTCGCATGTCCTTCTATCGGCTCAAGCAGT
TCCAGTGCGAGGTCACCGGCAAAAGCGGTCTTGACTATTTTCAGGCAGTGGAAAGTGAACGCCAGGAGGCCCGTA
CCATGCATGCTCGCTTCTCCGAACCCCTCAAGTCCCCTGTACTGAGAGCGGTGCAATGGCGTATGTCCATCTCTA
TCTATCTCTTGTCTAATATACTTAATTTCGCATCAAGAGGTCATGGGTCGTCTCGATCATCTTGTTGAAGCTGTC
TTCGACCGCTTCAAGGATCGCTATTTTAAAAGCGAGAGTGCGTCTTCATAAACAACCCGCTCTTCCTTCCTAACT
GTTATCTCTAGAGGTGCTTGTAGATATTGAAGGCGTCAAGTATGTTTGTCTCTTTTGACATCGTGCTCATACCAA
TCAAGTTTCCACAGATACTACGGTCTTATTGAAAAGGTCTATCCGCCTCGCTTTAGTGCTGACCAGCAGGCAAGA
GACGCCTTCAAGGACACTGATCTTTCCGAAAGAACTCTTGACGAAGAACAACCCCATCTATATGGAGGCGACCTG
AACATTCCAATACAGGAGGCAAATACGAAAGACAATCCCGAGTTATACTATTACTGGGTCCATATCCTCGAACTT
GAGAAGGACAAGGGAGAAAAGAGTAAGGTGGCCAAAACAGCCACAGAAAAGGACACCAAGGTCATTGGGAGTGTC
ATGGAGTGTCAGTGTAATACTTTAAGGTGAGCTCGTTGCTATCCCCTGACTCTTATGTTGCTGGATCGTTTGCTA
TCCTTCAGTCGCGACCGCTTATCCTTTTCAAAATCGATACTTCGTCGGTTTATTCGTGATTGCGTAGATCGCGAT
GCTGCTGTTGCTTCTCCCTGGACCGTCAAACCACTAATCGCCAAACATTATGGTGTGAGCTCTATCATGCCTGAA
GAAACCCGCAAAGGGGTGGAAGATATTAAAAAGGGCGAAATCGACAAACGGAAAAAAGTTTGGGAGGACAGAGAA
GGTCCCCCGACTAAGAAACAAAAGAAAATGACGGCTGGGCAAGAGGGCAAAGGTGTGTTAACCCCGTTTTATCCT
TTCTCCCGCCTTAGACCCGTTGCCCTTTGTAGTTGGGAGGAAGGAACGCGAAGCTCAAGAAAAAGCGGAGAAGGA
GAGACTGGCAAAAGAAGAGGCAGAGGCAGAGCGTATAGCTGTCGAGAAAAAGAAGAAACGGCCTGTTCGCTACCC
AACAGAAGACCTTGATATCCGAATAAATGACAAAGATAAGAAAGCAGGTATTCATTTGCAACGCCCAATGGCTCA
GCGGTCTGGTCTCCCTTGCAATGATTCTCCGAATACCTTTGAGTCGATGCTGCTTTGTTGGAACTTCTTGAACGC
TTACGGGTGGGTCAACCCCTGGTCTGCCTAAGTACTGTCTGATTTCATATTGTAGTGAACCCCTGCATGTGTGGC
ATTTCACACTCGATGATCTGGCTTGTGCGTTGCAGCACACAATGTCCGATTTGCCATGCCCTTTATTAGGCGAAA
TTCACTCGAATCTCATTTACAATCTTCGGACAGTGCCCTTTACAAGGCATAATGCCACACTAAGCCTTCTGAAGC
TCAAGGAAACCTTCGGCTCAGAACACGAGGTTTTTGGTGTCACCGTAGAGCAGTTGATGGGCGCACTGGCCGACG
TGGGTAACAACTGGGAACGAGTTCCTCTTCGTCATGGAGAGGGGCGCGAAGGTTGGGAGGATGCTTTGGTCGGTT
GTTTGAAAGACGTACGTACCTCGAAGGTATAACCTATATAAAAACTTATATATTCCTTAGCATGCTACCCTTGAA
AATTTTCCTCGCCTAAGGGAAATCCTAACACAATTGTTCTTTTCACCCCCTCAGGACGTCAGTGAAACTAGTTGC
AGTGACGTTCAGACCCTCACACATCCTTCGTTGCCTGCTGAAAGATACTATTCGCTGTCTCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail