Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|008070
Gene name
Locationscaffold_01a:1893701..1896157
Strand+
Gene length (bp)2456
Transcript length (bp)1530
Coding sequence length (bp)1530
Protein length (aa) 510

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00134 Cyclin_N Cyclin, N-terminal domain 1.5E-37 152 278
PF02984 Cyclin_C Cyclin, C-terminal domain 5.4E-10 281 373

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q59YH3|CG11_CANAL G1/S-specific cyclin CCN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CCN1 PE=1 SV=1 144 334 3.0E-53
sp|P0CY18|CG11_CANAX G1/S-specific cyclin CLN1 OS=Candida albicans GN=CLN1 PE=3 SV=1 144 334 3.0E-53
sp|C4YR54|CG11_CANAW G1/S-specific cyclin CCN1 OS=Candida albicans (strain WO-1) GN=CCN1 PE=3 SV=1 144 334 3.0E-53
sp|P25009|PUC1_SCHPO Cyclin puc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=puc1 PE=3 SV=1 95 339 2.0E-39
sp|P10815|CG23_SCHPO G2/mitotic-specific cyclin cdc13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc13 PE=1 SV=1 143 389 3.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q59YH3|CG11_CANAL G1/S-specific cyclin CCN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CCN1 PE=1 SV=1 144 334 3.0E-53
sp|P0CY18|CG11_CANAX G1/S-specific cyclin CLN1 OS=Candida albicans GN=CLN1 PE=3 SV=1 144 334 3.0E-53
sp|C4YR54|CG11_CANAW G1/S-specific cyclin CCN1 OS=Candida albicans (strain WO-1) GN=CCN1 PE=3 SV=1 144 334 3.0E-53
sp|P25009|PUC1_SCHPO Cyclin puc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=puc1 PE=3 SV=1 95 339 2.0E-39
sp|P10815|CG23_SCHPO G2/mitotic-specific cyclin cdc13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc13 PE=1 SV=1 143 389 3.0E-37
sp|P30284|CG21_EMENI G2/mitotic-specific cyclin-B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nimE PE=2 SV=1 143 392 5.0E-37
sp|Q5A0A9|CG24_CANAL G2/mitotic-specific cyclin-4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLB4 PE=1 SV=1 147 393 8.0E-34
sp|P43062|CG12_CANAX G1/S-specific cyclin CLN2 OS=Candida albicans GN=CLN2 PE=3 SV=1 147 289 2.0E-33
sp|Q5A1N6|CG13_CANAL G1/S-specific cyclin CLN3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLN3 PE=1 SV=1 147 289 6.0E-33
sp|P24870|CG23_YEAST G2/mitotic-specific cyclin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB3 PE=1 SV=3 147 342 1.0E-30
sp|P24871|CG24_YEAST G2/mitotic-specific cyclin-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB4 PE=1 SV=2 141 341 2.0E-30
sp|P30278|CCNB2_MEDSA G2/mitotic-specific cyclin-2 (Fragment) OS=Medicago sativa PE=2 SV=1 137 335 5.0E-30
sp|P36630|CG22_SCHPO G2/mitotic-specific cyclin cig2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cig2 PE=1 SV=2 143 395 8.0E-30
sp|P46278|CCNB2_MEDSV G2/mitotic-specific cyclin-2 OS=Medicago sativa subsp. varia PE=2 SV=1 137 335 9.0E-30
sp|Q0D9C7|CCB22_ORYSJ Cyclin-B2-2 OS=Oryza sativa subsp. japonica GN=CYCB2-2 PE=1 SV=1 137 335 4.0E-28
sp|A2YH60|CCB22_ORYSI Cyclin-B2-2 OS=Oryza sativa subsp. indica GN=CYCB2-2 PE=1 SV=2 137 335 4.0E-28
sp|Q7XSJ6|CCB21_ORYSJ Cyclin-B2-1 OS=Oryza sativa subsp. japonica GN=CYCB2-1 PE=1 SV=2 147 350 9.0E-28
sp|Q01J96|CCB21_ORYSI Cyclin-B2-1 OS=Oryza sativa subsp. indica GN=CYCB2-1 PE=1 SV=1 147 350 1.0E-27
sp|Q39069|CCB13_ARATH Cyclin-B1-3 OS=Arabidopsis thaliana GN=CYCB1-3 PE=2 SV=2 133 348 2.0E-27
sp|P34800|CCN1_ANTMA G2/mitotic-specific cyclin-1 OS=Antirrhinum majus PE=2 SV=1 155 348 7.0E-27
sp|P34801|CCN2_ANTMA G2/mitotic-specific cyclin-2 OS=Antirrhinum majus PE=2 SV=1 155 348 3.0E-26
sp|Q0DJR9|CCA14_ORYSJ Cyclin-A1-4 OS=Oryza sativa subsp. japonica GN=CYCA1-4 PE=2 SV=2 173 348 5.0E-26
sp|P37883|CCNB2_MESAU G2/mitotic-specific cyclin-B2 OS=Mesocricetus auratus GN=CCNB2 PE=2 SV=1 92 380 7.0E-26
sp|Q9FVX0|CCA12_ARATH Cyclin-A1-2 OS=Arabidopsis thaliana GN=CYCA1-2 PE=1 SV=2 173 404 8.0E-26
sp|P37881|CCNA2_MESAU Cyclin-A2 OS=Mesocricetus auratus GN=CCNA2 PE=2 SV=1 141 348 1.0E-25
sp|Q4R7A8|CCNB2_MACFA G2/mitotic-specific cyclin-B2 OS=Macaca fascicularis GN=CCNB2 PE=2 SV=1 129 380 1.0E-25
sp|Q9LDM4|CCB23_ARATH Cyclin-B2-3 OS=Arabidopsis thaliana GN=CYCB2-3 PE=2 SV=2 126 335 1.0E-25
sp|O95067|CCNB2_HUMAN G2/mitotic-specific cyclin-B2 OS=Homo sapiens GN=CCNB2 PE=1 SV=1 129 380 1.0E-25
sp|Q9C6Y3|CCA11_ARATH Cyclin-A1-1 OS=Arabidopsis thaliana GN=CYCA1-1 PE=1 SV=1 173 348 2.0E-25
sp|P30183|CCB11_ARATH Cyclin-B1-1 OS=Arabidopsis thaliana GN=CYCB1-1 PE=1 SV=2 126 335 2.0E-25
sp|P20248|CCNA2_HUMAN Cyclin-A2 OS=Homo sapiens GN=CCNA2 PE=1 SV=2 141 380 2.0E-25
sp|Q0JIF2|CCB11_ORYSJ Cyclin-B1-1 OS=Oryza sativa subsp. japonica GN=CYCB1-1 PE=2 SV=2 170 348 2.0E-25
sp|P30274|CCNA2_BOVIN Cyclin-A2 OS=Bos taurus GN=CCNA2 PE=1 SV=2 141 356 3.0E-25
sp|P30276|CCNB2_MOUSE G2/mitotic-specific cyclin-B2 OS=Mus musculus GN=Ccnb2 PE=1 SV=2 129 380 4.0E-25
sp|P51943|CCNA2_MOUSE Cyclin-A2 OS=Mus musculus GN=Ccna2 PE=1 SV=2 141 356 8.0E-25
sp|Q7F830|CCA11_ORYSJ Cyclin-A1-1 OS=Oryza sativa subsp. japonica GN=CYCA1-1 PE=2 SV=1 155 348 9.0E-25
sp|P46277|CCNB1_MEDSV G2/mitotic-specific cyclin-1 OS=Medicago sativa subsp. varia PE=2 SV=1 147 335 1.0E-24
sp|Q39068|CCB21_ARATH Cyclin-B2-1 OS=Arabidopsis thaliana GN=CYCB2-1 PE=1 SV=2 147 350 1.0E-24
sp|P18606|CCNA1_XENLA Cyclin-A1 OS=Xenopus laevis GN=ccna1 PE=2 SV=1 147 352 1.0E-24
sp|P24869|CG22_YEAST G2/mitotic-specific cyclin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB2 PE=1 SV=1 147 395 1.0E-24
sp|Q0JPA4|CCA12_ORYSJ Cyclin-A1-2 OS=Oryza sativa subsp. japonica GN=CYCA1-2 PE=3 SV=2 155 348 1.0E-24
sp|P25010|CCNAL_DAUCA G2/mitotic-specific cyclin C13-1 (Fragment) OS=Daucus carota PE=2 SV=1 148 336 3.0E-24
sp|O77689|CCNB2_BOVIN G2/mitotic-specific cyclin-B2 OS=Bos taurus GN=CCNB2 PE=2 SV=2 129 375 4.0E-24
sp|P13952|CCNB_SPISO G2/mitotic-specific cyclin-B OS=Spisula solidissima PE=2 SV=1 139 348 4.0E-24
sp|Q0INT0|CCA13_ORYSJ Cyclin-A1-3 OS=Oryza sativa subsp. japonica GN=CYCA1-3 PE=2 SV=2 155 348 5.0E-24
sp|P25012|CCNB2_SOYBN G2/mitotic-specific cyclin S13-7 (Fragment) OS=Glycine max PE=2 SV=1 170 348 5.0E-24
sp|Q6AY13|CCNA1_RAT Cyclin-A1 OS=Rattus norvegicus GN=Ccna1 PE=2 SV=1 147 348 5.0E-24
sp|Q61456|CCNA1_MOUSE Cyclin-A1 OS=Mus musculus GN=Ccna1 PE=1 SV=2 147 348 5.0E-24
sp|P51988|CCNB_HYDVU G2/mitotic-specific cyclin-B (Fragment) OS=Hydra vulgaris PE=2 SV=1 147 326 5.0E-24
sp|Q810T2|CCNB3_MOUSE G2/mitotic-specific cyclin-B3 OS=Mus musculus GN=Ccnb3 PE=1 SV=2 149 358 6.0E-24
sp|P51986|CCNA_HYDVD G2/mitotic-specific cyclin-A (Fragment) OS=Hydra viridissima PE=2 SV=1 147 339 6.0E-24
sp|Q2QQ96|CCA21_ORYSJ Cyclin-A2-1 OS=Oryza sativa subsp. japonica GN=CYCA2-1 PE=2 SV=1 173 350 8.0E-24
sp|P24861|CCNA_PATVU G2/mitotic-specific cyclin-A OS=Patella vulgata PE=2 SV=1 139 360 9.0E-24
sp|P78396|CCNA1_HUMAN Cyclin-A1 OS=Homo sapiens GN=CCNA1 PE=1 SV=1 147 348 1.0E-23
sp|P07818|CCNB_ARBPU G2/mitotic-specific cyclin-B OS=Arbacia punctulata PE=2 SV=1 147 337 2.0E-23
sp|Q0DH40|CCB15_ORYSJ Cyclin-B1-5 OS=Oryza sativa subsp. japonica GN=CYCB1-5 PE=3 SV=1 147 348 2.0E-23
sp|P43449|CCNA2_CHICK Cyclin-A2 OS=Gallus gallus GN=CCNA2 PE=2 SV=1 147 348 2.0E-23
sp|P14635|CCNB1_HUMAN G2/mitotic-specific cyclin-B1 OS=Homo sapiens GN=CCNB1 PE=1 SV=1 147 388 3.0E-23
sp|Q9DGA3|CCNB2_ORYCU G2/mitotic-specific cyclin-B2 OS=Oryzias curvinotus GN=ccnb2 PE=2 SV=1 65 337 4.0E-23
sp|P15206|CCNB_MARGL G2/mitotic-specific cyclin-B OS=Marthasterias glacialis PE=2 SV=1 147 334 5.0E-23
sp|P51987|CCNB_HYDVD G2/mitotic-specific cyclin-B OS=Hydra viridissima PE=2 SV=1 147 341 5.0E-23
sp|P24860|CCNB1_MOUSE G2/mitotic-specific cyclin-B1 OS=Mus musculus GN=Ccnb1 PE=1 SV=3 147 388 5.0E-23
sp|Q39067|CCB12_ARATH Cyclin-B1-2 OS=Arabidopsis thaliana GN=CYCB1-2 PE=1 SV=2 139 341 5.0E-23
sp|Q9DG96|CCNB2_ORYLU G2/mitotic-specific cyclin-B2 OS=Oryzias luzonensis GN=ccnb2 PE=2 SV=1 65 337 5.0E-23
sp|P42524|CCNB_DICDI G2/mitotic-specific cyclin-B OS=Dictyostelium discoideum GN=cycB PE=1 SV=1 147 350 6.0E-23
sp|P25011|CCNB1_SOYBN G2/mitotic-specific cyclin S13-6 OS=Glycine max PE=2 SV=1 147 348 7.0E-23
sp|P24865|CG21_SCHPO G2/mitotic-specific cyclin cig1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cig1 PE=1 SV=2 147 339 1.0E-22
sp|O48790|CCB14_ARATH Cyclin-B1-4 OS=Arabidopsis thaliana GN=CYCB1-4 PE=2 SV=1 170 348 1.0E-22
sp|Q39070|CCB22_ARATH Cyclin-B2-2 OS=Arabidopsis thaliana GN=CYCB2-2 PE=1 SV=2 147 335 1.0E-22
sp|Q9DGA0|CCNB1_ORYJA G2/mitotic-specific cyclin-B1 OS=Oryzias javanicus GN=ccnb1 PE=2 SV=2 143 388 2.0E-22
sp|P37882|CCNB1_MESAU G2/mitotic-specific cyclin-B1 OS=Mesocricetus auratus GN=CCNB1 PE=2 SV=1 147 388 2.0E-22
sp|P04962|CCNA_SPISO G2/mitotic-specific cyclin-A OS=Spisula solidissima PE=2 SV=1 133 339 2.0E-22
sp|Q9SA32|CCB31_ARATH Putative cyclin-B3-1 OS=Arabidopsis thaliana GN=CYCB3-1 PE=3 SV=2 147 335 3.0E-22
sp|P47827|CCNA2_XENLA Cyclin-A2 OS=Xenopus laevis GN=ccna2 PE=2 SV=1 147 379 3.0E-22
sp|Q08301|CCNB1_CRIGR G2/mitotic-specific cyclin-B1 OS=Cricetulus griseus GN=CCNB1 PE=2 SV=1 175 388 3.0E-22
sp|Q9SFW6|CCB24_ARATH Cyclin-B2-4 OS=Arabidopsis thaliana GN=CYCB2-4 PE=2 SV=2 137 350 4.0E-22
sp|Q147G5|CCA22_ARATH Cyclin-A2-2 OS=Arabidopsis thaliana GN=CYCA2-2 PE=2 SV=1 173 348 4.0E-22
sp|Q1LZG6|CCNB1_BOVIN G2/mitotic-specific cyclin-B1 OS=Bos taurus GN=CCNB1 PE=2 SV=1 147 334 5.0E-22
sp|Q9IBG0|CCNB2_ORYLA G2/mitotic-specific cyclin-B2 OS=Oryzias latipes GN=ccnb2 PE=2 SV=1 147 337 5.0E-22
sp|Q9DGA4|CCNB1_ORYCU G2/mitotic-specific cyclin-B1 OS=Oryzias curvinotus GN=ccnb1 PE=2 SV=1 143 333 9.0E-22
sp|Q9I7I0|CCNB3_DROME G2/mitotic-specific cyclin-B3 OS=Drosophila melanogaster GN=CycB3 PE=1 SV=1 170 397 1.0E-21
sp|Q9FMH5|CCA31_ARATH Putative cyclin-A3-1 OS=Arabidopsis thaliana GN=CYCA3-1 PE=3 SV=1 173 390 1.0E-21
sp|P30277|CCNB1_RAT G2/mitotic-specific cyclin-B1 OS=Rattus norvegicus GN=Ccnb1 PE=2 SV=1 175 388 2.0E-21
sp|P24862|CCNB_PATVU G2/mitotic-specific cyclin-B OS=Patella vulgata PE=2 SV=1 144 348 2.0E-21
sp|Q60FY0|CCNB1_ANGJA G2/mitotic-specific cyclin-B1 OS=Anguilla japonica GN=ccnb1 PE=2 SV=1 143 340 2.0E-21
sp|Q39071|CCA21_ARATH Cyclin-A2-1 OS=Arabidopsis thaliana GN=CYCA2-1 PE=2 SV=3 166 348 3.0E-21
sp|Q5ALY0|CG21_CANAL G2/mitotic-specific cyclin CLB2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLB2 PE=1 SV=1 143 388 3.0E-21
sp|Q60FX9|CCNB2_ANGJA G2/mitotic-specific cyclin-B2 OS=Anguilla japonica GN=ccnb2 PE=2 SV=1 147 350 4.0E-21
sp|P30283|CGS5_YEAST S-phase entry cyclin-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB5 PE=1 SV=1 132 348 6.0E-21
sp|Q9C6A9|CCA32_ARATH Cyclin-A3-2 OS=Arabidopsis thaliana GN=CYCA3-2 PE=2 SV=1 173 350 1.0E-20
sp|P29332|CCNB2_CHICK G2/mitotic-specific cyclin-B2 OS=Gallus gallus GN=CCNB2 PE=2 SV=1 147 342 1.0E-20
sp|P47829|CG21_CANAX G2/mitotic-specific cyclin CYB1 OS=Candida albicans GN=CYB1 PE=2 SV=1 143 388 1.0E-20
sp|Q3ECW2|CCA34_ARATH Cyclin-A3-4 OS=Arabidopsis thaliana GN=CYCA3-4 PE=1 SV=1 173 390 1.0E-20
sp|Q9DG97|CCNB1_ORYLU G2/mitotic-specific cyclin-B1 OS=Oryzias luzonensis GN=ccnb1 PE=2 SV=1 143 333 1.0E-20
sp|P13351|CCNB2_XENLA G2/mitotic-specific cyclin-B2 OS=Xenopus laevis GN=ccnb2 PE=1 SV=1 175 341 2.0E-20
sp|Q9DG99|CCNB2_ORYJA G2/mitotic-specific cyclin-B2 OS=Oryzias javanicus GN=ccnb2 PE=2 SV=1 147 337 2.0E-20
sp|Q659K0|CCNB3_CANLF G2/mitotic-specific cyclin-B3 OS=Canis lupus familiaris GN=CCNB3 PE=2 SV=1 148 345 2.0E-20
sp|P14785|CCNA_DROME G2/mitotic-specific cyclin-A OS=Drosophila melanogaster GN=CycA PE=1 SV=3 152 386 2.0E-20
sp|P32943|CGS6_YEAST S-phase entry cyclin-6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB6 PE=2 SV=2 147 348 3.0E-20
sp|A0MEB5|CCA33_ARATH Cyclin-A3-3 OS=Arabidopsis thaliana GN=CYCA3-3 PE=2 SV=2 173 351 3.0E-20
sp|P13350|CCNB1_XENLA G2/mitotic-specific cyclin-B1 OS=Xenopus laevis GN=ccnb1 PE=1 SV=1 143 380 5.0E-20
sp|O93229|CCNB2_RANJA G2/mitotic-specific cyclin-B2 OS=Rana japonica GN=CCNB2 PE=2 SV=1 147 339 7.0E-20
sp|P18063|CCNB_PATPE G2/mitotic-specific cyclin-B OS=Patiria pectinifera PE=2 SV=2 147 350 8.0E-20
sp|Q0JNK6|CCB13_ORYSJ Cyclin-B1-3 OS=Oryza sativa subsp. japonica GN=CYCB1-3 PE=2 SV=2 155 350 9.0E-20
sp|Q9IBG1|CCNB1_ORYLA G2/mitotic-specific cyclin-B1 OS=Oryzias latipes GN=ccnb1 PE=2 SV=1 143 333 1.0E-19
sp|Q92162|CCNB1_CARAU G2/mitotic-specific cyclin-B1 OS=Carassius auratus GN=ccnb1 PE=2 SV=1 143 380 2.0E-19
sp|P13365|CG13_YEAST G1/S-specific cyclin CLN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLN3 PE=1 SV=2 144 384 7.0E-19
sp|Q9C968|CCA24_ARATH Cyclin-A2-4 OS=Arabidopsis thaliana GN=CYCA2-4 PE=2 SV=1 173 365 7.0E-19
sp|Q38819|CCA23_ARATH Cyclin-A2-3 OS=Arabidopsis thaliana GN=CYCA2-3 PE=1 SV=2 173 365 9.0E-19
sp|Q8WWL7|CCNB3_HUMAN G2/mitotic-specific cyclin-B3 OS=Homo sapiens GN=CCNB3 PE=1 SV=2 148 313 1.0E-18
sp|Q92161|CCNA1_CARAU Cyclin-A1 OS=Carassius auratus GN=ccna1 PE=2 SV=1 140 348 3.0E-18
sp|P24868|CG21_YEAST G2/mitotic-specific cyclin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB1 PE=1 SV=1 142 341 4.0E-18
sp|P20439|CCNB_DROME G2/mitotic-specific cyclin-B OS=Drosophila melanogaster GN=CycB PE=1 SV=2 139 343 4.0E-18
sp|P39963|CCNB3_CHICK G2/mitotic-specific cyclin-B3 OS=Gallus gallus GN=CCNB3 PE=2 SV=1 147 313 5.0E-18
sp|O14332|REM1_SCHPO Meiosis-specific cyclin rem1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rem1 PE=3 SV=1 147 387 9.0E-18
sp|Q75I54|CCA31_ORYSJ Cyclin-A3-1 OS=Oryza sativa subsp. japonica GN=CYCA3-1 PE=3 SV=1 83 289 2.0E-17
sp|Q10Q63|CCF31_ORYSJ Putative cyclin-F3-1 OS=Oryza sativa subsp. japonica GN=CYCF3-1 PE=3 SV=1 155 366 2.0E-17
sp|Q10653|CCNB1_CAEEL G2/mitotic-specific cyclin-B1 OS=Caenorhabditis elegans GN=cyb-1 PE=1 SV=1 150 334 1.0E-16
sp|Q10Q62|CCF32_ORYSJ Putative cyclin-F3-2 OS=Oryza sativa subsp. japonica GN=CYCF3-2 PE=3 SV=1 179 360 1.0E-16
sp|P34638|CCNA1_CAEEL G2/mitotic-specific cyclin-A1 OS=Caenorhabditis elegans GN=cya-1 PE=1 SV=2 132 334 2.0E-16
sp|Q2QN26|CCA32_ORYSJ Cyclin-A3-2 OS=Oryza sativa subsp. japonica GN=CYCA3-2 PE=2 SV=1 147 288 6.0E-16
sp|P22674|CCNO_HUMAN Cyclin-O OS=Homo sapiens GN=CCNO PE=1 SV=2 168 376 5.0E-15
sp|Q32NJ2|CCNOA_XENLA Cyclin-O protein A OS=Xenopus laevis GN=ccno-a PE=2 SV=1 155 338 5.0E-15
sp|Q32NM1|CCNOB_XENLA Cyclin-O protein B OS=Xenopus laevis GN=ccno-b PE=2 SV=1 153 341 5.0E-14
sp|Q10654|CCNB3_CAEEL G2/mitotic-specific cyclin-B3 OS=Caenorhabditis elegans GN=cyb-3 PE=2 SV=3 154 341 6.0E-14
sp|Q5ABE2|HGC1_CANAL Hypha-specific G1 cyclin-related protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HGC1 PE=1 SV=1 172 287 5.0E-13
sp|P0C242|CCNO_MOUSE Cyclin-O OS=Mus musculus GN=Ccno PE=1 SV=1 168 365 9.0E-13
sp|Q06374|CG1_COLGL Putative G1/S-specific cyclin OS=Colletotrichum gloeosporioides GN=CYC1 PE=2 SV=1 138 331 3.0E-12
sp|P47794|CCNE1_DANRE G1/S-specific cyclin-E1 OS=Danio rerio GN=ccne1 PE=2 SV=1 149 308 2.0E-11
sp|P20437|CG11_YEAST G1/S-specific cyclin CLN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLN1 PE=1 SV=2 146 287 2.0E-11
sp|Q8MUK3|CCNE_CAEBR G1/S-specific cyclin-E OS=Caenorhabditis briggsae GN=cye-1 PE=2 SV=1 165 287 4.0E-11
sp|P20438|CG12_YEAST G1/S-specific cyclin CLN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLN2 PE=1 SV=2 170 287 7.0E-11
sp|Q61457|CCNE1_MOUSE G1/S-specific cyclin-E1 OS=Mus musculus GN=Ccne1 PE=1 SV=2 149 309 2.0E-10
sp|P39949|CCNE1_RAT G1/S-specific cyclin-E1 OS=Rattus norvegicus GN=Ccne1 PE=2 SV=2 149 309 2.0E-10
sp|O42575|CCNE3_XENLA G1/S-specific cyclin-E3 OS=Xenopus laevis GN=cyce3 PE=2 SV=1 149 306 2.0E-10
sp|P24864|CCNE1_HUMAN G1/S-specific cyclin-E1 OS=Homo sapiens GN=CCNE1 PE=1 SV=2 149 289 3.0E-10
sp|P51944|CCNF_MOUSE Cyclin-F OS=Mus musculus GN=Ccnf PE=2 SV=2 180 323 8.0E-10
sp|Q8K4F8|CCNF_RAT Cyclin-F OS=Rattus norvegicus GN=Ccnf PE=2 SV=2 180 323 8.0E-10
sp|P49707|CCNE1_CHICK G1/S-specific cyclin-E1 OS=Gallus gallus GN=CCNE1 PE=2 SV=1 149 298 1.0E-09
sp|P54733|CCNE_DROME G1/S-specific cyclin-E OS=Drosophila melanogaster GN=CycE PE=1 SV=2 150 289 1.0E-09
sp|Q91780|CCNE2_XENLA G1/S-specific cyclin-E2 OS=Xenopus laevis GN=cyce2 PE=2 SV=1 149 308 1.0E-09
sp|P50756|CCNE1_XENLA G1/S-specific cyclin-E1 OS=Xenopus laevis GN=cyce1 PE=2 SV=1 149 308 1.0E-09
sp|Q9Z238|CCNE2_MOUSE G1/S-specific cyclin-E2 OS=Mus musculus GN=Ccne2 PE=1 SV=1 143 289 2.0E-09
sp|Q39072|CCB15_ARATH Cyclin-B1-5 OS=Arabidopsis thaliana GN=CYCB1-5 PE=2 SV=3 147 287 2.0E-09
sp|P41002|CCNF_HUMAN Cyclin-F OS=Homo sapiens GN=CCNF PE=1 SV=2 164 315 3.0E-09
sp|O01501|CCNE_CAEEL G1/S-specific cyclin-E OS=Caenorhabditis elegans GN=cye-1 PE=2 SV=2 161 287 4.0E-09
sp|O96020|CCNE2_HUMAN G1/S-specific cyclin-E2 OS=Homo sapiens GN=CCNE2 PE=1 SV=1 137 289 5.0E-09
sp|Q9LM91|CCB25_ARATH Cyclin-B2-5 OS=Arabidopsis thaliana GN=CYCB2-5 PE=3 SV=2 208 335 5.0E-09
sp|Q5E9K7|CCNE2_BOVIN G1/S-specific cyclin-E2 OS=Bos taurus GN=CCNE2 PE=2 SV=1 175 289 7.0E-09
sp|A5PK16|CCNF_BOVIN Cyclin-F OS=Bos taurus GN=CCNF PE=2 SV=1 180 315 2.0E-08
sp|Q5XGG5|CCNF_XENTR Cyclin-F OS=Xenopus tropicalis GN=ccnf PE=2 SV=1 180 323 2.0E-08
sp|Q7T0L6|CCNF_XENLA Cyclin-F OS=Xenopus laevis GN=ccnf PE=2 SV=1 180 323 2.0E-08
sp|O15995|CCNE_HEMPU G1/S-specific cyclin-E OS=Hemicentrotus pulcherrimus GN=CYCE PE=2 SV=1 170 287 3.0E-08
sp|Q6NYX6|CCNF_DANRE Cyclin-F OS=Danio rerio GN=ccnf PE=2 SV=1 159 337 5.0E-08
sp|Q9H8S5|CNTD2_HUMAN Cyclin N-terminal domain-containing protein 2 OS=Homo sapiens GN=CNTD2 PE=2 SV=2 179 280 8.0E-08
sp|P51945|CCNG1_MOUSE Cyclin-G1 OS=Mus musculus GN=Ccng1 PE=2 SV=2 186 289 3.0E-07
sp|P39950|CCNG1_RAT Cyclin-G1 OS=Rattus norvegicus GN=Ccng1 PE=2 SV=2 186 289 8.0E-07
sp|Q5E9I1|CCNG1_BOVIN Cyclin-G1 OS=Bos taurus GN=CCNG1 PE=2 SV=1 186 289 9.0E-07
sp|Q52QT8|CCNG1_PIG Cyclin-G1 OS=Sus scrofa GN=CCNG1 PE=2 SV=1 186 289 1.0E-06
sp|Q5SCB5|CCND_OSTTA Cyclin-D OS=Ostreococcus tauri GN=CycD PE=3 SV=1 181 339 1.0E-06
sp|P51959|CCNG1_HUMAN Cyclin-G1 OS=Homo sapiens GN=CCNG1 PE=1 SV=2 186 289 1.0E-06
sp|Q5R5D0|CCNG1_PONAB Cyclin-G1 OS=Pongo abelii GN=CCNG1 PE=2 SV=1 186 289 1.0E-06
sp|P55169|CCND1_CHICK G1/S-specific cyclin-D1 OS=Gallus gallus GN=CCND1 PE=2 SV=1 173 334 2.0E-06
sp|Q3MHH5|CCND3_BOVIN G1/S-specific cyclin-D3 OS=Bos taurus GN=CCND3 PE=2 SV=1 160 355 4.0E-06
sp|P30282|CCND3_MOUSE G1/S-specific cyclin-D3 OS=Mus musculus GN=Ccnd3 PE=1 SV=1 160 355 6.0E-06
sp|P48961|CCND3_RAT G1/S-specific cyclin-D3 OS=Rattus norvegicus GN=Ccnd3 PE=1 SV=1 173 355 6.0E-06
sp|Q14094|CCNI_HUMAN Cyclin-I OS=Homo sapiens GN=CCNI PE=2 SV=1 138 289 7.0E-06
sp|Q10PQ9|CCSDS_ORYSJ Cyclin-SDS-like OS=Oryza sativa subsp. japonica GN=SDS PE=2 SV=1 181 325 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|008070
MYVTNFHMHWRFADMHQCRSLVVYIKDNSRHPLNSDPFEPAVSLFVALSTDCFISSPSSPTSSPSDITGLDMKDT
SVSATRQSRNSLVYPKKRPSPHGIHKASKSPSLLASYACRSPRSAKLALLQQQQRLREAQFCRKESILLEEEYRD
EIRYYMHDMERFTMSSTQSMDQQPEIRWHMRPCLVDFLVEVHFTFRLRPETLYLTLNIVDRYVSRRIVYIKHYQL
VGCAALWIAAKFEDAKERVPTVQDLAQICRETYEESAFIQMEGHVLSTIQWTLGHPTAEAWLRLMCCGPYAEEAK
VQHVARFLMEITLFYREFIKYPPSTIALSSLTLARYLCGKSRRLWEETDECLEVIEYLDARLSKHVNDLSETLVK
KYSYAFYSKAATFVVQYYLQGGRFSPQTLPSLPVTPKRATASAATTPMSSSTSLSDVSDDMPLTPSTPTFSGDPF
SSSCPTDDKENQPSRFEPVLNKHRVETVPEQFLPHDFVTFGRSALNNLNISSPRTTLVS*
Coding >Agabi119p4|008070
ATGTACGTGACAAATTTCCATATGCACTGGCGGTTTGCTGACATGCACCAGTGTCGAAGCCTAGTGGTGTATATC
AAAGACAACAGCCGCCACCCGCTCAACTCTGACCCCTTTGAACCCGCGGTCTCTCTTTTTGTTGCACTTTCCACA
GACTGCTTCATCTCCAGCCCATCCTCGCCAACTTCGTCCCCCTCAGATATTACTGGTCTCGACATGAAGGACACT
TCCGTCTCAGCCACACGCCAATCTCGCAACTCCCTCGTCTACCCCAAGAAACGTCCTTCCCCCCATGGTATCCAC
AAGGCATCCAAATCACCCTCTCTTCTCGCTTCATATGCCTGTCGCTCTCCCCGTTCCGCAAAACTTGCCCTTTTA
CAGCAGCAGCAGCGCCTTCGTGAAGCCCAATTCTGTAGGAAAGAAAGCATTCTCCTCGAAGAGGAGTATCGCGAT
GAAATCCGTTACTATATGCACGATATGGAGCGTTTCACCATGTCTTCGACCCAATCGATGGATCAGCAGCCTGAG
ATCCGGTGGCACATGCGCCCCTGCCTCGTAGATTTTCTTGTTGAAGTTCACTTTACGTTCCGCCTTCGGCCAGAG
ACTCTCTACCTCACTCTCAACATCGTGGATCGCTATGTCTCCCGTCGTATCGTTTACATCAAACACTACCAACTT
GTTGGCTGTGCTGCCCTTTGGATTGCCGCAAAATTTGAGGATGCAAAAGAGCGTGTCCCAACTGTTCAAGACCTT
GCTCAGATCTGCCGCGAGACCTACGAAGAATCCGCTTTTATACAGATGGAAGGTCACGTCCTCTCCACAATTCAG
TGGACTCTCGGTCATCCAACCGCTGAAGCTTGGCTGCGGCTCATGTGCTGTGGTCCGTACGCGGAAGAGGCCAAA
GTTCAACACGTTGCGCGTTTCTTGATGGAGATCACCCTTTTCTATCGTGAATTTATCAAGTATCCTCCTTCTACA
ATCGCGTTGTCTTCTTTGACACTTGCTCGTTATCTCTGTGGCAAGTCACGTCGTCTTTGGGAAGAAACGGATGAA
TGTCTAGAAGTCATCGAATACCTTGATGCCCGATTGTCCAAACATGTGAATGATCTGTCGGAAACGCTCGTTAAA
AAGTATTCCTATGCCTTTTACTCCAAAGCGGCCACGTTTGTGGTACAATACTATCTGCAAGGCGGCCGGTTCAGT
CCTCAAACACTTCCTTCATTGCCAGTTACTCCGAAGCGTGCGACTGCGTCAGCGGCAACAACACCTATGAGCTCG
TCAACGTCGTTGTCCGATGTGTCAGATGATATGCCCCTCACCCCGTCTACGCCGACATTCTCTGGTGATCCATTC
TCGAGCTCGTGTCCTACCGACGACAAGGAAAATCAGCCTTCACGTTTTGAGCCTGTGCTAAATAAGCATCGTGTA
GAAACTGTTCCAGAGCAATTCCTTCCACACGACTTTGTCACCTTTGGTCGATCCGCTCTTAACAATCTGAACATT
TCATCACCACGCACCACCCTTGTCTCATAA
Transcript >Agabi119p4|008070
ATGTACGTGACAAATTTCCATATGCACTGGCGGTTTGCTGACATGCACCAGTGTCGAAGCCTAGTGGTGTATATC
AAAGACAACAGCCGCCACCCGCTCAACTCTGACCCCTTTGAACCCGCGGTCTCTCTTTTTGTTGCACTTTCCACA
GACTGCTTCATCTCCAGCCCATCCTCGCCAACTTCGTCCCCCTCAGATATTACTGGTCTCGACATGAAGGACACT
TCCGTCTCAGCCACACGCCAATCTCGCAACTCCCTCGTCTACCCCAAGAAACGTCCTTCCCCCCATGGTATCCAC
AAGGCATCCAAATCACCCTCTCTTCTCGCTTCATATGCCTGTCGCTCTCCCCGTTCCGCAAAACTTGCCCTTTTA
CAGCAGCAGCAGCGCCTTCGTGAAGCCCAATTCTGTAGGAAAGAAAGCATTCTCCTCGAAGAGGAGTATCGCGAT
GAAATCCGTTACTATATGCACGATATGGAGCGTTTCACCATGTCTTCGACCCAATCGATGGATCAGCAGCCTGAG
ATCCGGTGGCACATGCGCCCCTGCCTCGTAGATTTTCTTGTTGAAGTTCACTTTACGTTCCGCCTTCGGCCAGAG
ACTCTCTACCTCACTCTCAACATCGTGGATCGCTATGTCTCCCGTCGTATCGTTTACATCAAACACTACCAACTT
GTTGGCTGTGCTGCCCTTTGGATTGCCGCAAAATTTGAGGATGCAAAAGAGCGTGTCCCAACTGTTCAAGACCTT
GCTCAGATCTGCCGCGAGACCTACGAAGAATCCGCTTTTATACAGATGGAAGGTCACGTCCTCTCCACAATTCAG
TGGACTCTCGGTCATCCAACCGCTGAAGCTTGGCTGCGGCTCATGTGCTGTGGTCCGTACGCGGAAGAGGCCAAA
GTTCAACACGTTGCGCGTTTCTTGATGGAGATCACCCTTTTCTATCGTGAATTTATCAAGTATCCTCCTTCTACA
ATCGCGTTGTCTTCTTTGACACTTGCTCGTTATCTCTGTGGCAAGTCACGTCGTCTTTGGGAAGAAACGGATGAA
TGTCTAGAAGTCATCGAATACCTTGATGCCCGATTGTCCAAACATGTGAATGATCTGTCGGAAACGCTCGTTAAA
AAGTATTCCTATGCCTTTTACTCCAAAGCGGCCACGTTTGTGGTACAATACTATCTGCAAGGCGGCCGGTTCAGT
CCTCAAACACTTCCTTCATTGCCAGTTACTCCGAAGCGTGCGACTGCGTCAGCGGCAACAACACCTATGAGCTCG
TCAACGTCGTTGTCCGATGTGTCAGATGATATGCCCCTCACCCCGTCTACGCCGACATTCTCTGGTGATCCATTC
TCGAGCTCGTGTCCTACCGACGACAAGGAAAATCAGCCTTCACGTTTTGAGCCTGTGCTAAATAAGCATCGTGTA
GAAACTGTTCCAGAGCAATTCCTTCCACACGACTTTGTCACCTTTGGTCGATCCGCTCTTAACAATCTGAACATT
TCATCACCACGCACCACCCTTGTCTCATAA
Gene >Agabi119p4|008070
ATGTACGTGACAAATTTCCATATGCACTGGCGGTTTGCTGACATGGTACACATACAGCCTCGAGCAACAGCGTTT
TCAAGACATTTTTTCTTACGTCTTGCCAGCACCAGTGTCGGTAAGTGGCCCACGCGTCGAGCCAGAAGCGTTTAT
ATTGAATGAGAGCAGAAGCCTAGTGGTGTATATCAAAGGTAAGCCAATTGTCATTAAGGCTTTATGGACGACGGG
AGATCTACGTCACTGCATCGAGCTCAACGGAAAACGTGGGGTCGTGGGAATTAGTATTGAAAGGGAGATCGCGCC
CGATATAGCAGTATGCCAATTGCGTGGTAGATATACCCTTGCCGCAGTTATCGGCCCATGGTGTTGCCTAAAAGA
ATTGCAGCTGTGGGCATGGATCAGCTGGGCGGGTGGGGATAGTCGAGGTCGTTGGATGATATGCGGATGGACAGG
GCGACTAGATGCATGTGACTGGAGTCCTGATTGGGCCATTGGGAGTTGATACGAACGCCATCAGAGGACATCAGT
CTACGGTTGGTTGGCATTTGCCAACGCCTTCTTTGGTTTCCCTTTTCTCTGCCCTCCCCTTGGGCCCCAGCCTCG
TCCTGGGCGCACACTCTGCTTCCCTCTCTCACACGACTCACGCTTACGACCCTCTCTCCCCCCTCTAGACAACAG
CCGCCACCCGCTCAACTCTGACCCCTTTGAACCCGCGGTCTCTCTTTTTGTTGCACTTTCCACAGACTGCTTCAT
CTCCAGCCCGTGAGTAATCTGAATCCTCCATTGCCCGCTTGCGTTATTGTGTTATTTTTGGGTTACCTACCCGAT
CGAATGCCCTGTTTTGTTACTTGCTCTGTTTGTCTTCGCGAGGCCTGTCTGTGTCCTGTGTCCTGTTCTCCTTCC
TCCCTCGCGCTCCCGCGCCGTTTCCCGAAGGGCGTTTCCCTCCCGTCTTCTACCGATATCCGCATCTGATGGCGC
CCCTTGATCATGTCAACCTCGGCGGTCCTGACCTTTTTTCTTCCTCTAGATCCTCGCCAACTTCGTCCCCCTCAG
ATATTACTGGTCTCGACATGAAGGACACTTCCGTCTCAGCCACACGCCAATCTCGCAACTCCCTCGTCTACCCCA
AGAAACGTCCTTCCCCCCATGGTATCCACAAGGCATCCAAATCACCCTCTCTTCTCGCTTCATATGCCTGTCGCT
CTCCCCGTTCCGCAAAACTTGCCCTTTTACAGCAGCAGCAGCGCCTTCGTGAAGCCCAATTCTGTAGGAAAGAAA
GCATTCTCCTCGAAGAGGAGTATCGCGATGAAATCCGTTACTATATGCACGATATGGAGGTCAGTTAATCCCTTT
GATCGTATTTTCTATGCGAAAAATCCATGCTCAGTCTTCCTTCAATACGTCTTTAGCGTTTCACCATGTCTTCGA
CCCAATCGATGGATCAGCAGCCTGAGATCCGGTGGCACATGCGCCCCTGCCTCGTAGATTTTCTTGTTGAAGTTC
ACTTTACGTTCCGCCTTCGGCCAGAGACTCTCTACCTCACTCTCAACATCGTGGATCGCTATGTCTCCCGTCGTA
TCGTTTACATCAAACACTACCAACTTGTTGGCTGTGCTGCCCTTTGGATTGCCGCAAAATTTGAGGATGCAAAAG
AGCGTGTCCCAACTGTTCAAGACCTTGCTCAGATCTGCCGCGAGACCTACGAAGAATCCGCTTTTATACAGATGG
AAGGTCACGTCCTCTCCACAATTCAGTGGACTCTCGGTCATCCAACCGCTGAAGCTTGGCTGCGGCTCATGTGCT
GTGGTCCGTACGCGGAAGAGGCCAAAGTTCAACACGTTGCGCGTTTCTTGATGGAGATCACCCTTTTCTATCGTG
AATTTATCAAGTATCCTCCTTCTACAATCGCGTTGTCTTCTTTGACACTTGCTCGTTATCTCTGTGGCAAGTCAC
GTCGTCTTTGGGAAGAAACGGATGAATGTCTAGAAGTCATCGAATACCTTGATGCCCGATTGTCCAAACATGTGA
ATGATCTGTCGGAAACGCTCGTTAAAAAGTATTCCTATGCCTTTTACTCCAAAGCGGCCACGTTTGTGGTACAAT
ACTATCTGCAAGGCGGCCGGTTCAGTCCTCAAACACTTCCTTCATTGCCAGTTACTCCGAAGCGTGCGACTGCGT
CAGCGGCAACAACACCTATGAGCTCGTCAACGTCGTTGTCCGATGTGTCAGATGATATGCCCCTCACCCCGTCTA
CGCCGACATTCTCTGGTGATCCATTCTCGAGCTCGTGTCCTACCGACGACAAGGAAAATCAGCCTTCACGTTTTG
AGCCTGTGCTAAATAAGCATCGTGTAGAAACTGTTCCAGAGCAATTCCTTCCACACGACTTTGTCACCTTTGGTC
GATCCGCTCTTAACAATCTGAACATTTCATCACCACGCACCACCCTTGTCTCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail