Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|007880
Gene name
Locationscaffold_01a:1850325..1853310
Strand+
Gene length (bp)2985
Transcript length (bp)2724
Coding sequence length (bp)2724
Protein length (aa) 908

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01388 ARID ARID/BRIGHT DNA binding domain 1.2E-15 146 266

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74365|SOL1_SCHPO SWI/SNF chromatin-remodeling complex subunit sol1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sol1 PE=1 SV=1 137 611 4.0E-11

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
ARID/BRIGHT

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID5
Orthogroup1493
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|007880
Agaricus bisporus var bisporus H97 AgabiH97|007880
Agaricus bisporus var burnettii H119p4 Agabi119p4|007880 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|007880
MLPQNVQQLRSQAQHQPQQSNMNPTGMSAGTMDHPSFFNNLDPSQAKQMAALTAANNARMATNSRPPSSMPVGNG
ASSGPYLGGITPAGYSSTKNDLLPAANGHANFQLPNNHGVSQTPNSAVNASFLDPPMSQPSAQAASFKQRQHQFL
NGLANVMARRNTPLPPSLTGIPSPNYDPNTSPWSYIEPSNEVGSFRLAGQDVSLFKLWGLVMQHGGAQALKHNNG
WFTIASEFNLPEEFPQVQANGSASVVLMLEQMYTGILFPFEDIYKKNLQEQQRKAQLASRQIPMGQPGQIRTMPA
NGPQQGPNQMQRGPVGTMAHTPQAPHQRAGLNAQVPQHNISLSQSTSQAGMASGSEPNLLDSDIQGIKRKLDIED
PEGKRARQKTDPLEASTGGDGSAFFNQTPGLKRTRQPLRRKIEYVPWARELDTHGGRNLRLIEHEWNTISQRRPL
RDINDWGVVDIEGLRMSIRSKLPTELSYALTTVTILSTMRSQNPGSGFPIFQCPDLFDDMLDLLEEEAFGEIQDD
ISEDAMEVSPIVTQRDLLNAIYDEGLKPFAALEAHQGSKKLTSGFTPRPADTVLAIVNILRNLSVVSDNWQFLSH
HDKMLDLLLRLCMVRRVDGSLIPVSPNLSLSDLVTIRKDTLYTLVNLVGLINFGPAYSLSQPMTRVSKRVFELVA
SYLVDPSEAVSPFSSIQVAGQPLNAHPKPSALTDASLEVFTRFSLSDANRQALAQTIPKPYIWELFEALVHRLPI
NDVDFQLFGRETWLSYLEKMVMSLYSLSFLAPPSLKQRLKSDRKLGFKTVMFRLVQKLLTNPNPDFRMLFFLCSR
RAIEAMKVLDDEGDLFDTTETTTATLSFGMGFADSSESVMESGSGMLVGQRDATWDIMMTREVWSDETMFKELES
LARVECH*
Coding >Agabi119p4|007880
ATGCTCCCACAGAATGTGCAACAGCTGCGCTCTCAAGCTCAGCATCAGCCTCAGCAATCCAACATGAATCCCACT
GGCATGTCGGCAGGAACAATGGATCATCCGTCTTTCTTCAACAACCTCGATCCTTCCCAAGCGAAGCAAATGGCC
GCTCTTACCGCCGCTAACAACGCTCGAATGGCTACGAACAGCCGCCCACCGTCTTCCATGCCTGTGGGTAACGGA
GCAAGTTCGGGGCCATATCTCGGGGGAATTACACCCGCAGGTTACTCAAGTACAAAAAACGATCTTTTACCTGCT
GCGAATGGACATGCGAATTTTCAATTACCGAATAATCATGGCGTTTCACAAACGCCAAACTCGGCTGTCAACGCA
TCTTTCCTCGATCCTCCCATGTCACAGCCTTCCGCCCAAGCTGCATCCTTCAAACAGCGCCAGCACCAGTTCCTC
AATGGCCTCGCCAATGTCATGGCGAGGCGGAACACTCCTCTTCCCCCATCATTAACTGGCATCCCCTCCCCCAAT
TATGACCCGAACACCTCACCATGGTCTTACATCGAACCTTCGAATGAGGTGGGGTCTTTTCGTCTTGCAGGGCAG
GATGTCAGTCTTTTCAAACTCTGGGGTCTTGTCATGCAGCATGGAGGTGCCCAAGCGCTCAAGCACAACAATGGA
TGGTTTACTATAGCTAGCGAATTTAACCTACCGGAAGAGTTCCCTCAAGTGCAAGCTAATGGTTCGGCGTCTGTT
GTACTTATGTTGGAGCAGATGTACACTGGCATTCTATTTCCGTTTGAGGATATCTACAAGAAAAATTTACAGGAG
CAGCAGCGAAAAGCTCAGTTGGCGTCAAGACAAATTCCCATGGGACAGCCAGGGCAGATACGTACAATGCCAGCA
AATGGACCGCAACAAGGTCCCAACCAAATGCAGCGCGGTCCCGTTGGCACGATGGCTCACACTCCCCAAGCACCC
CATCAAAGAGCGGGTCTCAATGCTCAAGTCCCGCAGCACAATATCTCACTATCCCAGTCGACTTCGCAAGCTGGA
ATGGCTTCTGGATCCGAACCTAATCTTCTGGATAGTGATATTCAAGGCATCAAACGAAAGCTCGATATAGAAGAT
CCAGAAGGCAAACGTGCTAGGCAGAAAACAGACCCTTTAGAAGCTTCAACCGGTGGAGATGGATCCGCTTTTTTC
AATCAAACTCCGGGACTAAAGAGAACGCGCCAACCTCTGCGGCGCAAGATAGAATATGTACCCTGGGCACGCGAA
CTGGATACACATGGTGGCCGAAATCTACGACTGATAGAGCATGAATGGAACACCATCTCCCAGCGACGGCCCCTC
CGCGACATCAATGACTGGGGCGTCGTTGATATTGAAGGTCTTCGGATGTCTATTCGTTCGAAACTTCCAACCGAA
CTGTCATATGCTTTGACAACCGTCACTATCCTTTCCACAATGCGCAGTCAAAACCCGGGCTCTGGTTTTCCTATC
TTTCAATGTCCCGACCTCTTTGATGATATGCTTGACCTCTTGGAAGAGGAAGCGTTTGGAGAAATACAAGATGAT
ATTTCAGAGGATGCAATGGAGGTGTCTCCCATCGTTACGCAGCGCGATCTTCTCAACGCCATTTACGATGAAGGA
CTTAAACCCTTTGCTGCCCTAGAGGCTCACCAAGGGAGCAAGAAATTGACTTCGGGTTTTACTCCACGGCCAGCG
GATACTGTTCTTGCTATTGTCAATATTTTGCGGAATCTGTCAGTTGTTTCTGACAACTGGCAATTCTTATCGCAC
CATGATAAGATGCTCGATCTTCTGCTGCGGCTTTGTATGGTCCGTCGAGTAGACGGTTCACTTATCCCAGTATCG
CCAAACCTGTCCTTGTCAGATTTGGTTACAATTCGGAAAGATACCCTTTACACTCTCGTCAACCTTGTAGGTTTA
ATCAACTTCGGGCCTGCGTATTCACTGTCACAGCCGATGACTCGGGTTTCGAAACGTGTATTCGAGCTCGTGGCG
TCATATCTTGTCGACCCCTCCGAGGCTGTGTCTCCATTTTCATCGATCCAAGTCGCAGGACAACCATTAAATGCG
CATCCGAAGCCGTCAGCACTCACTGATGCTTCTCTAGAAGTTTTCACTCGCTTCAGCCTCTCAGATGCGAATCGA
CAAGCATTAGCCCAGACGATACCAAAACCATACATATGGGAGCTGTTCGAAGCGCTAGTCCACCGACTACCCATT
AACGACGTAGATTTCCAGCTGTTCGGGCGCGAAACGTGGCTGAGCTATTTGGAAAAAATGGTCATGTCATTATAC
TCCCTCTCGTTTCTGGCCCCACCGTCACTCAAGCAACGCCTGAAATCTGACCGTAAACTTGGATTCAAGACTGTC
ATGTTCCGGCTTGTCCAGAAGCTTTTGACCAATCCTAACCCTGATTTCCGAATGCTTTTCTTCCTTTGCTCCCGT
AGAGCGATCGAAGCGATGAAGGTCCTTGACGATGAGGGGGATCTTTTTGATACCACTGAAACGACAACGGCCACC
CTATCCTTCGGTATGGGTTTTGCAGACTCGAGTGAAAGCGTTATGGAAAGTGGGTCCGGAATGCTAGTGGGTCAG
CGGGATGCTACTTGGGACATCATGATGACCAGGGAAGTGTGGAGTGATGAAACCATGTTCAAAGAGCTGGAAAGC
CTTGCGAGGGTGGAGTGTCATTGA
Transcript >Agabi119p4|007880
ATGCTCCCACAGAATGTGCAACAGCTGCGCTCTCAAGCTCAGCATCAGCCTCAGCAATCCAACATGAATCCCACT
GGCATGTCGGCAGGAACAATGGATCATCCGTCTTTCTTCAACAACCTCGATCCTTCCCAAGCGAAGCAAATGGCC
GCTCTTACCGCCGCTAACAACGCTCGAATGGCTACGAACAGCCGCCCACCGTCTTCCATGCCTGTGGGTAACGGA
GCAAGTTCGGGGCCATATCTCGGGGGAATTACACCCGCAGGTTACTCAAGTACAAAAAACGATCTTTTACCTGCT
GCGAATGGACATGCGAATTTTCAATTACCGAATAATCATGGCGTTTCACAAACGCCAAACTCGGCTGTCAACGCA
TCTTTCCTCGATCCTCCCATGTCACAGCCTTCCGCCCAAGCTGCATCCTTCAAACAGCGCCAGCACCAGTTCCTC
AATGGCCTCGCCAATGTCATGGCGAGGCGGAACACTCCTCTTCCCCCATCATTAACTGGCATCCCCTCCCCCAAT
TATGACCCGAACACCTCACCATGGTCTTACATCGAACCTTCGAATGAGGTGGGGTCTTTTCGTCTTGCAGGGCAG
GATGTCAGTCTTTTCAAACTCTGGGGTCTTGTCATGCAGCATGGAGGTGCCCAAGCGCTCAAGCACAACAATGGA
TGGTTTACTATAGCTAGCGAATTTAACCTACCGGAAGAGTTCCCTCAAGTGCAAGCTAATGGTTCGGCGTCTGTT
GTACTTATGTTGGAGCAGATGTACACTGGCATTCTATTTCCGTTTGAGGATATCTACAAGAAAAATTTACAGGAG
CAGCAGCGAAAAGCTCAGTTGGCGTCAAGACAAATTCCCATGGGACAGCCAGGGCAGATACGTACAATGCCAGCA
AATGGACCGCAACAAGGTCCCAACCAAATGCAGCGCGGTCCCGTTGGCACGATGGCTCACACTCCCCAAGCACCC
CATCAAAGAGCGGGTCTCAATGCTCAAGTCCCGCAGCACAATATCTCACTATCCCAGTCGACTTCGCAAGCTGGA
ATGGCTTCTGGATCCGAACCTAATCTTCTGGATAGTGATATTCAAGGCATCAAACGAAAGCTCGATATAGAAGAT
CCAGAAGGCAAACGTGCTAGGCAGAAAACAGACCCTTTAGAAGCTTCAACCGGTGGAGATGGATCCGCTTTTTTC
AATCAAACTCCGGGACTAAAGAGAACGCGCCAACCTCTGCGGCGCAAGATAGAATATGTACCCTGGGCACGCGAA
CTGGATACACATGGTGGCCGAAATCTACGACTGATAGAGCATGAATGGAACACCATCTCCCAGCGACGGCCCCTC
CGCGACATCAATGACTGGGGCGTCGTTGATATTGAAGGTCTTCGGATGTCTATTCGTTCGAAACTTCCAACCGAA
CTGTCATATGCTTTGACAACCGTCACTATCCTTTCCACAATGCGCAGTCAAAACCCGGGCTCTGGTTTTCCTATC
TTTCAATGTCCCGACCTCTTTGATGATATGCTTGACCTCTTGGAAGAGGAAGCGTTTGGAGAAATACAAGATGAT
ATTTCAGAGGATGCAATGGAGGTGTCTCCCATCGTTACGCAGCGCGATCTTCTCAACGCCATTTACGATGAAGGA
CTTAAACCCTTTGCTGCCCTAGAGGCTCACCAAGGGAGCAAGAAATTGACTTCGGGTTTTACTCCACGGCCAGCG
GATACTGTTCTTGCTATTGTCAATATTTTGCGGAATCTGTCAGTTGTTTCTGACAACTGGCAATTCTTATCGCAC
CATGATAAGATGCTCGATCTTCTGCTGCGGCTTTGTATGGTCCGTCGAGTAGACGGTTCACTTATCCCAGTATCG
CCAAACCTGTCCTTGTCAGATTTGGTTACAATTCGGAAAGATACCCTTTACACTCTCGTCAACCTTGTAGGTTTA
ATCAACTTCGGGCCTGCGTATTCACTGTCACAGCCGATGACTCGGGTTTCGAAACGTGTATTCGAGCTCGTGGCG
TCATATCTTGTCGACCCCTCCGAGGCTGTGTCTCCATTTTCATCGATCCAAGTCGCAGGACAACCATTAAATGCG
CATCCGAAGCCGTCAGCACTCACTGATGCTTCTCTAGAAGTTTTCACTCGCTTCAGCCTCTCAGATGCGAATCGA
CAAGCATTAGCCCAGACGATACCAAAACCATACATATGGGAGCTGTTCGAAGCGCTAGTCCACCGACTACCCATT
AACGACGTAGATTTCCAGCTGTTCGGGCGCGAAACGTGGCTGAGCTATTTGGAAAAAATGGTCATGTCATTATAC
TCCCTCTCGTTTCTGGCCCCACCGTCACTCAAGCAACGCCTGAAATCTGACCGTAAACTTGGATTCAAGACTGTC
ATGTTCCGGCTTGTCCAGAAGCTTTTGACCAATCCTAACCCTGATTTCCGAATGCTTTTCTTCCTTTGCTCCCGT
AGAGCGATCGAAGCGATGAAGGTCCTTGACGATGAGGGGGATCTTTTTGATACCACTGAAACGACAACGGCCACC
CTATCCTTCGGTATGGGTTTTGCAGACTCGAGTGAAAGCGTTATGGAAAGTGGGTCCGGAATGCTAGTGGGTCAG
CGGGATGCTACTTGGGACATCATGATGACCAGGGAAGTGTGGAGTGATGAAACCATGTTCAAAGAGCTGGAAAGC
CTTGCGAGGGTGGAGTGTCATTGA
Gene >Agabi119p4|007880
ATGCTGTAGGTCTCTGCTACTTTATCCTCTATATTATTGTCTCATTCTCGGTGATTCAGCCCACAGAATGTGCAA
CAGCTGCGCTCTCAAGCTCAGCATCAGCCTCAGCAATCCAACATGAATCCCACTGGCATGTCGGCAGGAACAATG
GATCATCCGTCTTTCTTCAACAACCTCGATCCTTCCCAAGCGAAGCAAATGGCCGCTCTTACCGCCGCTAACAAC
GCTCGAATGGCTACGAACAGCCGCCCACCGTCTTCCATGCCTGTGGGTAACGGAGCAAGTTCGGGGCCATATCTC
GGGGGAATTACACCCGCAGGTTACTCAAGTACAAAAAACGATCTTTTACCTGCTGCGAATGGACATGCGAATTTT
CAATTACCGAATAATCATGGCGTTTCACAAACGCCAAACTCGGCTGTCAACGCATCTTTCCTCGATCCTCCCATG
TCACAGCCTTCCGCCCAAGCTGCATCCTTCAAACAGCGCCAGCACCAGTTCCTCAATGGCCTCGCCAATGTCATG
GCGAGGCGGAACACTCCTCTTCCCCCATCATTAACTGGCATCCCCTCCCCCAATTATGACCCGAACACCTCACCA
TGGTCTTACATCGAACCTTCGAATGAGGTGGGGTCTTTTCGTCTTGCAGGGCAGGATGTCAGTCTTTTCAAACTC
TGGGGTCTTGTCATGCAGCATGGAGGTGCCCAAGCGGTAAGTTACGTGGTGACTTGTTTGCATCGTTAATTCTTA
TCAATCGCCTCTCAGCTCAAGCACAACAATGGATGGTTTACTATAGCTAGCGAATTTAACCTACCGGAAGAGTTC
CCTCAAGTGCAAGCTAATGGTTCGGCGTCTGTTGTACTTATGTTGGAGCAGATGTACACTGGCATTCTATTTCCG
TTTGAGGATATCTACAAGAAAAATTTACAGGAGCAGCAGCGAAAAGCTCAGTTGGCGTCAAGACAAATTCCCATG
GGACAGCCAGGGCAGATACGTACAATGCCAGCAAATGGACCGCAACAAGGTCCCAACCAAATGCAGCGCGGTCCC
GTTGGCACGATGGGTATGATAATCAACTAGTTCGAATTGTGCGCGAAGCTCATTATTCCGCAGCTCACACTCCCC
AAGCACCCCATCAAAGAGCGGGTCTCAATGCTCAAGTCCCGCAGCACAATATCTCACTATCCCAGTCGACTTCGC
AAGCTGGAATGGCTTCTGGATCCGAACCTAATCTTCTGGATAGTGATATTCAAGGCATCAAACGAAAGCTCGATA
TAGAAGATCCAGAAGGCAAACGTGCTAGGCAGAAAACAGGCATGTGCTTCCTGATTTCATGATTTGATTCAAGTG
ACTCAATTCTATGGATTAGACCCTTTAGAAGCTTCAGTAAGTCATCCCCTTTCCATGGAACATTACCCCTCATCT
GGGCTGCAGACCGGTGGAGATGGATCCGCTTTTTTCAATCAAACTCCGGGACTAAAGAGAACGCGCCAACCTCTG
CGGCGCAAGATAGAATATGTACCCTGGGCACGCGAACTGGATACACATGGTGGCCGAAATCTACGACTGATAGAG
CATGAATGGAACACCATCTCCCAGCGACGGCCCCTCCGCGACATCAATGACTGGGGCGTCGTTGATATTGAAGGT
CTTCGGATGTCTATTCGTTCGAAACTTCCAACCGAACTGTCATATGCTTTGACAACCGTCACTATCCTTTCCACA
ATGCGCAGTCAAAACCCGGGCTCTGGTTTTCCTATCTTTCAATGTCCCGACCTCTTTGATGATATGCTTGACCTC
TTGGAAGAGGAAGCGTTTGGAGAAATACAAGATGATATTTCAGAGGATGCAATGGAGGTGTCTCCCATCGTTACG
CAGCGCGATCTTCTCAACGCCATTTACGATGAAGGACTTAAACCCTTTGCTGCCCTAGAGGCTCACCAAGGGAGC
AAGAAATTGACTTCGGGTTTTACTCCACGGCCAGCGGATACTGTTCTTGCTATTGTCAATATTTTGCGGAATCTG
TCAGTTGTTTCTGACAACTGGCAATTCTTATCGCACCATGATAAGATGCTCGATCTTCTGCTGCGGCTTTGTATG
GTCCGTCGAGTAGACGGTTCACTTATCCCAGTATCGCCAAACCTGTCCTTGTCAGATTTGGTTACAATTCGGAAA
GATACCCTTTACACTCTCGTCAACCTTGTAGGTTTAATCAACTTCGGGCCTGCGTATTCACTGTCACAGCCGATG
ACTCGGGTTTCGAAACGTGTATTCGAGCTCGTGGCGTCATATCTTGTCGACCCCTCCGAGGCTGTGTCTCCATTT
TCATCGATCCAAGTCGCAGGACAACCATTAAATGCGCATCCGAAGCCGTCAGCACTCACTGATGCTTCTCTAGAA
GTTTTCACTCGCTTCAGCCTCTCAGATGCGAATCGACAAGCATTAGCCCAGACGATACCAAAACCATACATATGG
GAGCTGTTCGAAGCGCTAGTCCACCGACTACCCATTAACGACGTAGATTTCCAGCTGTTCGGGCGCGAAACGTGG
CTGAGCTATTTGGAAAAAATGGTCATGTCATTATACTCCCTCTCGTTTCTGGCCCCACCGTCACTCAAGCAACGC
CTGAAATCTGACCGTAAACTTGGATTCAAGACTGTCATGTTCCGGCTTGTCCAGAAGCTTTTGACCAATCCTAAC
CCTGATTTCCGAATGCTTTTCTTCCTTTGCTCCCGTAGAGCGATCGAAGCGATGAAGGTCCTTGACGATGAGGGG
GATCTTTTTGATACCACTGAAACGACAACGGCCACCCTATCCTTCGGTATGGGTTTTGCAGACTCGAGTGAAAGC
GTTATGGAAAGTGGGTCCGGAATGCTAGTGGGTCAGCGGGATGCTACTTGGGACATCATGATGACCAGGGAAGTG
TGGAGTGATGAAACCATGTTCAAAGAGCTGGAAAGCCTTGCGAGGGTGGAGTGTCATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail