© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Agabi119p4|007660 |
| Gene name | |
| Location | scaffold_01a:1800744..1802221 |
| Strand | - |
| Gene length (bp) | 1477 |
| Transcript length (bp) | 1170 |
| Coding sequence length (bp) | 1170 |
| Protein length (aa) | 390 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF16881 | LIAS_N | N-terminal domain of lipoyl synthase of Radical_SAM family | 2.4E-24 | 17 | 100 |
| PF04055 | Radical_SAM | Radical SAM superfamily | 2.1E-13 | 131 | 290 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|A8N1T1|LIPA_COPC7 | Lipoyl synthase, mitochondrial OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_03624 PE=3 SV=1 | 31 | 382 | 0.0E+00 |
| sp|B0CQH8|LIPA_LACBS | Lipoyl synthase, mitochondrial OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_181332 PE=3 SV=1 | 1 | 362 | 0.0E+00 |
| sp|P0CO58|LIPA_CRYNJ | Lipoyl synthase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNL04340 PE=3 SV=1 | 11 | 362 | 1.0E-167 |
| sp|P0CO59|LIPA_CRYNB | Lipoyl synthase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBI2500 PE=3 SV=1 | 11 | 362 | 1.0E-167 |
| sp|Q7SF84|LIPA_NEUCR | Lipoyl synthase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU00565 PE=3 SV=1 | 29 | 387 | 7.0E-166 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|A8N1T1|LIPA_COPC7 | Lipoyl synthase, mitochondrial OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_03624 PE=3 SV=1 | 31 | 382 | 0.0E+00 |
| sp|B0CQH8|LIPA_LACBS | Lipoyl synthase, mitochondrial OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_181332 PE=3 SV=1 | 1 | 362 | 0.0E+00 |
| sp|P0CO58|LIPA_CRYNJ | Lipoyl synthase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNL04340 PE=3 SV=1 | 11 | 362 | 1.0E-167 |
| sp|P0CO59|LIPA_CRYNB | Lipoyl synthase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBI2500 PE=3 SV=1 | 11 | 362 | 1.0E-167 |
| sp|Q7SF84|LIPA_NEUCR | Lipoyl synthase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU00565 PE=3 SV=1 | 29 | 387 | 7.0E-166 |
| sp|Q5AQE4|LIPA_EMENI | Lipoyl synthase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN9486 PE=3 SV=1 | 30 | 362 | 1.0E-164 |
| sp|D1Z4I6|LIPA_SORMK | Lipoyl synthase, mitochondrial OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_01256 PE=3 SV=1 | 29 | 382 | 2.0E-164 |
| sp|B2AT43|LIPA_PODAN | Lipoyl synthase, mitochondrial OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_1_14620 PE=3 SV=1 | 64 | 366 | 6.0E-164 |
| sp|A1CJC4|LIPA_ASPCL | Lipoyl synthase, mitochondrial OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_034510 PE=3 SV=1 | 30 | 362 | 2.0E-161 |
| sp|B8NUL8|LIPA_ASPFN | Lipoyl synthase, mitochondrial OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_100710 PE=3 SV=1 | 20 | 368 | 7.0E-161 |
| sp|Q2U4H2|LIPA_ASPOR | Lipoyl synthase, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090020000344 PE=3 SV=1 | 20 | 368 | 8.0E-161 |
| sp|B6HFQ1|LIPA_PENRW | Lipoyl synthase, mitochondrial OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=Pc20g03200 PE=3 SV=1 | 20 | 362 | 4.0E-160 |
| sp|C5FZJ2|LIPA_ARTOC | Lipoyl synthase, mitochondrial OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_08114 PE=3 SV=1 | 4 | 366 | 6.0E-160 |
| sp|A1D855|LIPA_NEOFI | Lipoyl synthase, mitochondrial OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_070700 PE=3 SV=1 | 33 | 362 | 8.0E-160 |
| sp|C5JVC1|LIPA_AJEDS | Lipoyl synthase, mitochondrial OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_06713 PE=3 SV=1 | 29 | 384 | 2.0E-159 |
| sp|C5GPL2|LIPA_AJEDR | Lipoyl synthase, mitochondrial OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=BDCG_05907 PE=3 SV=1 | 29 | 384 | 2.0E-159 |
| sp|B6K4J2|LIPA_SCHJY | Lipoyl synthase, mitochondrial OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=SJAG_03553 PE=3 SV=1 | 31 | 360 | 3.0E-159 |
| sp|A3GGJ5|LIPA_PICST | Lipoyl synthase, mitochondrial OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PICST_86231 PE=3 SV=2 | 16 | 362 | 4.0E-159 |
| sp|C0NXP6|LIPA_AJECG | Lipoyl synthase, mitochondrial OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_07690 PE=3 SV=1 | 2 | 365 | 5.0E-159 |
| sp|O13642|LIPA_SCHPO | Lipoyl synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lip5 PE=3 SV=2 | 33 | 364 | 6.0E-159 |
| sp|C4JE77|LIPA_UNCRE | Lipoyl synthase, mitochondrial OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_00501 PE=3 SV=1 | 2 | 385 | 7.0E-159 |
| sp|A7EV21|LIPA_SCLS1 | Lipoyl synthase, mitochondrial OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_09179 PE=3 SV=1 | 64 | 364 | 8.0E-159 |
| sp|B6QSZ4|LIPA_TALMQ | Lipoyl synthase, mitochondrial OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=PMAA_003450 PE=3 SV=1 | 16 | 364 | 2.0E-158 |
| sp|Q4WWP1|LIPA_ASPFU | Lipoyl synthase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_3G06560 PE=3 SV=1 | 33 | 362 | 5.0E-158 |
| sp|B0XYY2|LIPA_ASPFC | Lipoyl synthase, mitochondrial OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_042490 PE=3 SV=1 | 33 | 362 | 5.0E-158 |
| sp|B5RUV1|LIPA_DEBHA | Lipoyl synthase, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2G18854g PE=3 SV=1 | 17 | 362 | 6.0E-158 |
| sp|Q6C6C6|LIPA_YARLI | Lipoyl synthase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E10571g PE=3 SV=1 | 17 | 362 | 6.0E-158 |
| sp|C5PIN8|LIPA_COCP7 | Lipoyl synthase, mitochondrial OS=Coccidioides posadasii (strain C735) GN=CPC735_057610 PE=3 SV=1 | 29 | 365 | 7.0E-158 |
| sp|C7Z527|LIPA_NECH7 | Lipoyl synthase, mitochondrial OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_66689 PE=3 SV=1 | 64 | 366 | 2.0E-157 |
| sp|C6HLY2|LIPA_AJECH | Lipoyl synthase, mitochondrial OS=Ajellomyces capsulatus (strain H143) GN=HCDG_07601 PE=3 SV=1 | 2 | 364 | 3.0E-156 |
| sp|C1H594|LIPA_PARBA | Lipoyl synthase, mitochondrial OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=PAAG_05935 PE=3 SV=1 | 28 | 365 | 4.0E-155 |
| sp|P0CH68|LIPA_CANAW | Lipoyl synthase, mitochondrial OS=Candida albicans (strain WO-1) GN=LAB5 PE=3 SV=1 | 17 | 362 | 4.0E-155 |
| sp|P0CH67|LIPA_CANAL | Lipoyl synthase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LAB5 PE=3 SV=1 | 17 | 362 | 4.0E-155 |
| sp|A5DGI1|LIPA_PICGU | Lipoyl synthase, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_02382 PE=3 SV=2 | 17 | 382 | 5.0E-155 |
| sp|B9WFS9|LIPA_CANDC | Lipoyl synthase, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=CD36_42180 PE=3 SV=1 | 17 | 362 | 2.0E-154 |
| sp|C5M276|LIPA_CANTT | Lipoyl synthase, mitochondrial OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=CTRG_00165 PE=3 SV=1 | 16 | 362 | 7.0E-154 |
| sp|C0SDG9|LIPA_PARBP | Lipoyl synthase, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb03) GN=PABG_05724 PE=3 SV=1 | 31 | 362 | 9.0E-153 |
| sp|A5ABM5|LIPA_ASPNC | Lipoyl synthase, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An11g09760 PE=3 SV=1 | 30 | 362 | 1.0E-152 |
| sp|Q74ZH6|LIPA_ASHGO | Lipoyl synthase, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGR231C PE=3 SV=1 | 31 | 362 | 2.0E-152 |
| sp|C4YA37|LIPA_CLAL4 | Lipoyl synthase, mitochondrial OS=Clavispora lusitaniae (strain ATCC 42720) GN=CLUG_04975 PE=3 SV=1 | 17 | 362 | 2.0E-152 |
| sp|Q0V6U4|LIPA_PHANO | Lipoyl synthase, mitochondrial OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_00270 PE=3 SV=2 | 28 | 365 | 9.0E-152 |
| sp|C4QYF2|LIPA_PICPG | Lipoyl synthase, mitochondrial OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr1-4_0425 PE=3 SV=1 | 31 | 386 | 1.0E-151 |
| sp|C1GFM3|LIPA_PARBD | Lipoyl synthase, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb18) GN=PADG_06059 PE=3 SV=1 | 28 | 362 | 2.0E-151 |
| sp|Q6FPY0|LIPA_CANGA | Lipoyl synthase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0I10923g PE=3 SV=1 | 31 | 359 | 9.0E-151 |
| sp|Q6CLS2|LIPA_KLULA | Lipoyl synthase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0F00836g PE=3 SV=1 | 33 | 366 | 2.0E-150 |
| sp|C5DGZ5|LIPA_LACTC | Lipoyl synthase, mitochondrial OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=KLTH0D09548g PE=3 SV=1 | 21 | 363 | 2.0E-149 |
| sp|B8MLU5|LIPA_TALSN | Lipoyl synthase, mitochondrial OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=TSTA_101110 PE=3 SV=1 | 33 | 364 | 3.0E-149 |
| sp|A5E450|LIPA_LODEL | Lipoyl synthase, mitochondrial OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=LELG_04389 PE=3 SV=1 | 30 | 362 | 1.0E-148 |
| sp|C5DY71|LIPA_ZYGRC | Lipoyl synthase, mitochondrial OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=ZYRO0F10758g PE=3 SV=1 | 33 | 374 | 4.0E-148 |
| sp|P32875|LIPA_YEAST | Lipoyl synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LIP5 PE=1 SV=1 | 31 | 362 | 5.0E-148 |
| sp|C8ZGV5|LIPA_YEAS8 | Lipoyl synthase, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=LIP5 PE=3 SV=1 | 31 | 362 | 5.0E-148 |
| sp|A6ZP42|LIPA_YEAS7 | Lipoyl synthase, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=LIP5 PE=3 SV=1 | 31 | 362 | 5.0E-148 |
| sp|B5VS81|LIPA_YEAS6 | Lipoyl synthase, mitochondrial OS=Saccharomyces cerevisiae (strain AWRI1631) GN=LIP5 PE=3 SV=1 | 31 | 362 | 5.0E-148 |
| sp|C7GWI3|LIPA_YEAS2 | Lipoyl synthase, mitochondrial OS=Saccharomyces cerevisiae (strain JAY291) GN=LIP5 PE=3 SV=1 | 31 | 362 | 5.0E-148 |
| sp|B3LJM6|LIPA_YEAS1 | Lipoyl synthase, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=LIP5 PE=3 SV=1 | 31 | 362 | 5.0E-148 |
| sp|B2WBE8|LIPA_PYRTR | Lipoyl synthase, mitochondrial OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_06961 PE=3 SV=1 | 18 | 362 | 1.0E-147 |
| sp|Q16W22|LIAS_AEDAE | Lipoyl synthase, mitochondrial OS=Aedes aegypti GN=AAEL009368 PE=3 SV=1 | 9 | 365 | 5.0E-141 |
| sp|B4IUG3|LIAS1_DROYA | Lipoyl synthase 1, mitochondrial OS=Drosophila yakuba GN=Las1 PE=3 SV=1 | 1 | 375 | 6.0E-141 |
| sp|B4PF83|LIAS2_DROYA | Lipoyl synthase 2, mitochondrial OS=Drosophila yakuba GN=Las2 PE=3 SV=1 | 1 | 375 | 8.0E-141 |
| sp|C3Y3G4|LIAS_BRAFL | Lipoyl synthase, mitochondrial OS=Branchiostoma floridae GN=BRAFLDRAFT_125969 PE=3 SV=1 | 35 | 365 | 1.0E-139 |
| sp|B4IAA7|LIAS_DROSE | Lipoyl synthase, mitochondrial OS=Drosophila sechellia GN=Las PE=3 SV=1 | 22 | 375 | 7.0E-139 |
| sp|B0WAU6|LIAS_CULQU | Lipoyl synthase, mitochondrial OS=Culex quinquefasciatus GN=CPIJ004250 PE=3 SV=1 | 21 | 362 | 7.0E-139 |
| sp|Q7JQW6|LIAS_DROME | Lipoyl synthase, mitochondrial OS=Drosophila melanogaster GN=Las PE=1 SV=2 | 22 | 375 | 6.0E-138 |
| sp|Q99M04|LIAS_MOUSE | Lipoyl synthase, mitochondrial OS=Mus musculus GN=Lias PE=1 SV=1 | 8 | 369 | 1.0E-137 |
| sp|B4KYY0|LIAS_DROMO | Lipoyl synthase, mitochondrial OS=Drosophila mojavensis GN=Las PE=3 SV=1 | 19 | 359 | 1.0E-137 |
| sp|Q5XIH4|LIAS_RAT | Lipoyl synthase, mitochondrial OS=Rattus norvegicus GN=Lias PE=2 SV=1 | 8 | 369 | 3.0E-137 |
| sp|Q6PHG4|LIAS_DANRE | Lipoyl synthase, mitochondrial OS=Danio rerio GN=lias PE=2 SV=1 | 38 | 368 | 5.0E-137 |
| sp|B3NIL9|LIAS_DROER | Lipoyl synthase, mitochondrial OS=Drosophila erecta GN=Las PE=3 SV=1 | 1 | 371 | 6.0E-137 |
| sp|O43766|LIAS_HUMAN | Lipoyl synthase, mitochondrial OS=Homo sapiens GN=LIAS PE=1 SV=3 | 37 | 371 | 1.0E-136 |
| sp|Q6GQ48|LIAS_XENLA | Lipoyl synthase, mitochondrial OS=Xenopus laevis GN=lias PE=2 SV=1 | 37 | 371 | 2.0E-136 |
| sp|B4J3F3|LIAS_DROGR | Lipoyl synthase, mitochondrial OS=Drosophila grimshawi GN=Las PE=3 SV=1 | 33 | 359 | 6.0E-136 |
| sp|A4RZ86|LIAS_OSTLU | Lipoyl synthase, mitochondrial OS=Ostreococcus lucimarinus (strain CCE9901) GN=LIP1 PE=3 SV=1 | 17 | 362 | 7.0E-136 |
| sp|B3M996|LIAS_DROAN | Lipoyl synthase, mitochondrial OS=Drosophila ananassae GN=Las PE=3 SV=1 | 4 | 370 | 7.0E-136 |
| sp|Q2LYK1|LIAS_DROPS | Lipoyl synthase, mitochondrial OS=Drosophila pseudoobscura pseudoobscura GN=Las PE=3 SV=1 | 22 | 359 | 2.0E-134 |
| sp|B4MXR6|LIAS_DROWI | Lipoyl synthase, mitochondrial OS=Drosophila willistoni GN=Las PE=3 SV=1 | 4 | 359 | 5.0E-134 |
| sp|Q5BIP7|LIAS_BOVIN | Lipoyl synthase, mitochondrial OS=Bos taurus GN=LIAS PE=2 SV=1 | 37 | 371 | 5.0E-134 |
| sp|B7FRU7|LIPA1_PHATC | Lipoyl synthase 1, mitochondrial OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_18029 PE=3 SV=1 | 66 | 362 | 3.0E-128 |
| sp|B3SBB5|LIAS_TRIAD | Lipoyl synthase, mitochondrial OS=Trichoplax adhaerens GN=TRIADDRAFT_38449 PE=3 SV=1 | 19 | 362 | 6.0E-128 |
| sp|C4PZQ3|LIAS_SCHMA | Lipoyl synthase, mitochondrial OS=Schistosoma mansoni GN=Smp_010100 PE=3 SV=1 | 32 | 371 | 4.0E-127 |
| sp|A8JGF7|LIAS_CHLRE | Lipoyl synthase, mitochondrial OS=Chlamydomonas reinhardtii GN=LIP1 PE=3 SV=1 | 70 | 360 | 6.0E-125 |
| sp|Q21452|LIAS_CAEEL | Lipoyl synthase, mitochondrial OS=Caenorhabditis elegans GN=M01F1.3 PE=3 SV=1 | 37 | 362 | 4.0E-123 |
| sp|A8PF69|LIAS_BRUMA | Lipoyl synthase, mitochondrial OS=Brugia malayi GN=Bm1_23910 PE=3 SV=1 | 37 | 362 | 1.0E-122 |
| sp|D0NP70|LIPA_PHYIT | Lipoyl synthase, mitochondrial OS=Phytophthora infestans (strain T30-4) GN=PITG_14852 PE=3 SV=1 | 11 | 362 | 6.0E-122 |
| sp|A9NNH7|LIAS_PICSI | Lipoyl synthase, mitochondrial OS=Picea sitchensis GN=LIP1 PE=2 SV=1 | 6 | 359 | 9.0E-120 |
| sp|B7FM45|LIAS_MEDTR | Lipoyl synthase, mitochondrial OS=Medicago truncatula GN=LIP1 PE=2 SV=1 | 1 | 359 | 4.0E-119 |
| sp|B9RX57|LISC_RICCO | Lipoyl synthase, chloroplastic OS=Ricinus communis GN=LIP1P PE=3 SV=1 | 66 | 369 | 5.0E-119 |
| sp|A5CB81|LIAS_VITVI | Lipoyl synthase, mitochondrial OS=Vitis vinifera GN=LIP1 PE=3 SV=1 | 41 | 359 | 6.0E-118 |
| sp|Q3LSN4|LIAS1_PEA | Lipoyl synthase 1, mitochondrial OS=Pisum sativum GN=LIP1-1 PE=2 SV=1 | 1 | 359 | 1.0E-117 |
| sp|Q3LSN5|LIAS2_PEA | Lipoyl synthase 2, mitochondrial OS=Pisum sativum GN=LIP1-2 PE=2 SV=1 | 1 | 359 | 5.0E-117 |
| sp|B8B016|LISC2_ORYSI | Lipoyl synthase 2, chloroplastic OS=Oryza sativa subsp. indica GN=LIP1P-2 PE=3 SV=1 | 58 | 365 | 1.0E-116 |
| sp|Q6L534|LISC2_ORYSJ | Lipoyl synthase 2, chloroplastic OS=Oryza sativa subsp. japonica GN=LIP1P-2 PE=2 SV=1 | 58 | 365 | 2.0E-116 |
| sp|B7G3Y9|LIPA2_PHATC | Lipoyl synthase 2, mitochondrial OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_28652 PE=3 SV=1 | 66 | 365 | 4.0E-116 |
| sp|B9H5L9|LIAS_POPTR | Lipoyl synthase, mitochondrial OS=Populus trichocarpa GN=LIP1 PE=3 SV=1 | 5 | 359 | 5.0E-116 |
| sp|Q9ZWT1|LIAS_ARATH | Lipoyl synthase, mitochondrial OS=Arabidopsis thaliana GN=LIP1 PE=2 SV=1 | 41 | 359 | 3.0E-115 |
| sp|Q7RBD6|LIPA_PLAYO | Lipoyl synthase, apicoplast OS=Plasmodium yoelii yoelii GN=lipA PE=3 SV=1 | 57 | 367 | 3.0E-114 |
| sp|A2XU53|LIAS_ORYSI | Lipoyl synthase, mitochondrial OS=Oryza sativa subsp. indica GN=LIP1 PE=3 SV=2 | 49 | 359 | 3.0E-114 |
| sp|B8A031|LIAS_MAIZE | Lipoyl synthase, mitochondrial OS=Zea mays GN=LIP1 PE=2 SV=1 | 3 | 362 | 4.0E-114 |
| sp|Q7XRF1|LIAS_ORYSJ | Lipoyl synthase, mitochondrial OS=Oryza sativa subsp. japonica GN=LIP1 PE=2 SV=2 | 31 | 359 | 1.0E-113 |
| sp|C5Y9R0|LIAS_SORBI | Lipoyl synthase, mitochondrial OS=Sorghum bicolor GN=LIP1 PE=3 SV=1 | 49 | 359 | 2.0E-113 |
| sp|D0A0G6|LIPA_TRYB9 | Lipoyl synthase, mitochondrial OS=Trypanosoma brucei gambiense (strain MHOM/CI/86/DAL972) GN=TbgDal_X18270 PE=3 SV=1 | 65 | 362 | 2.0E-113 |
| sp|Q388A7|LIPA_TRYB2 | Lipoyl synthase, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb10.61.1530 PE=3 SV=1 | 65 | 362 | 2.0E-113 |
| sp|Q8IDQ0|LIPA_PLAF7 | Lipoyl synthase, apicoplast OS=Plasmodium falciparum (isolate 3D7) GN=lipA PE=2 SV=1 | 66 | 367 | 8.0E-112 |
| sp|Q4DC43|LIPA1_TRYCC | Lipoyl synthase 1, mitochondrial OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053511291.30 PE=3 SV=1 | 65 | 362 | 4.0E-110 |
| sp|B9N2B0|LISC2_POPTR | Lipoyl synthase 2, chloroplastic OS=Populus trichocarpa GN=LIP1P-2 PE=3 SV=1 | 2 | 365 | 5.0E-110 |
| sp|Q4DYL7|LIPA2_TRYCC | Lipoyl synthase 2, mitochondrial OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053506211.10 PE=3 SV=1 | 65 | 362 | 8.0E-110 |
| sp|C0PN26|LISC2_MAIZE | Lipoyl synthase 2, chloroplastic OS=Zea mays GN=LIP1P-2 PE=2 SV=1 | 66 | 365 | 1.0E-109 |
| sp|Q5ZAQ2|LISC1_ORYSJ | Lipoyl synthase 1, chloroplastic OS=Oryza sativa subsp. japonica GN=LIP1P-1 PE=3 SV=1 | 66 | 360 | 2.0E-109 |
| sp|B8AA76|LISC1_ORYSI | Lipoyl synthase 1, chloroplastic OS=Oryza sativa subsp. indica GN=LIP1P-1 PE=3 SV=2 | 66 | 360 | 2.0E-109 |
| sp|C5XKZ1|LISC_SORBI | Lipoyl synthase, chloroplastic OS=Sorghum bicolor GN=LIP1P PE=3 SV=1 | 66 | 360 | 2.0E-109 |
| sp|B6TN12|LISC1_MAIZE | Lipoyl synthase 1, chloroplastic OS=Zea mays GN=LIP1P-1 PE=2 SV=1 | 66 | 360 | 3.0E-109 |
| sp|B9I666|LISC1_POPTR | Lipoyl synthase 1, chloroplastic OS=Populus trichocarpa GN=LIP1P-1 PE=3 SV=1 | 57 | 365 | 8.0E-109 |
| sp|A5K883|LIPA_PLAVS | Lipoyl synthase, apicoplast OS=Plasmodium vivax (strain Salvador I) GN=lipA PE=3 SV=1 | 42 | 364 | 8.0E-109 |
| sp|Q8LEE8|LISC_ARATH | Lipoyl synthase, chloroplastic OS=Arabidopsis thaliana GN=LIP1P PE=2 SV=2 | 66 | 360 | 2.0E-108 |
| sp|A4RW69|LISC_OSTLU | Lipoyl synthase, chloroplastic OS=Ostreococcus lucimarinus (strain CCE9901) GN=LIP1P PE=3 SV=1 | 40 | 366 | 5.0E-108 |
| sp|A8I2V9|LISC_CHLRE | Lipoyl synthase, chloroplastic OS=Chlamydomonas reinhardtii GN=LIP1P PE=3 SV=1 | 57 | 359 | 1.0E-107 |
| sp|A7HBU9|LIPA_ANADF | Lipoyl synthase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=lipA PE=3 SV=1 | 64 | 366 | 2.0E-107 |
| sp|B3L8F2|LIPA_PLAKH | Lipoyl synthase, apicoplast OS=Plasmodium knowlesi (strain H) GN=lipA PE=3 SV=1 | 57 | 366 | 1.0E-106 |
| sp|Q86G50|LIPA_TOXGO | Lipoyl synthase, apicoplast OS=Toxoplasma gondii GN=lipA PE=2 SV=1 | 59 | 368 | 5.0E-106 |
| sp|B9LR22|LIPA_HALLT | Probable lipoyl synthase OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=lipA PE=3 SV=1 | 62 | 360 | 1.0E-105 |
| sp|Q1D4N0|LIPA_MYXXD | Lipoyl synthase OS=Myxococcus xanthus (strain DK 1622) GN=lipA PE=3 SV=2 | 64 | 366 | 3.0E-104 |
| sp|Q9HN78|LIPA_HALSA | Probable lipoyl synthase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=lipA PE=3 SV=1 | 64 | 360 | 9.0E-104 |
| sp|B0R7C4|LIPA_HALS3 | Probable lipoyl synthase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=lipA PE=3 SV=1 | 64 | 360 | 9.0E-104 |
| sp|Q5SLQ4|LIPA_THET8 | Lipoyl synthase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=lipA PE=3 SV=1 | 66 | 356 | 1.0E-102 |
| sp|Q72GV1|LIPA_THET2 | Lipoyl synthase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=lipA PE=3 SV=1 | 66 | 356 | 1.0E-102 |
| sp|A1U380|LIPA_MARHV | Lipoyl synthase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=lipA PE=3 SV=1 | 64 | 359 | 3.0E-102 |
| sp|Q2IIW6|LIPA_ANADE | Lipoyl synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=lipA PE=3 SV=2 | 66 | 366 | 4.0E-102 |
| sp|Q1IXJ7|LIPA_DEIGD | Lipoyl synthase OS=Deinococcus geothermalis (strain DSM 11300) GN=lipA PE=3 SV=1 | 66 | 357 | 8.0E-101 |
| sp|A4HY57|LIPA_LEIIN | Lipoyl synthase, mitochondrial OS=Leishmania infantum GN=LinJ19.0190 PE=3 SV=1 | 65 | 362 | 1.0E-100 |
| sp|Q4QDI6|LIPA_LEIMA | Lipoyl synthase, mitochondrial OS=Leishmania major GN=LmjF19.0350 PE=3 SV=1 | 65 | 362 | 3.0E-100 |
| sp|A9FD62|LIPA_SORC5 | Lipoyl synthase OS=Sorangium cellulosum (strain So ce56) GN=lipA PE=3 SV=1 | 66 | 364 | 1.0E-99 |
| sp|Q3IU11|LIPA_NATPD | Probable lipoyl synthase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=lipA PE=3 SV=1 | 64 | 360 | 6.0E-99 |
| sp|A4XYX3|LIPA_PSEMY | Lipoyl synthase OS=Pseudomonas mendocina (strain ymp) GN=lipA PE=3 SV=1 | 66 | 359 | 1.0E-98 |
| sp|B9RW49|LIAS_RICCO | Lipoyl synthase, mitochondrial OS=Ricinus communis GN=LIP1 PE=3 SV=1 | 68 | 327 | 2.0E-98 |
| sp|Q9RWA4|LIPA_DEIRA | Lipoyl synthase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=lipA PE=3 SV=1 | 66 | 356 | 1.0E-97 |
| sp|A3MW09|LIPA_PYRCJ | Probable lipoyl synthase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=lipA PE=3 SV=1 | 65 | 358 | 3.0E-96 |
| sp|A4H9Z3|LIPA_LEIBR | Lipoyl synthase, mitochondrial OS=Leishmania braziliensis GN=LbrM19_V2.0670 PE=3 SV=1 | 36 | 362 | 2.0E-94 |
| sp|A4WK38|LIPA_PYRAR | Probable lipoyl synthase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=lipA PE=3 SV=1 | 65 | 354 | 2.0E-94 |
| sp|Q9Y9E3|LIPA_AERPE | Probable lipoyl synthase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=lipA PE=3 SV=2 | 78 | 363 | 1.0E-92 |
| sp|Q0A8A4|LIPA_ALKEH | Lipoyl synthase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=lipA PE=3 SV=1 | 64 | 357 | 2.0E-92 |
| sp|Q5WYF5|LIPA_LEGPL | Lipoyl synthase OS=Legionella pneumophila (strain Lens) GN=lipA PE=3 SV=1 | 66 | 354 | 2.0E-92 |
| sp|Q5ZXI6|LIPA_LEGPH | Lipoyl synthase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=lipA PE=3 SV=1 | 66 | 354 | 2.0E-92 |
| sp|Q5X703|LIPA_LEGPA | Lipoyl synthase OS=Legionella pneumophila (strain Paris) GN=lipA PE=3 SV=1 | 66 | 354 | 2.0E-92 |
| sp|A5IGG3|LIPA_LEGPC | Lipoyl synthase OS=Legionella pneumophila (strain Corby) GN=lipA PE=3 SV=1 | 66 | 354 | 5.0E-92 |
| sp|B0TZD6|LIPA_FRAP2 | Lipoyl synthase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=lipA PE=3 SV=1 | 59 | 359 | 1.0E-91 |
| sp|A4IY90|LIPA_FRATW | Lipoyl synthase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=lipA PE=3 SV=1 | 59 | 359 | 1.0E-91 |
| sp|Q5NH21|LIPA_FRATT | Lipoyl synthase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=lipA PE=3 SV=1 | 59 | 359 | 1.0E-91 |
| sp|A0Q6Q2|LIPA_FRATN | Lipoyl synthase OS=Francisella tularensis subsp. novicida (strain U112) GN=lipA PE=3 SV=1 | 59 | 359 | 1.0E-91 |
| sp|Q14IH3|LIPA_FRAT1 | Lipoyl synthase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=lipA PE=3 SV=1 | 59 | 359 | 1.0E-91 |
| sp|Q0BM68|LIPA_FRATO | Lipoyl synthase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=lipA PE=3 SV=1 | 59 | 359 | 1.0E-91 |
| sp|Q2A3R2|LIPA_FRATH | Lipoyl synthase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=lipA PE=3 SV=1 | 59 | 359 | 1.0E-91 |
| sp|A7NBV0|LIPA_FRATF | Lipoyl synthase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=lipA PE=3 SV=1 | 59 | 359 | 1.0E-91 |
| sp|B2SH72|LIPA_FRATM | Lipoyl synthase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=lipA PE=3 SV=1 | 59 | 359 | 2.0E-91 |
| sp|A1WT98|LIPA_HALHL | Lipoyl synthase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=lipA PE=3 SV=1 | 64 | 350 | 5.0E-89 |
| sp|Q1AT13|LIPA_RUBXD | Lipoyl synthase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=lipA PE=3 SV=1 | 66 | 366 | 7.0E-87 |
| sp|Q4JBV4|LIPA_SULAC | Probable lipoyl synthase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=lipA PE=3 SV=1 | 78 | 366 | 3.0E-86 |
| sp|Q97U63|LIPA_SULSO | Probable lipoyl synthase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=lipA PE=3 SV=1 | 69 | 357 | 9.0E-86 |
| sp|Q2GGX7|LIPA_EHRCR | Lipoyl synthase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=lipA PE=3 SV=1 | 66 | 352 | 1.0E-85 |
| sp|Q5HB02|LIPA_EHRRW | Lipoyl synthase OS=Ehrlichia ruminantium (strain Welgevonden) GN=lipA PE=3 SV=1 | 66 | 352 | 5.0E-85 |
| sp|Q5FFK4|LIPA_EHRRG | Lipoyl synthase OS=Ehrlichia ruminantium (strain Gardel) GN=lipA PE=3 SV=1 | 66 | 352 | 5.0E-85 |
| sp|Q3YRT2|LIPA_EHRCJ | Lipoyl synthase OS=Ehrlichia canis (strain Jake) GN=lipA PE=3 SV=1 | 66 | 352 | 1.0E-84 |
| sp|Q67MF5|LIPA_SYMTH | Lipoyl synthase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=lipA PE=3 SV=1 | 64 | 352 | 2.0E-84 |
| sp|Q0VN36|LIPA_ALCBS | Lipoyl synthase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=lipA PE=3 SV=1 | 64 | 350 | 3.0E-84 |
| sp|Q5WDS6|LIPA_BACSK | Lipoyl synthase OS=Bacillus clausii (strain KSM-K16) GN=lipA PE=3 SV=1 | 64 | 352 | 3.0E-84 |
| sp|Q9A7I8|LIPA_CAUCR | Lipoyl synthase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=lipA PE=3 SV=1 | 64 | 354 | 5.0E-84 |
| sp|B8GW82|LIPA_CAUCN | Lipoyl synthase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=lipA PE=3 SV=1 | 64 | 354 | 5.0E-84 |
| sp|Q68W08|LIPA_RICTY | Lipoyl synthase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=lipA PE=3 SV=1 | 64 | 350 | 7.0E-84 |
| sp|Q8ERL8|LIPA_OCEIH | Lipoyl synthase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=lipA PE=3 SV=1 | 61 | 384 | 8.0E-84 |
| sp|Q2GKX7|LIPA_ANAPZ | Lipoyl synthase OS=Anaplasma phagocytophilum (strain HZ) GN=lipA PE=3 SV=1 | 66 | 355 | 1.0E-83 |
| sp|Q8ZUR9|LIPA_PYRAE | Probable lipoyl synthase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=lipA PE=3 SV=1 | 65 | 358 | 2.0E-83 |
| sp|A8GUH3|LIPA_RICB8 | Lipoyl synthase OS=Rickettsia bellii (strain OSU 85-389) GN=lipA PE=3 SV=2 | 66 | 371 | 6.0E-83 |
| sp|Q6L1L7|LIPA_PICTO | Probable lipoyl synthase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=lipA PE=3 SV=1 | 66 | 356 | 6.0E-83 |
| sp|Q2RHM6|LIPA_MOOTA | Lipoyl synthase OS=Moorella thermoacetica (strain ATCC 39073) GN=lipA PE=3 SV=1 | 64 | 356 | 8.0E-83 |
| sp|Q5KVM7|LIPA_GEOKA | Lipoyl synthase OS=Geobacillus kaustophilus (strain HTA426) GN=lipA PE=3 SV=2 | 64 | 352 | 1.0E-82 |
| sp|C5D7H5|LIPA_GEOSW | Lipoyl synthase OS=Geobacillus sp. (strain WCH70) GN=lipA PE=3 SV=1 | 64 | 352 | 1.0E-82 |
| sp|Q9K7C9|LIPA_BACHD | Lipoyl synthase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=lipA PE=3 SV=1 | 64 | 363 | 1.0E-82 |
| sp|Q0W150|LIPA_METAR | Probable lipoyl synthase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=lipA PE=3 SV=1 | 57 | 355 | 2.0E-82 |
| sp|A8EZU2|LIPA_RICCK | Lipoyl synthase OS=Rickettsia canadensis (strain McKiel) GN=lipA PE=3 SV=1 | 66 | 352 | 2.0E-82 |
| sp|Q1RGX4|LIPA_RICBR | Lipoyl synthase OS=Rickettsia bellii (strain RML369-C) GN=lipA PE=3 SV=1 | 66 | 371 | 2.0E-82 |
| sp|B3CQP5|LIPA_ORITI | Lipoyl synthase OS=Orientia tsutsugamushi (strain Ikeda) GN=lipA PE=3 SV=1 | 66 | 354 | 3.0E-82 |
| sp|A8F2M4|LIPA_RICM5 | Lipoyl synthase OS=Rickettsia massiliae (strain Mtu5) GN=lipA PE=3 SV=1 | 66 | 352 | 7.0E-82 |
| sp|A4ISG5|LIPA_GEOTN | Lipoyl synthase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=lipA PE=3 SV=1 | 64 | 352 | 8.0E-82 |
| sp|Q4UK97|LIPA_RICFE | Lipoyl synthase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=lipA PE=3 SV=2 | 66 | 352 | 8.0E-82 |
| sp|B6IQ36|LIPA_RHOCS | Lipoyl synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=lipA PE=3 SV=1 | 64 | 383 | 1.0E-81 |
| sp|B9EAJ9|LIPA_MACCJ | Lipoyl synthase OS=Macrococcus caseolyticus (strain JCSC5402) GN=lipA PE=3 SV=1 | 64 | 352 | 2.0E-81 |
| sp|A5CCM4|LIPA_ORITB | Lipoyl synthase OS=Orientia tsutsugamushi (strain Boryong) GN=lipA PE=3 SV=1 | 66 | 354 | 2.0E-81 |
| sp|O05959|LIPA_RICPR | Lipoyl synthase OS=Rickettsia prowazekii (strain Madrid E) GN=lipA PE=3 SV=1 | 66 | 350 | 2.0E-81 |
| sp|Q8KDH2|LIPA_CHLTE | Lipoyl synthase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=lipA PE=3 SV=1 | 61 | 353 | 2.0E-81 |
| sp|C4K1I0|LIPA_RICPU | Lipoyl synthase OS=Rickettsia peacockii (strain Rustic) GN=lipA PE=3 SV=1 | 66 | 352 | 3.0E-81 |
| sp|Q92GH8|LIPA_RICCN | Lipoyl synthase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=lipA PE=3 SV=2 | 66 | 352 | 3.0E-81 |
| sp|C3PLL8|LIPA_RICAE | Lipoyl synthase OS=Rickettsia africae (strain ESF-5) GN=lipA PE=3 SV=1 | 66 | 352 | 4.0E-81 |
| sp|A8GTI8|LIPA_RICRS | Lipoyl synthase OS=Rickettsia rickettsii (strain Sheila Smith) GN=lipA PE=3 SV=1 | 66 | 352 | 1.0E-80 |
| sp|B0BV26|LIPA_RICRO | Lipoyl synthase OS=Rickettsia rickettsii (strain Iowa) GN=lipA PE=3 SV=1 | 66 | 352 | 1.0E-80 |
| sp|Q1GTM7|LIPA_SPHAL | Lipoyl synthase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=lipA PE=3 SV=1 | 64 | 354 | 1.0E-80 |
| sp|Q4L4T8|LIPA_STAHJ | Lipoyl synthase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=lipA PE=3 SV=2 | 64 | 352 | 2.0E-80 |
| sp|A7GUG3|LIPA_BACCN | Lipoyl synthase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=lipA PE=3 SV=1 | 59 | 352 | 2.0E-80 |
| sp|B3QNE9|LIPA_CHLP8 | Lipoyl synthase OS=Chlorobaculum parvum (strain NCIB 8327) GN=lipA PE=3 SV=1 | 61 | 353 | 2.0E-80 |
| sp|A4XHV2|LIPA_CALS8 | Lipoyl synthase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=lipA PE=3 SV=1 | 66 | 352 | 2.0E-80 |
| sp|O32129|LIPA_BACSU | Lipoyl synthase OS=Bacillus subtilis (strain 168) GN=lipA PE=1 SV=2 | 64 | 352 | 3.0E-80 |
| sp|Q8CPW4|LIPA_STAES | Lipoyl synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=lipA PE=3 SV=1 | 64 | 352 | 5.0E-80 |
| sp|Q5HQN7|LIPA_STAEQ | Lipoyl synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=lipA PE=3 SV=1 | 64 | 352 | 5.0E-80 |
| sp|B3CP16|LIPA_WOLPP | Lipoyl synthase OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=lipA PE=3 SV=1 | 66 | 352 | 7.0E-80 |
| sp|Q5GSY2|LIPA_WOLTR | Lipoyl synthase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=lipA PE=3 SV=1 | 66 | 352 | 9.0E-80 |
| sp|B7IMZ7|LIPA_BACC2 | Lipoyl synthase OS=Bacillus cereus (strain G9842) GN=lipA PE=3 SV=1 | 59 | 352 | 1.0E-79 |
| sp|A7Z8E8|LIPA_BACMF | Lipoyl synthase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=lipA PE=3 SV=1 | 64 | 352 | 1.0E-79 |
| sp|Q5PAD4|LIPA_ANAMM | Lipoyl synthase OS=Anaplasma marginale (strain St. Maries) GN=lipA PE=3 SV=2 | 66 | 350 | 1.0E-79 |
| sp|A8GPR5|LIPA_RICAH | Lipoyl synthase OS=Rickettsia akari (strain Hartford) GN=lipA PE=3 SV=1 | 66 | 352 | 1.0E-79 |
| sp|Q49W64|LIPA_STAS1 | Lipoyl synthase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=lipA PE=3 SV=1 | 64 | 352 | 1.0E-79 |
| sp|Q2YWR5|LIPA_STAAB | Lipoyl synthase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=lipA PE=3 SV=1 | 64 | 374 | 1.0E-79 |
| sp|C1D5T3|LIPA_LARHH | Lipoyl synthase OS=Laribacter hongkongensis (strain HLHK9) GN=lipA PE=3 SV=1 | 64 | 352 | 2.0E-79 |
| sp|P65287|LIPA_STAAW | Lipoyl synthase OS=Staphylococcus aureus (strain MW2) GN=lipA PE=3 SV=1 | 64 | 374 | 2.0E-79 |
| sp|A8Z1I3|LIPA_STAAT | Lipoyl synthase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=lipA PE=3 SV=1 | 64 | 374 | 2.0E-79 |
| sp|Q6GB01|LIPA_STAAS | Lipoyl synthase OS=Staphylococcus aureus (strain MSSA476) GN=lipA PE=3 SV=1 | 64 | 374 | 2.0E-79 |
| sp|Q6GIG3|LIPA_STAAR | Lipoyl synthase OS=Staphylococcus aureus (strain MRSA252) GN=lipA PE=3 SV=1 | 64 | 374 | 2.0E-79 |
| sp|P65286|LIPA_STAAN | Lipoyl synthase OS=Staphylococcus aureus (strain N315) GN=lipA PE=1 SV=1 | 64 | 374 | 2.0E-79 |
| sp|P65285|LIPA_STAAM | Lipoyl synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=lipA PE=3 SV=1 | 64 | 374 | 2.0E-79 |
| sp|A6QFD6|LIPA_STAAE | Lipoyl synthase OS=Staphylococcus aureus (strain Newman) GN=lipA PE=3 SV=1 | 64 | 374 | 2.0E-79 |
| sp|Q5HHG0|LIPA_STAAC | Lipoyl synthase OS=Staphylococcus aureus (strain COL) GN=lipA PE=3 SV=1 | 64 | 374 | 2.0E-79 |
| sp|A5IRA1|LIPA_STAA9 | Lipoyl synthase OS=Staphylococcus aureus (strain JH9) GN=lipA PE=3 SV=1 | 64 | 374 | 2.0E-79 |
| sp|Q2FZX4|LIPA_STAA8 | Lipoyl synthase OS=Staphylococcus aureus (strain NCTC 8325) GN=lipA PE=3 SV=1 | 64 | 374 | 2.0E-79 |
| sp|Q2FIE9|LIPA_STAA3 | Lipoyl synthase OS=Staphylococcus aureus (strain USA300) GN=lipA PE=3 SV=1 | 64 | 374 | 2.0E-79 |
| sp|A6U030|LIPA_STAA2 | Lipoyl synthase OS=Staphylococcus aureus (strain JH1) GN=lipA PE=3 SV=1 | 64 | 374 | 2.0E-79 |
| sp|A7X0C7|LIPA_STAA1 | Lipoyl synthase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=lipA PE=3 SV=1 | 64 | 374 | 2.0E-79 |
| sp|Q8R9E1|LIPA_CALS4 | Lipoyl synthase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=lipA PE=3 SV=1 | 64 | 350 | 2.0E-79 |
| sp|B7HCZ6|LIPA_BACC4 | Lipoyl synthase OS=Bacillus cereus (strain B4264) GN=lipA PE=3 SV=1 | 59 | 352 | 3.0E-79 |
| sp|Q816A0|LIPA_BACCR | Lipoyl synthase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=lipA PE=3 SV=1 | 59 | 352 | 3.0E-79 |
| sp|C1EY56|LIPA_BACC3 | Lipoyl synthase OS=Bacillus cereus (strain 03BB102) GN=lipA PE=3 SV=1 | 59 | 352 | 4.0E-79 |
| sp|A0RKF7|LIPA_BACAH | Lipoyl synthase OS=Bacillus thuringiensis (strain Al Hakam) GN=lipA PE=3 SV=2 | 59 | 352 | 4.0E-79 |
| sp|A7HXW0|LIPA_PARL1 | Lipoyl synthase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=lipA PE=3 SV=1 | 64 | 354 | 4.0E-79 |
| sp|B9DIX8|LIPA_STACT | Lipoyl synthase OS=Staphylococcus carnosus (strain TM300) GN=lipA PE=3 SV=1 | 64 | 352 | 4.0E-79 |
| sp|Q631Z7|LIPA_BACCZ | Lipoyl synthase OS=Bacillus cereus (strain ZK / E33L) GN=lipA PE=3 SV=1 | 59 | 352 | 4.0E-79 |
| sp|B9J3H2|LIPA_BACCQ | Lipoyl synthase OS=Bacillus cereus (strain Q1) GN=lipA PE=3 SV=1 | 59 | 352 | 4.0E-79 |
| sp|B7HUW3|LIPA_BACC7 | Lipoyl synthase OS=Bacillus cereus (strain AH187) GN=lipA PE=3 SV=1 | 59 | 352 | 4.0E-79 |
| sp|Q72YB2|LIPA_BACC1 | Lipoyl synthase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=lipA PE=3 SV=1 | 59 | 352 | 4.0E-79 |
| sp|Q6HBT4|LIPA_BACHK | Lipoyl synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=lipA PE=3 SV=1 | 59 | 352 | 5.0E-79 |
| sp|B7JDM3|LIPA_BACC0 | Lipoyl synthase OS=Bacillus cereus (strain AH820) GN=lipA PE=3 SV=1 | 59 | 352 | 5.0E-79 |
| sp|Q81XM8|LIPA_BACAN | Lipoyl synthase OS=Bacillus anthracis GN=lipA PE=3 SV=1 | 59 | 352 | 5.0E-79 |
| sp|C3LCA6|LIPA_BACAC | Lipoyl synthase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=lipA PE=3 SV=1 | 59 | 352 | 5.0E-79 |
| sp|C3PDK2|LIPA_BACAA | Lipoyl synthase OS=Bacillus anthracis (strain A0248) GN=lipA PE=3 SV=1 | 59 | 352 | 5.0E-79 |
| sp|A9VNX6|LIPA_BACWK | Lipoyl synthase OS=Bacillus weihenstephanensis (strain KBAB4) GN=lipA PE=3 SV=1 | 59 | 352 | 6.0E-79 |
| sp|P61200|LIPA_WOLPM | Lipoyl synthase OS=Wolbachia pipientis wMel GN=lipA PE=3 SV=1 | 66 | 352 | 7.0E-79 |
| sp|B9LM70|LIPA_CHLSY | Lipoyl synthase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=lipA PE=3 SV=1 | 58 | 350 | 9.0E-79 |
| sp|A9WEM1|LIPA_CHLAA | Lipoyl synthase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=lipA PE=3 SV=1 | 58 | 350 | 9.0E-79 |
| sp|B9MQ24|LIPA_CALBD | Lipoyl synthase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=lipA PE=3 SV=1 | 66 | 350 | 1.0E-78 |
| sp|P61199|LIPA_TREDE | Lipoyl synthase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=lipA PE=3 SV=1 | 60 | 350 | 1.0E-78 |
| sp|C0R2Q4|LIPA_WOLWR | Lipoyl synthase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=lipA PE=3 SV=1 | 66 | 352 | 2.0E-78 |
| sp|Q89LR6|LIPA1_BRADU | Lipoyl synthase 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=lipA1 PE=3 SV=1 | 59 | 354 | 2.0E-78 |
| sp|B2IB58|LIPA_BEII9 | Lipoyl synthase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=lipA PE=3 SV=1 | 64 | 354 | 2.0E-78 |
| sp|Q1II13|LIPA_KORVE | Lipoyl synthase OS=Koribacter versatilis (strain Ellin345) GN=lipA PE=3 SV=1 | 66 | 352 | 2.0E-78 |
| sp|B8G782|LIPA_CHLAD | Lipoyl synthase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=lipA PE=3 SV=1 | 58 | 350 | 2.0E-78 |
| sp|A8FH34|LIPA_BACP2 | Lipoyl synthase OS=Bacillus pumilus (strain SAFR-032) GN=lipA PE=3 SV=1 | 64 | 352 | 2.0E-78 |
| sp|A4WRC8|LIPA_RHOS5 | Lipoyl synthase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=lipA PE=3 SV=1 | 63 | 354 | 6.0E-78 |
| sp|A1BFY3|LIPA_CHLPD | Lipoyl synthase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=lipA PE=3 SV=1 | 64 | 350 | 6.0E-78 |
| sp|C3K2L8|LIPA_PSEFS | Lipoyl synthase OS=Pseudomonas fluorescens (strain SBW25) GN=lipA PE=3 SV=1 | 56 | 352 | 6.0E-78 |
| sp|Q2NAD7|LIPA_ERYLH | Lipoyl synthase OS=Erythrobacter litoralis (strain HTCC2594) GN=lipA PE=3 SV=1 | 64 | 356 | 7.0E-78 |
| sp|C1DMR1|LIPA_AZOVD | Lipoyl synthase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=lipA PE=3 SV=1 | 63 | 352 | 1.0E-77 |
| sp|Q8DL83|LIPA1_THEEB | Lipoyl synthase 1 OS=Thermosynechococcus elongatus (strain BP-1) GN=lipA1 PE=3 SV=2 | 66 | 352 | 2.0E-77 |
| sp|A5CWR6|LIPA_VESOH | Lipoyl synthase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=lipA PE=3 SV=1 | 59 | 351 | 2.0E-77 |
| sp|A9KFW5|LIPA_COXBN | Lipoyl synthase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=lipA PE=3 SV=1 | 64 | 350 | 3.0E-77 |
| sp|B6J7S3|LIPA_COXB1 | Lipoyl synthase OS=Coxiella burnetii (strain CbuK_Q154) GN=lipA PE=3 SV=1 | 64 | 350 | 3.0E-77 |
| sp|B8EJU1|LIPA_METSB | Lipoyl synthase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=lipA PE=3 SV=1 | 64 | 354 | 3.0E-77 |
| sp|Q7NTF9|LIPA_CHRVO | Lipoyl synthase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=lipA PE=3 SV=1 | 66 | 350 | 4.0E-77 |
| sp|P73572|LIPA2_SYNY3 | Lipoyl synthase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=lipA2 PE=3 SV=1 | 63 | 352 | 4.0E-77 |
| sp|Q83C63|LIPA_COXBU | Lipoyl synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=lipA PE=3 SV=1 | 64 | 350 | 5.0E-77 |
| sp|A9NDX8|LIPA_COXBR | Lipoyl synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=lipA PE=3 SV=1 | 64 | 350 | 5.0E-77 |
| sp|B6IZL4|LIPA_COXB2 | Lipoyl synthase OS=Coxiella burnetii (strain CbuG_Q212) GN=lipA PE=3 SV=1 | 64 | 350 | 5.0E-77 |
| sp|Q2GE84|LIPA_NEOSM | Lipoyl synthase OS=Neorickettsia sennetsu (strain Miyayama) GN=lipA PE=3 SV=1 | 91 | 364 | 6.0E-77 |
| sp|Q3K6A4|LIPA_PSEPF | Lipoyl synthase OS=Pseudomonas fluorescens (strain Pf0-1) GN=lipA PE=3 SV=1 | 56 | 352 | 8.0E-77 |
| sp|A5US48|LIPA_ROSS1 | Lipoyl synthase OS=Roseiflexus sp. (strain RS-1) GN=lipA PE=3 SV=1 | 64 | 350 | 9.0E-77 |
| sp|Q7NFJ9|LIPA2_GLOVI | Lipoyl synthase 2 OS=Gloeobacter violaceus (strain PCC 7421) GN=lipA2 PE=3 SV=1 | 59 | 352 | 1.0E-76 |
| sp|A4SEG3|LIPA_CHLPM | Lipoyl synthase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=lipA PE=3 SV=1 | 64 | 351 | 1.0E-76 |
| sp|A7TDI2|LIAS_NEMVE | Lipoyl synthase, mitochondrial OS=Nematostella vectensis GN=v1g225637 PE=3 SV=1 | 56 | 350 | 2.0E-76 |
| sp|Q2G712|LIPA_NOVAD | Lipoyl synthase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=lipA PE=3 SV=1 | 64 | 354 | 2.0E-76 |
| sp|A7IM78|LIPA_XANP2 | Lipoyl synthase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=lipA PE=3 SV=1 | 64 | 354 | 3.0E-76 |
| sp|A5WDV8|LIPA_PSYWF | Lipoyl synthase OS=Psychrobacter sp. (strain PRwf-1) GN=lipA PE=3 SV=1 | 56 | 379 | 3.0E-76 |
| sp|Q8A029|LIPA_BACTN | Lipoyl synthase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=lipA PE=3 SV=1 | 64 | 350 | 4.0E-76 |
| sp|P65282|LIPA_BRUSU | Lipoyl synthase OS=Brucella suis biovar 1 (strain 1330) GN=lipA PE=3 SV=1 | 66 | 354 | 4.0E-76 |
| sp|B0CGS4|LIPA_BRUSI | Lipoyl synthase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=lipA PE=3 SV=1 | 66 | 354 | 4.0E-76 |
| sp|P65281|LIPA_BRUME | Lipoyl synthase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=lipA PE=3 SV=1 | 66 | 354 | 4.0E-76 |
| sp|C0RJ95|LIPA_BRUMB | Lipoyl synthase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=lipA PE=3 SV=1 | 66 | 354 | 4.0E-76 |
| sp|A9M5D7|LIPA_BRUC2 | Lipoyl synthase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=lipA PE=3 SV=1 | 66 | 354 | 4.0E-76 |
| sp|Q57D15|LIPA_BRUAB | Lipoyl synthase OS=Brucella abortus biovar 1 (strain 9-941) GN=lipA PE=3 SV=1 | 66 | 354 | 4.0E-76 |
| sp|Q2YPV8|LIPA_BRUA2 | Lipoyl synthase OS=Brucella abortus (strain 2308) GN=lipA PE=3 SV=1 | 66 | 354 | 4.0E-76 |
| sp|B2S5X5|LIPA_BRUA1 | Lipoyl synthase OS=Brucella abortus (strain S19) GN=lipA PE=3 SV=1 | 66 | 354 | 4.0E-76 |
| sp|B9KSE2|LIPA_RHOSK | Lipoyl synthase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=lipA PE=3 SV=1 | 59 | 354 | 4.0E-76 |
| sp|Q3J2P4|LIPA_RHOS4 | Lipoyl synthase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=lipA PE=3 SV=1 | 59 | 354 | 4.0E-76 |
| sp|A3PJL9|LIPA_RHOS1 | Lipoyl synthase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=lipA PE=3 SV=1 | 59 | 354 | 4.0E-76 |
| sp|A4VQZ6|LIPA_PSEU5 | Lipoyl synthase OS=Pseudomonas stutzeri (strain A1501) GN=lipA PE=3 SV=1 | 63 | 352 | 4.0E-76 |
| sp|A1AWI8|LIPA_RUTMC | Lipoyl synthase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=lipA PE=3 SV=1 | 66 | 350 | 5.0E-76 |
| sp|A5FNF9|LIPA_FLAJ1 | Lipoyl synthase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=lipA PE=3 SV=1 | 63 | 350 | 6.0E-76 |
| sp|A6GZL9|LIPA_FLAPJ | Lipoyl synthase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=lipA PE=3 SV=1 | 66 | 350 | 6.0E-76 |
| sp|A5EVQ3|LIPA_DICNV | Lipoyl synthase OS=Dichelobacter nodosus (strain VCS1703A) GN=lipA PE=3 SV=1 | 66 | 350 | 7.0E-76 |
| sp|A0M4W4|LIPA_GRAFK | Lipoyl synthase OS=Gramella forsetii (strain KT0803) GN=lipA PE=3 SV=1 | 66 | 350 | 1.0E-75 |
| sp|Q1GGW2|LIPA_RUEST | Lipoyl synthase OS=Ruegeria sp. (strain TM1040) GN=lipA PE=3 SV=2 | 63 | 354 | 1.0E-75 |
| sp|A4YUR5|LIPA_BRASO | Lipoyl synthase OS=Bradyrhizobium sp. (strain ORS278) GN=lipA PE=3 SV=1 | 59 | 354 | 2.0E-75 |
| sp|Q8YXD1|LIPA2_NOSS1 | Lipoyl synthase 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=lipA2 PE=3 SV=1 | 65 | 352 | 3.0E-75 |
| sp|A4SJV5|LIPA_AERS4 | Lipoyl synthase OS=Aeromonas salmonicida (strain A449) GN=lipA PE=3 SV=1 | 64 | 350 | 4.0E-75 |
| sp|A5V2U6|LIPA_SPHWW | Lipoyl synthase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=lipA PE=3 SV=1 | 52 | 356 | 5.0E-75 |
| sp|A6V0B4|LIPA_PSEA7 | Lipoyl synthase OS=Pseudomonas aeruginosa (strain PA7) GN=lipA PE=3 SV=2 | 63 | 352 | 5.0E-75 |
| sp|Q2RT68|LIPA_RHORT | Lipoyl synthase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=lipA PE=3 SV=1 | 59 | 369 | 5.0E-75 |
| sp|A5VQP8|LIPA_BRUO2 | Lipoyl synthase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=lipA PE=3 SV=1 | 66 | 354 | 5.0E-75 |
| sp|A0KNA3|LIPA_AERHH | Lipoyl synthase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=lipA PE=3 SV=1 | 64 | 350 | 6.0E-75 |
| sp|A6X0M7|LIPA_OCHA4 | Lipoyl synthase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=lipA PE=3 SV=1 | 66 | 354 | 6.0E-75 |
| sp|A8I4L8|LIPA_AZOC5 | Lipoyl synthase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=lipA PE=3 SV=1 | 64 | 354 | 1.0E-74 |
| sp|Q9HX25|LIPA_PSEAE | Lipoyl synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lipA PE=3 SV=1 | 63 | 352 | 1.0E-74 |
| sp|Q02SG3|LIPA_PSEAB | Lipoyl synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=lipA PE=3 SV=1 | 63 | 352 | 1.0E-74 |
| sp|B7V9C1|LIPA_PSEA8 | Lipoyl synthase OS=Pseudomonas aeruginosa (strain LESB58) GN=lipA PE=3 SV=1 | 63 | 352 | 1.0E-74 |
| sp|Q7NLU2|LIPA1_GLOVI | Lipoyl synthase 1 OS=Gloeobacter violaceus (strain PCC 7421) GN=lipA1 PE=3 SV=1 | 66 | 360 | 1.0E-74 |
| sp|B4RBV1|LIPA_PHEZH | Lipoyl synthase OS=Phenylobacterium zucineum (strain HLK1) GN=lipA PE=3 SV=1 | 64 | 354 | 1.0E-74 |
| sp|Q4ZN84|LIPA_PSEU2 | Lipoyl synthase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=lipA PE=3 SV=1 | 63 | 352 | 1.0E-74 |
| sp|Q48DM6|LIPA_PSE14 | Lipoyl synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=lipA PE=3 SV=1 | 63 | 352 | 1.0E-74 |
| sp|A1B1T3|LIPA_PARDP | Lipoyl synthase OS=Paracoccus denitrificans (strain Pd 1222) GN=lipA PE=3 SV=1 | 63 | 356 | 2.0E-74 |
| sp|Q0BSW6|LIPA_GRABC | Lipoyl synthase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=lipA PE=3 SV=2 | 59 | 369 | 2.0E-74 |
| sp|Q9PDW0|LIPA_XYLFA | Lipoyl synthase OS=Xylella fastidiosa (strain 9a5c) GN=lipA PE=3 SV=3 | 64 | 350 | 2.0E-74 |
| sp|Q0APQ9|LIPA_MARMM | Lipoyl synthase OS=Maricaulis maris (strain MCS10) GN=lipA PE=3 SV=1 | 64 | 354 | 2.0E-74 |
| sp|Q82UJ5|LIPA_NITEU | Lipoyl synthase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=lipA PE=3 SV=1 | 64 | 352 | 3.0E-74 |
| sp|B0U641|LIPA_XYLFM | Lipoyl synthase OS=Xylella fastidiosa (strain M12) GN=lipA PE=3 SV=1 | 64 | 350 | 3.0E-74 |
| sp|A5EIM5|LIPA_BRASB | Lipoyl synthase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=lipA PE=3 SV=1 | 59 | 354 | 3.0E-74 |
| sp|Q87DZ9|LIPA_XYLFT | Lipoyl synthase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=lipA PE=3 SV=1 | 64 | 350 | 3.0E-74 |
| sp|B2I923|LIPA_XYLF2 | Lipoyl synthase OS=Xylella fastidiosa (strain M23) GN=lipA PE=3 SV=1 | 64 | 350 | 3.0E-74 |
| sp|A1S8U1|LIPA_SHEAM | Lipoyl synthase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=lipA PE=3 SV=1 | 64 | 350 | 4.0E-74 |
| sp|Q0AI05|LIPA_NITEC | Lipoyl synthase OS=Nitrosomonas eutropha (strain C91) GN=lipA PE=3 SV=1 | 64 | 352 | 4.0E-74 |
| sp|B1X4X1|LIPA_PAUCH | Lipoyl synthase, organellar chromatophore OS=Paulinella chromatophora GN=PCC_0559 PE=3 SV=1 | 66 | 360 | 4.0E-74 |
| sp|Q87VW7|LIPA_PSESM | Lipoyl synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=lipA PE=3 SV=1 | 63 | 352 | 5.0E-74 |
| sp|Q07MZ5|LIPA_RHOP5 | Lipoyl synthase OS=Rhodopseudomonas palustris (strain BisA53) GN=lipA PE=3 SV=1 | 59 | 351 | 8.0E-74 |
| sp|B3H2J0|LIPA_ACTP7 | Lipoyl synthase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=lipA PE=3 SV=1 | 66 | 350 | 9.0E-74 |
| sp|A3N2P1|LIPA_ACTP2 | Lipoyl synthase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=lipA PE=3 SV=1 | 66 | 350 | 9.0E-74 |
| sp|Q98MY2|LIPA_RHILO | Lipoyl synthase OS=Rhizobium loti (strain MAFF303099) GN=lipA PE=3 SV=1 | 64 | 354 | 1.0E-73 |
| sp|Q5LGU6|LIPA_BACFN | Lipoyl synthase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=lipA PE=3 SV=1 | 57 | 350 | 1.0E-73 |
| sp|Q1I4G1|LIPA_PSEE4 | Lipoyl synthase OS=Pseudomonas entomophila (strain L48) GN=lipA PE=3 SV=1 | 63 | 352 | 1.0E-73 |
| sp|Q6ARK0|LIPA_DESPS | Lipoyl synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=lipA PE=3 SV=1 | 66 | 354 | 1.0E-73 |
| sp|B1J144|LIPA_PSEPW | Lipoyl synthase OS=Pseudomonas putida (strain W619) GN=lipA PE=3 SV=1 | 63 | 352 | 2.0E-73 |
| sp|Q8P590|LIPA_XANCP | Lipoyl synthase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=lipA PE=3 SV=1 | 47 | 350 | 2.0E-73 |
| sp|Q4UYT2|LIPA_XANC8 | Lipoyl synthase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=lipA PE=3 SV=1 | 47 | 350 | 2.0E-73 |
| sp|Q64XQ0|LIPA_BACFR | Lipoyl synthase OS=Bacteroides fragilis (strain YCH46) GN=lipA PE=3 SV=1 | 57 | 350 | 2.0E-73 |
| sp|Q7W0K8|LIPA_BORPE | Lipoyl synthase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=lipA PE=3 SV=1 | 66 | 352 | 2.0E-73 |
| sp|Q7WR00|LIPA_BORBR | Lipoyl synthase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=lipA PE=3 SV=1 | 66 | 352 | 2.0E-73 |
| sp|Q1GYC1|LIPA_METFK | Lipoyl synthase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=lipA PE=3 SV=1 | 64 | 350 | 2.0E-73 |
| sp|Q88DM5|LIPA_PSEPK | Lipoyl synthase OS=Pseudomonas putida (strain KT2440) GN=lipA PE=3 SV=1 | 63 | 352 | 2.0E-73 |
| sp|A5W9I5|LIPA_PSEP1 | Lipoyl synthase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=lipA PE=3 SV=1 | 63 | 352 | 2.0E-73 |
| sp|Q3SM23|LIPA_THIDA | Lipoyl synthase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=lipA PE=3 SV=1 | 64 | 348 | 2.0E-73 |
| sp|B4EV01|LIPA_PROMH | Lipoyl synthase OS=Proteus mirabilis (strain HI4320) GN=lipA PE=3 SV=1 | 64 | 350 | 2.0E-73 |
| sp|Q7V507|LIPA1_PROMM | Lipoyl synthase 1 OS=Prochlorococcus marinus (strain MIT 9313) GN=lipA1 PE=3 SV=1 | 66 | 352 | 2.0E-73 |
| sp|Q8DLC2|LIPA2_THEEB | Lipoyl synthase 2 OS=Thermosynechococcus elongatus (strain BP-1) GN=lipA2 PE=1 SV=1 | 65 | 352 | 2.0E-73 |
| sp|Q3SSP1|LIPA_NITWN | Lipoyl synthase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=lipA PE=3 SV=1 | 63 | 354 | 2.0E-73 |
| sp|B1VHG8|LIPA_CORU7 | Lipoyl synthase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=lipA PE=3 SV=1 | 66 | 358 | 3.0E-73 |
| sp|Q7W222|LIPA_BORPA | Lipoyl synthase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=lipA PE=3 SV=1 | 66 | 352 | 3.0E-73 |
| sp|B0RNP9|LIPA_XANCB | Lipoyl synthase OS=Xanthomonas campestris pv. campestris (strain B100) GN=lipA PE=3 SV=1 | 47 | 350 | 3.0E-73 |
| sp|Q2SA38|LIPA_HAHCH | Lipoyl synthase OS=Hahella chejuensis (strain KCTC 2396) GN=lipA PE=3 SV=1 | 56 | 350 | 5.0E-73 |
| sp|Q6LN87|LIPA_PHOPR | Lipoyl synthase OS=Photobacterium profundum GN=lipA PE=3 SV=1 | 64 | 350 | 6.0E-73 |
| sp|Q8PPL8|LIPA_XANAC | Lipoyl synthase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=lipA PE=3 SV=1 | 47 | 350 | 6.0E-73 |
| sp|Q3BXQ3|LIPA_XANC5 | Lipoyl synthase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=lipA PE=3 SV=1 | 47 | 350 | 6.0E-73 |
| sp|Q1QCS6|LIPA_PSYCK | Lipoyl synthase OS=Psychrobacter cryohalolentis (strain K5) GN=lipA PE=3 SV=1 | 56 | 354 | 7.0E-73 |
| sp|B9JW84|LIPA_AGRVS | Lipoyl synthase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=lipA PE=3 SV=1 | 64 | 354 | 7.0E-73 |
| sp|Q6MEX3|LIPA_PARUW | Lipoyl synthase OS=Protochlamydia amoebophila (strain UWE25) GN=lipA PE=3 SV=1 | 64 | 367 | 8.0E-73 |
| sp|Q4FTQ5|LIPA_PSYA2 | Lipoyl synthase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=lipA PE=3 SV=1 | 56 | 354 | 8.0E-73 |
| sp|Q5GVR7|LIPA_XANOR | Lipoyl synthase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=lipA PE=3 SV=1 | 47 | 350 | 9.0E-73 |
| sp|Q2NYZ2|LIPA_XANOM | Lipoyl synthase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=lipA PE=3 SV=1 | 47 | 350 | 9.0E-73 |
| sp|Q11HV6|LIPA_CHESB | Lipoyl synthase OS=Chelativorans sp. (strain BNC1) GN=lipA PE=3 SV=1 | 64 | 354 | 1.0E-72 |
| sp|Q3B3Y5|LIPA_CHLL7 | Lipoyl synthase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=lipA PE=3 SV=1 | 63 | 345 | 1.0E-72 |
| sp|A3QH60|LIPA_SHELP | Lipoyl synthase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=lipA PE=3 SV=1 | 64 | 350 | 1.0E-72 |
| sp|A8H7D5|LIPA_SHEPA | Lipoyl synthase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=lipA PE=3 SV=1 | 64 | 350 | 2.0E-72 |
| sp|Q2L1D8|LIPA_BORA1 | Lipoyl synthase OS=Bordetella avium (strain 197N) GN=lipA PE=3 SV=1 | 66 | 352 | 2.0E-72 |
| sp|Q8D325|LIPA_WIGBR | Lipoyl synthase OS=Wigglesworthia glossinidia brevipalpis GN=lipA PE=3 SV=1 | 59 | 350 | 2.0E-72 |
| sp|A8FZ23|LIPA_SHESH | Lipoyl synthase OS=Shewanella sediminis (strain HAW-EB3) GN=lipA PE=3 SV=1 | 64 | 350 | 2.0E-72 |
| sp|Q3ARP5|LIPA_CHLCH | Lipoyl synthase OS=Chlorobium chlorochromatii (strain CaD3) GN=lipA PE=3 SV=2 | 64 | 353 | 3.0E-72 |
| sp|Q7VKB1|LIPA_HAEDU | Lipoyl synthase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=lipA PE=3 SV=1 | 66 | 350 | 3.0E-72 |
| sp|Q256D6|LIPA_CHLFF | Lipoyl synthase OS=Chlamydophila felis (strain Fe/C-56) GN=lipA PE=3 SV=1 | 58 | 358 | 4.0E-72 |
| sp|B0BRR9|LIPA_ACTPJ | Lipoyl synthase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=lipA PE=3 SV=1 | 66 | 350 | 5.0E-72 |
| sp|B3QIL2|LIPA_RHOPT | Lipoyl synthase OS=Rhodopseudomonas palustris (strain TIE-1) GN=lipA PE=3 SV=1 | 63 | 354 | 5.0E-72 |
| sp|P61198|LIPA_RHOPA | Lipoyl synthase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=lipA PE=3 SV=1 | 63 | 354 | 5.0E-72 |
| sp|Q7V6S0|LIPA2_PROMM | Lipoyl synthase 2 OS=Prochlorococcus marinus (strain MIT 9313) GN=lipA2 PE=3 SV=1 | 64 | 352 | 5.0E-72 |
| sp|A9W6I4|LIPA_METEP | Lipoyl synthase OS=Methylobacterium extorquens (strain PA1) GN=lipA PE=3 SV=1 | 59 | 354 | 5.0E-72 |
| sp|B8GMV6|LIPA_THISH | Lipoyl synthase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=lipA PE=3 SV=1 | 64 | 352 | 5.0E-72 |
| sp|Q31F42|LIPA_THICR | Lipoyl synthase OS=Thiomicrospira crunogena (strain XCL-2) GN=lipA PE=3 SV=2 | 59 | 350 | 6.0E-72 |
| sp|Q214R4|LIPA_RHOPB | Lipoyl synthase OS=Rhodopseudomonas palustris (strain BisB18) GN=lipA PE=3 SV=1 | 59 | 354 | 6.0E-72 |
| sp|Q1QMA2|LIPA_NITHX | Lipoyl synthase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=lipA PE=3 SV=1 | 63 | 354 | 6.0E-72 |
| sp|Q1LTM3|LIPA_BAUCH | Lipoyl synthase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=lipA PE=3 SV=1 | 66 | 350 | 6.0E-72 |
| sp|Q9RNY7|LIPA_ZYMMO | Lipoyl synthase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=lipA PE=3 SV=2 | 64 | 351 | 7.0E-72 |
| sp|Q8YWC1|LIPA1_NOSS1 | Lipoyl synthase 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=lipA1 PE=3 SV=1 | 66 | 352 | 8.0E-72 |
| sp|Q6G401|LIPA_BARHE | Lipoyl synthase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=lipA PE=3 SV=1 | 59 | 354 | 8.0E-72 |
| sp|Q087L5|LIPA_SHEFN | Lipoyl synthase OS=Shewanella frigidimarina (strain NCIMB 400) GN=lipA PE=3 SV=1 | 64 | 350 | 8.0E-72 |
| sp|Q2J897|LIPA_FRASC | Lipoyl synthase OS=Frankia sp. (strain CcI3) GN=lipA PE=3 SV=1 | 54 | 358 | 9.0E-72 |
| sp|Q137C6|LIPA_RHOPS | Lipoyl synthase OS=Rhodopseudomonas palustris (strain BisB5) GN=lipA PE=3 SV=1 | 59 | 354 | 9.0E-72 |
| sp|C5BGD9|LIPA_EDWI9 | Lipoyl synthase OS=Edwardsiella ictaluri (strain 93-146) GN=lipA PE=3 SV=1 | 64 | 350 | 1.0E-71 |
| sp|B7KRC9|LIPA_METC4 | Lipoyl synthase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=lipA PE=3 SV=1 | 59 | 354 | 1.0E-71 |
| sp|A6L1U8|LIPA_BACV8 | Lipoyl synthase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=lipA PE=3 SV=1 | 66 | 350 | 1.0E-71 |
| sp|Q2IW20|LIPA_RHOP2 | Lipoyl synthase OS=Rhodopseudomonas palustris (strain HaA2) GN=lipA PE=3 SV=1 | 63 | 354 | 1.0E-71 |
| sp|A0PNH7|LIPA_MYCUA | Lipoyl synthase OS=Mycobacterium ulcerans (strain Agy99) GN=lipA PE=3 SV=1 | 54 | 364 | 1.0E-71 |
| sp|B2HHL4|LIPA_MYCMM | Lipoyl synthase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=lipA PE=3 SV=1 | 54 | 364 | 1.0E-71 |
| sp|B0TR57|LIPA_SHEHH | Lipoyl synthase OS=Shewanella halifaxensis (strain HAW-EB4) GN=lipA PE=3 SV=1 | 64 | 350 | 1.0E-71 |
| sp|A6U8F5|LIPA_SINMW | Lipoyl synthase OS=Sinorhizobium medicae (strain WSM419) GN=lipA PE=3 SV=1 | 64 | 354 | 1.0E-71 |
| sp|B5EMR4|LIPA_ACIF5 | Lipoyl synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=lipA PE=3 SV=1 | 66 | 356 | 1.0E-71 |
| sp|B7J7N7|LIPA_ACIF2 | Lipoyl synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=lipA PE=3 SV=1 | 66 | 356 | 1.0E-71 |
| sp|Q8UFG1|LIPA_AGRFC | Lipoyl synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=lipA PE=3 SV=1 | 64 | 354 | 1.0E-71 |
| sp|Q6D7M8|LIPA_PECAS | Lipoyl synthase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=lipA PE=3 SV=1 | 64 | 350 | 2.0E-71 |
| sp|A9L014|LIPA_SHEB9 | Lipoyl synthase OS=Shewanella baltica (strain OS195) GN=lipA PE=3 SV=1 | 64 | 350 | 2.0E-71 |
| sp|A3D7P9|LIPA_SHEB5 | Lipoyl synthase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=lipA PE=3 SV=1 | 64 | 350 | 2.0E-71 |
| sp|B8E4W4|LIPA_SHEB2 | Lipoyl synthase OS=Shewanella baltica (strain OS223) GN=lipA PE=3 SV=1 | 64 | 350 | 2.0E-71 |
| sp|B2RKU2|LIPA_PORG3 | Lipoyl synthase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=lipA PE=3 SV=1 | 66 | 350 | 2.0E-71 |
| sp|A4J247|LIPA_DESRM | Lipoyl synthase OS=Desulfotomaculum reducens (strain MI-1) GN=lipA PE=3 SV=1 | 64 | 352 | 2.0E-71 |
| sp|Q7MWT4|LIPA_PORGI | Lipoyl synthase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=lipA PE=3 SV=1 | 66 | 350 | 2.0E-71 |
| sp|Q2K8V9|LIPA_RHIEC | Lipoyl synthase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=lipA PE=3 SV=1 | 64 | 354 | 2.0E-71 |
| sp|B1KDX3|LIPA_SHEWM | Lipoyl synthase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=lipA PE=3 SV=1 | 64 | 350 | 2.0E-71 |
| sp|B4SHB4|LIPA_PELPB | Lipoyl synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=lipA PE=3 SV=1 | 66 | 350 | 3.0E-71 |
| sp|P9WK91|LIPA_MYCTU | Lipoyl synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lipA PE=1 SV=1 | 54 | 354 | 3.0E-71 |
| sp|P9WK90|LIPA_MYCTO | Lipoyl synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=lipA PE=3 SV=1 | 54 | 354 | 3.0E-71 |
| sp|A5U4P6|LIPA_MYCTA | Lipoyl synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=lipA PE=3 SV=1 | 54 | 354 | 3.0E-71 |
| sp|C1AQD3|LIPA_MYCBT | Lipoyl synthase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=lipA PE=3 SV=1 | 54 | 354 | 3.0E-71 |
| sp|A1KKR0|LIPA_MYCBP | Lipoyl synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=lipA PE=3 SV=1 | 54 | 354 | 3.0E-71 |
| sp|P65284|LIPA_MYCBO | Lipoyl synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=lipA PE=3 SV=1 | 54 | 354 | 3.0E-71 |
| sp|B2VBK1|LIPA_ERWT9 | Lipoyl synthase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=lipA PE=3 SV=1 | 55 | 350 | 3.0E-71 |
| sp|Q57390|LIPA_PELCD | Lipoyl synthase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=lipA PE=3 SV=2 | 66 | 350 | 3.0E-71 |
| sp|Q7MN17|LIPA_VIBVY | Lipoyl synthase OS=Vibrio vulnificus (strain YJ016) GN=lipA PE=3 SV=1 | 64 | 350 | 3.0E-71 |
| sp|Q8DFD1|LIPA_VIBVU | Lipoyl synthase OS=Vibrio vulnificus (strain CMCP6) GN=lipA PE=3 SV=1 | 64 | 350 | 3.0E-71 |
| sp|A8GB09|LIPA_SERP5 | Lipoyl synthase OS=Serratia proteamaculans (strain 568) GN=lipA PE=3 SV=1 | 64 | 350 | 4.0E-71 |
| sp|Q0HLK3|LIPA_SHESM | Lipoyl synthase OS=Shewanella sp. (strain MR-4) GN=lipA PE=3 SV=1 | 64 | 350 | 4.0E-71 |
| sp|A0KTV4|LIPA_SHESA | Lipoyl synthase OS=Shewanella sp. (strain ANA-3) GN=lipA PE=3 SV=1 | 64 | 350 | 4.0E-71 |
| sp|B4RLK9|LIPA_NEIG2 | Lipoyl synthase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=lipA PE=3 SV=1 | 66 | 364 | 4.0E-71 |
| sp|Q5F8I0|LIPA_NEIG1 | Lipoyl synthase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=lipA PE=3 SV=1 | 66 | 364 | 4.0E-71 |
| sp|A7MY96|LIPA_VIBCB | Lipoyl synthase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=lipA PE=3 SV=1 | 64 | 350 | 4.0E-71 |
| sp|B2FUS8|LIPA_STRMK | Lipoyl synthase OS=Stenotrophomonas maltophilia (strain K279a) GN=lipA PE=3 SV=1 | 47 | 350 | 4.0E-71 |
| sp|A1RGT2|LIPA_SHESW | Lipoyl synthase OS=Shewanella sp. (strain W3-18-1) GN=lipA PE=3 SV=1 | 64 | 350 | 4.0E-71 |
| sp|A4Y9G2|LIPA_SHEPC | Lipoyl synthase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=lipA PE=3 SV=1 | 64 | 350 | 4.0E-71 |
| sp|B1ZEL4|LIPA_METPB | Lipoyl synthase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=lipA PE=3 SV=1 | 59 | 354 | 4.0E-71 |
| sp|B3PYS0|LIPA_RHIE6 | Lipoyl synthase OS=Rhizobium etli (strain CIAT 652) GN=lipA PE=3 SV=1 | 64 | 354 | 5.0E-71 |
| sp|A6LE09|LIPA_PARD8 | Lipoyl synthase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=lipA PE=3 SV=1 | 64 | 350 | 5.0E-71 |
| sp|Q0HXV7|LIPA_SHESR | Lipoyl synthase OS=Shewanella sp. (strain MR-7) GN=lipA PE=3 SV=1 | 64 | 350 | 5.0E-71 |
| sp|B5ZNB1|LIPA_RHILW | Lipoyl synthase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=lipA PE=3 SV=1 | 64 | 354 | 5.0E-71 |
| sp|Q12QX1|LIPA_SHEDO | Lipoyl synthase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=lipA PE=3 SV=1 | 64 | 350 | 5.0E-71 |
| sp|Q1MH26|LIPA_RHIL3 | Lipoyl synthase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=lipA PE=3 SV=1 | 64 | 354 | 6.0E-71 |
| sp|O32962|LIPA_MYCLE | Lipoyl synthase OS=Mycobacterium leprae (strain TN) GN=lipA PE=3 SV=1 | 54 | 354 | 6.0E-71 |
| sp|B8ZQJ9|LIPA_MYCLB | Lipoyl synthase OS=Mycobacterium leprae (strain Br4923) GN=lipA PE=3 SV=1 | 54 | 354 | 6.0E-71 |
| sp|B4SJ16|LIPA_STRM5 | Lipoyl synthase OS=Stenotrophomonas maltophilia (strain R551-3) GN=lipA PE=3 SV=1 | 47 | 350 | 6.0E-71 |
| sp|A5GW06|LIPA_SYNR3 | Lipoyl synthase OS=Synechococcus sp. (strain RCC307) GN=lipA PE=3 SV=1 | 66 | 352 | 6.0E-71 |
| sp|Q2NUV8|LIPA_SODGM | Lipoyl synthase OS=Sodalis glossinidius (strain morsitans) GN=lipA PE=3 SV=1 | 64 | 350 | 7.0E-71 |
| sp|B8CSH7|LIPA_SHEPW | Lipoyl synthase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=lipA PE=3 SV=1 | 64 | 350 | 7.0E-71 |
| sp|Q9JUC8|LIPA_NEIMA | Lipoyl synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=lipA PE=3 SV=1 | 66 | 364 | 7.0E-71 |
| sp|A5G2D2|LIPA_ACICJ | Lipoyl synthase OS=Acidiphilium cryptum (strain JF-5) GN=lipA PE=3 SV=1 | 64 | 350 | 7.0E-71 |
| sp|C6DBV6|LIPA_PECCP | Lipoyl synthase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=lipA PE=3 SV=1 | 64 | 350 | 7.0E-71 |
| sp|Q92Q94|LIPA_RHIME | Lipoyl synthase OS=Rhizobium meliloti (strain 1021) GN=lipA PE=3 SV=1 | 64 | 354 | 7.0E-71 |
| sp|Q9KTF9|LIPA_VIBCH | Lipoyl synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=lipA PE=3 SV=1 | 64 | 350 | 8.0E-71 |
| sp|B9JEZ6|LIPA_AGRRK | Lipoyl synthase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=lipA PE=3 SV=1 | 64 | 375 | 8.0E-71 |
| sp|Q9JZA5|LIPA_NEIMB | Lipoyl synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=lipA PE=3 SV=1 | 66 | 364 | 9.0E-71 |
| sp|A9IS79|LIPA_BART1 | Lipoyl synthase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=lipA PE=3 SV=1 | 59 | 354 | 9.0E-71 |
| sp|Q8EHQ6|LIPA_SHEON | Lipoyl synthase OS=Shewanella oneidensis (strain MR-1) GN=lipA PE=3 SV=1 | 64 | 350 | 1.0E-70 |
| sp|Q7U4D9|LIPA1_SYNPX | Lipoyl synthase 1 OS=Synechococcus sp. (strain WH8102) GN=lipA1 PE=3 SV=1 | 66 | 352 | 1.0E-70 |
| sp|Q7N767|LIPA_PHOLL | Lipoyl synthase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=lipA PE=3 SV=1 | 64 | 350 | 1.0E-70 |
| sp|A9LZ95|LIPA_NEIM0 | Lipoyl synthase OS=Neisseria meningitidis serogroup C (strain 053442) GN=lipA PE=3 SV=1 | 66 | 358 | 1.0E-70 |
| sp|C3LTJ1|LIPA_VIBCM | Lipoyl synthase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=lipA PE=3 SV=1 | 64 | 350 | 1.0E-70 |
| sp|A5F2Y0|LIPA_VIBC3 | Lipoyl synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=lipA PE=3 SV=1 | 64 | 350 | 1.0E-70 |
| sp|B1LWN4|LIPA_METRJ | Lipoyl synthase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=lipA PE=3 SV=1 | 66 | 354 | 1.0E-70 |
| sp|P72980|LIPA1_SYNY3 | Lipoyl synthase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=lipA1 PE=3 SV=1 | 66 | 352 | 2.0E-70 |
| sp|Q3IJ81|LIPA_PSEHT | Lipoyl synthase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=lipA PE=3 SV=1 | 64 | 352 | 2.0E-70 |
| sp|A1JPR9|LIPA_YERE8 | Lipoyl synthase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=lipA PE=3 SV=1 | 64 | 350 | 2.0E-70 |
| sp|A6T689|LIPA_KLEP7 | Lipoyl synthase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=lipA PE=3 SV=1 | 64 | 350 | 2.0E-70 |
| sp|B5XZS6|LIPA_KLEP3 | Lipoyl synthase OS=Klebsiella pneumoniae (strain 342) GN=lipA PE=3 SV=1 | 64 | 350 | 2.0E-70 |
| sp|Q6G166|LIPA_BARQU | Lipoyl synthase OS=Bartonella quintana (strain Toulouse) GN=lipA PE=3 SV=1 | 59 | 352 | 3.0E-70 |
| sp|A8Z609|LIPA_SULMW | Lipoyl synthase OS=Sulcia muelleri (strain GWSS) GN=lipA PE=3 SV=1 | 66 | 350 | 3.0E-70 |
| sp|Q3J7W4|LIPA_NITOC | Lipoyl synthase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=lipA PE=3 SV=1 | 64 | 350 | 3.0E-70 |
| sp|A4FA70|LIPA_SACEN | Lipoyl synthase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=lipA PE=3 SV=2 | 54 | 354 | 3.0E-70 |
| sp|B3ECK5|LIPA_CHLL2 | Lipoyl synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=lipA PE=3 SV=1 | 66 | 353 | 3.0E-70 |
| sp|Q7VBJ3|LIPA2_PROMA | Lipoyl synthase 2 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=lipA2 PE=3 SV=1 | 64 | 350 | 4.0E-70 |
| sp|B0SQ03|LIPA_LEPBP | Lipoyl synthase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=lipA PE=3 SV=1 | 59 | 356 | 4.0E-70 |
| sp|B0SGV6|LIPA_LEPBA | Lipoyl synthase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=lipA PE=3 SV=1 | 59 | 356 | 4.0E-70 |
| sp|A6WRL2|LIPA_SHEB8 | Lipoyl synthase OS=Shewanella baltica (strain OS185) GN=lipA PE=3 SV=1 | 64 | 350 | 5.0E-70 |
| sp|Q87RR1|LIPA_VIBPA | Lipoyl synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=lipA PE=3 SV=1 | 64 | 350 | 5.0E-70 |
| sp|Q0RFE8|LIPA_FRAAA | Lipoyl synthase OS=Frankia alni (strain ACN14a) GN=lipA PE=3 SV=1 | 64 | 358 | 6.0E-70 |
| sp|C5CCN0|LIPA_MICLC | Lipoyl synthase OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=lipA PE=3 SV=1 | 64 | 360 | 6.0E-70 |
| sp|A8G714|LIPA_PROM2 | Lipoyl synthase OS=Prochlorococcus marinus (strain MIT 9215) GN=lipA PE=3 SV=1 | 66 | 360 | 7.0E-70 |
| sp|Q5QYE5|LIPA_IDILO | Lipoyl synthase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=lipA PE=3 SV=2 | 64 | 350 | 7.0E-70 |
| sp|B8IDD6|LIPA_METNO | Lipoyl synthase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=lipA PE=3 SV=1 | 64 | 351 | 8.0E-70 |
| sp|Q5FNM1|LIPA_GLUOX | Lipoyl synthase OS=Gluconobacter oxydans (strain 621H) GN=lipA PE=3 SV=1 | 64 | 350 | 8.0E-70 |
| sp|Q3Z4G4|LIPA_SHISS | Lipoyl synthase OS=Shigella sonnei (strain Ss046) GN=lipA PE=3 SV=1 | 64 | 350 | 9.0E-70 |
| sp|P60719|LIPA_SHIFL | Lipoyl synthase OS=Shigella flexneri GN=lipA PE=3 SV=1 | 64 | 350 | 9.0E-70 |
| sp|Q0T6N8|LIPA_SHIF8 | Lipoyl synthase OS=Shigella flexneri serotype 5b (strain 8401) GN=lipA PE=3 SV=2 | 64 | 350 | 9.0E-70 |
| sp|Q32IV2|LIPA_SHIDS | Lipoyl synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=lipA PE=3 SV=1 | 64 | 350 | 9.0E-70 |
| sp|Q324R5|LIPA_SHIBS | Lipoyl synthase OS=Shigella boydii serotype 4 (strain Sb227) GN=lipA PE=3 SV=1 | 64 | 350 | 9.0E-70 |
| sp|Q1RET3|LIPA_ECOUT | Lipoyl synthase OS=Escherichia coli (strain UTI89 / UPEC) GN=lipA PE=3 SV=1 | 64 | 350 | 9.0E-70 |
| sp|B1LKL9|LIPA_ECOSM | Lipoyl synthase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=lipA PE=3 SV=1 | 64 | 350 | 9.0E-70 |
| sp|B6I137|LIPA_ECOSE | Lipoyl synthase OS=Escherichia coli (strain SE11) GN=lipA PE=3 SV=1 | 64 | 350 | 9.0E-70 |
| sp|B7N9N3|LIPA_ECOLU | Lipoyl synthase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=lipA PE=3 SV=1 | 64 | 350 | 9.0E-70 |
| sp|P60716|LIPA_ECOLI | Lipoyl synthase OS=Escherichia coli (strain K12) GN=lipA PE=1 SV=1 | 64 | 350 | 9.0E-70 |
| sp|B1IYI0|LIPA_ECOLC | Lipoyl synthase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=lipA PE=3 SV=1 | 64 | 350 | 9.0E-70 |
| sp|P60717|LIPA_ECOL6 | Lipoyl synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lipA PE=3 SV=1 | 64 | 350 | 9.0E-70 |
| sp|Q0TK45|LIPA_ECOL5 | Lipoyl synthase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=lipA PE=3 SV=1 | 64 | 350 | 9.0E-70 |
| sp|A1A8Q3|LIPA_ECOK1 | Lipoyl synthase OS=Escherichia coli O1:K1 / APEC GN=lipA PE=3 SV=1 | 64 | 350 | 9.0E-70 |
| sp|A7ZXQ4|LIPA_ECOHS | Lipoyl synthase OS=Escherichia coli O9:H4 (strain HS) GN=lipA PE=3 SV=1 | 64 | 350 | 9.0E-70 |
| sp|C4ZWB5|LIPA_ECOBW | Lipoyl synthase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=lipA PE=3 SV=1 | 64 | 350 | 9.0E-70 |
| sp|B7M5F5|LIPA_ECO8A | Lipoyl synthase OS=Escherichia coli O8 (strain IAI1) GN=lipA PE=3 SV=1 | 64 | 350 | 9.0E-70 |
| sp|B7MRR5|LIPA_ECO81 | Lipoyl synthase OS=Escherichia coli O81 (strain ED1a) GN=lipA PE=3 SV=1 | 64 | 350 | 9.0E-70 |
| sp|B7NLY7|LIPA_ECO7I | Lipoyl synthase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=lipA PE=3 SV=1 | 64 | 350 | 9.0E-70 |
| sp|B5YQH9|LIPA_ECO5E | Lipoyl synthase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=lipA PE=3 SV=1 | 64 | 350 | 9.0E-70 |
| sp|P60718|LIPA_ECO57 | Lipoyl synthase OS=Escherichia coli O157:H7 GN=lipA PE=3 SV=1 | 64 | 350 | 9.0E-70 |
| sp|B7L9H2|LIPA_ECO55 | Lipoyl synthase OS=Escherichia coli (strain 55989 / EAEC) GN=lipA PE=3 SV=1 | 64 | 350 | 9.0E-70 |
| sp|B7MFQ1|LIPA_ECO45 | Lipoyl synthase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=lipA PE=3 SV=1 | 64 | 350 | 9.0E-70 |
| sp|B7UKR9|LIPA_ECO27 | Lipoyl synthase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=lipA PE=3 SV=1 | 64 | 350 | 9.0E-70 |
| sp|A7ZJ15|LIPA_ECO24 | Lipoyl synthase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=lipA PE=3 SV=1 | 64 | 350 | 9.0E-70 |
| sp|A6WD63|LIPA_KINRD | Lipoyl synthase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=lipA PE=3 SV=1 | 54 | 360 | 1.0E-69 |
| sp|B2TTI9|LIPA_SHIB3 | Lipoyl synthase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=lipA PE=3 SV=1 | 64 | 350 | 1.0E-69 |
| sp|Q4FM35|LIPA_PELUB | Lipoyl synthase OS=Pelagibacter ubique (strain HTCC1062) GN=lipA PE=3 SV=1 | 66 | 352 | 1.0E-69 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0051536 | iron-sulfur cluster binding | Yes |
| GO:0003824 | catalytic activity | Yes |
| GO:0051540 | metal cluster binding | No |
| GO:0005488 | binding | No |
| GO:0003674 | molecular_function | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 19 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Agabi119p4|007660 MFAVLRTINGKIPHCSRALATAANSNATPRSKFSQDLENGPGLDDFITGDASDRIVLGNTTGPRLPSFLKTSIPA GGSYAKIKKDLRGLKLHTVCEEARCPNIGECWGGKADATDAENRRNATATIMLMGDTCTRGCRFCAVKTSRAPSP LDPHEPEHTAEAISRWGLGYIVLTSVDRDDLADGGARHFAETIFKIKQKAPHILVEALTPDFAGNLEHVSIVAKS GLDVYAHNIETTEAMTPYVRDRRATFRGSLSVLDHAKKEGARITKTSIMLGVGETEEEIMDALKELRQVNVDVVT FGQYMRPTKRHMKVDRYVEPAEFNRWKQVAEDMGFLYVASGPLVRSSYKAGEFYIENLLRGKAGERQTKNILSSQ SLEATSADIVNSIT* |
| Coding | >Agabi119p4|007660 ATGTTTGCTGTGTTGCGCACGATTAATGGAAAGATTCCACATTGCTCCCGTGCCCTAGCAACCGCGGCAAATTCA AATGCCACACCTCGTTCCAAATTCAGTCAGGACCTCGAGAATGGACCTGGTTTAGATGACTTCATTACAGGCGAT GCATCAGACCGCATAGTGCTTGGAAATACGACAGGGCCCAGGTTGCCTTCTTTCCTGAAAACATCTATCCCTGCT GGCGGCTCTTATGCCAAAATCAAGAAAGACCTTCGTGGGCTCAAGTTGCACACTGTTTGTGAGGAAGCACGATGT CCTAACATAGGAGAATGTTGGGGCGGAAAGGCCGACGCCACGGATGCGGAGAACCGAAGGAATGCAACAGCTACG ATAATGCTAATGGGCGATACATGTACTCGAGGGTGCCGCTTTTGCGCTGTGAAAACCTCCAGAGCACCTTCCCCT TTGGATCCTCACGAACCGGAGCATACGGCAGAGGCCATAAGTCGGTGGGGTTTGGGCTATATTGTTCTGACGAGT GTAGACCGTGATGACCTTGCCGACGGAGGTGCAAGACATTTTGCAGAGACAATCTTCAAAATCAAGCAAAAGGCC CCTCATATACTCGTAGAAGCGCTAACACCAGACTTTGCCGGAAATCTAGAACACGTATCAATAGTCGCCAAATCT GGCCTTGACGTTTACGCTCATAATATCGAGACTACAGAAGCCATGACGCCTTATGTTCGCGATCGCAGAGCGACT TTCCGAGGAAGTCTGAGTGTGTTGGACCATGCGAAGAAAGAGGGCGCTCGTATCACAAAGACCAGCATAATGCTG GGCGTCGGTGAAACGGAGGAAGAAATAATGGATGCCCTGAAAGAGTTGCGTCAAGTGAATGTTGATGTCGTTACG TTCGGACAATATATGCGCCCCACGAAACGCCACATGAAAGTCGACCGCTACGTTGAACCTGCAGAATTCAATAGG TGGAAGCAAGTGGCTGAAGATATGGGTTTCTTGTATGTTGCTAGTGGCCCACTTGTAAGAAGCAGTTACAAGGCT GGCGAATTCTATATTGAAAACCTACTTCGTGGCAAGGCTGGTGAACGGCAAACTAAAAATATATTGTCCTCGCAA AGTTTGGAAGCAACGTCTGCAGACATCGTGAATTCGATAACATAG |
| Transcript | >Agabi119p4|007660 ATGTTTGCTGTGTTGCGCACGATTAATGGAAAGATTCCACATTGCTCCCGTGCCCTAGCAACCGCGGCAAATTCA AATGCCACACCTCGTTCCAAATTCAGTCAGGACCTCGAGAATGGACCTGGTTTAGATGACTTCATTACAGGCGAT GCATCAGACCGCATAGTGCTTGGAAATACGACAGGGCCCAGGTTGCCTTCTTTCCTGAAAACATCTATCCCTGCT GGCGGCTCTTATGCCAAAATCAAGAAAGACCTTCGTGGGCTCAAGTTGCACACTGTTTGTGAGGAAGCACGATGT CCTAACATAGGAGAATGTTGGGGCGGAAAGGCCGACGCCACGGATGCGGAGAACCGAAGGAATGCAACAGCTACG ATAATGCTAATGGGCGATACATGTACTCGAGGGTGCCGCTTTTGCGCTGTGAAAACCTCCAGAGCACCTTCCCCT TTGGATCCTCACGAACCGGAGCATACGGCAGAGGCCATAAGTCGGTGGGGTTTGGGCTATATTGTTCTGACGAGT GTAGACCGTGATGACCTTGCCGACGGAGGTGCAAGACATTTTGCAGAGACAATCTTCAAAATCAAGCAAAAGGCC CCTCATATACTCGTAGAAGCGCTAACACCAGACTTTGCCGGAAATCTAGAACACGTATCAATAGTCGCCAAATCT GGCCTTGACGTTTACGCTCATAATATCGAGACTACAGAAGCCATGACGCCTTATGTTCGCGATCGCAGAGCGACT TTCCGAGGAAGTCTGAGTGTGTTGGACCATGCGAAGAAAGAGGGCGCTCGTATCACAAAGACCAGCATAATGCTG GGCGTCGGTGAAACGGAGGAAGAAATAATGGATGCCCTGAAAGAGTTGCGTCAAGTGAATGTTGATGTCGTTACG TTCGGACAATATATGCGCCCCACGAAACGCCACATGAAAGTCGACCGCTACGTTGAACCTGCAGAATTCAATAGG TGGAAGCAAGTGGCTGAAGATATGGGTTTCTTGTATGTTGCTAGTGGCCCACTTGTAAGAAGCAGTTACAAGGCT GGCGAATTCTATATTGAAAACCTACTTCGTGGCAAGGCTGGTGAACGGCAAACTAAAAATATATTGTCCTCGCAA AGTTTGGAAGCAACGTCTGCAGACATCGTGAATTCGATAACATAG |
| Gene | >Agabi119p4|007660 ATGTTTGCTGTGTTGCGCACGATTAATGGAAAGATTCCACATTGCTCCCGTGCCCTAGCAACCGCGGCAAATTCA AATGCCACACCTCGTTCCAAATTCAGTCAGGACCTCGAGAATGGACCTGGTTTAGATGACTTCATTACAGGCGAT GCATCAGACCGCATAGTGCTTGGAAATACGACAGGGTAAGGATATCCTTTGTATTATTCTATGCAGATAATGTAT TGCCTCTCTTGATAGGCCCAGGTTGCCTTCTTTCCTGAAAACATCTATCCCTGCTGGCGGCTCTTATGCCAAAAT CAAGAAAGACCTTCGTGGGCTCAAGTTGCACACTGTTTGTGAGGAAGCACGATGTCCTAACATAGGAGAATGTTG GGGCGGAAAGGCCGACGCCACGGATGCGGAGAACCGAAGGAATGCAACAGCTACGATAATGGTGTGTTTGTGTTC TAAGTCGCTGGTGAACTCAAGATTCACATGTTCTAGCTAATGGGCGATACATGTACTCGAGGGTGCCGCTTTTGC GCTGTGAAAACCTCCAGAGCACCTTCCCCTTTGGATCCTCACGAACCGGAGCATACGGCAGAGGCCATAAGTCGG TGGGGTTTGGGCTATATTGTTCTGACGAGTGTAGACCGTGATGGTACGAGTCGGCTATTTCTTGGCCGCTTGCTT TGATCTGATGATATCTTTTTAGACCTTGCCGACGGAGGTGCAAGACATTTTGCAGAGACAATCTTCAAAATCAAG CAAAAGTTTGTCGTGCTACTTGTGGCCGACTCAAATACTTACTGTGTTCAGGGCCCCTCATATACTCGTAGAAGC GCTAACACCAGACTTTGCCGGAAATCTAGAACACGTATCAATAGTCGCCAAATCTGGCCTTGACGTTTACGCTCA TAATATCGAGACTACAGAAGCCATGACGCCTTATGTTCGCGATCGCAGAGCGACTTTCCGAGGAAGTCTGAGTGT GTTGGACCATGCGAAGAAAGAGGGCGCTCGTATCACAAAGACCAGCATAATGCTGGGCGTCGGTGAAACGGAGGA AGAAATAATGGATGCCCTGAAAGGTACGTGGACCCATAATTGTTTTCTATAGCGGCTTTATCCATCTACCGATTC AGAGTTGCGTCAAGTGAATGTTGATGTCGTTACGTTCGGACAATATATGCGCCCCACGAAACGCCACATGAAAGT CGACCGCTACGTTGAACCTGCAGAATTCAATAGGTGGAAGCAAGTGGCTGAAGATATGGGTTTCTTGTATGTTGC TAGTGGCCCACTTGTAAGAAGCAGTTACAAGGTTAGTTCCTTTGAGTTACTCCGAACTCCTTGTCTTACCATAAA CTAGGCTGGCGAATTCTATATTGAAAACCTACTTCGTGGCAAGGCTGGTGAACGGCAAACTAAAAATATATTGTC CTCGCAAAGTTTGGAAGCAACGTCTGCAGACATCGTGAATTCGATAACATAG |