Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|007640
Gene name
Locationscaffold_01a:1798792..1799899
Strand-
Gene length (bp)1107
Transcript length (bp)948
Coding sequence length (bp)948
Protein length (aa) 316

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01501 Glyco_transf_8 Glycosyl transferase family 8 2.5E-17 12 264

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O22693|GOLS4_ARATH Galactinol synthase 4 OS=Arabidopsis thaliana GN=GOLS4 PE=2 SV=1 4 299 4.0E-25
sp|Q9FXB2|GOLS2_ARATH Galactinol synthase 2 OS=Arabidopsis thaliana GN=GOLS2 PE=1 SV=1 9 296 2.0E-23
sp|Q9XGN4|GOLS1_AJURE Galactinol synthase 1 OS=Ajuga reptans GN=GOLS1 PE=1 SV=1 9 298 9.0E-23
sp|O22893|GOLS1_ARATH Galactinol synthase 1 OS=Arabidopsis thaliana GN=GOLS1 PE=1 SV=1 9 291 5.0E-22
sp|Q4PSY4|GOLS7_ARATH Galactinol synthase 7 OS=Arabidopsis thaliana GN=GOLS7 PE=2 SV=1 9 294 1.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O22693|GOLS4_ARATH Galactinol synthase 4 OS=Arabidopsis thaliana GN=GOLS4 PE=2 SV=1 4 299 4.0E-25
sp|Q9FXB2|GOLS2_ARATH Galactinol synthase 2 OS=Arabidopsis thaliana GN=GOLS2 PE=1 SV=1 9 296 2.0E-23
sp|Q9XGN4|GOLS1_AJURE Galactinol synthase 1 OS=Ajuga reptans GN=GOLS1 PE=1 SV=1 9 298 9.0E-23
sp|O22893|GOLS1_ARATH Galactinol synthase 1 OS=Arabidopsis thaliana GN=GOLS1 PE=1 SV=1 9 291 5.0E-22
sp|Q4PSY4|GOLS7_ARATH Galactinol synthase 7 OS=Arabidopsis thaliana GN=GOLS7 PE=2 SV=1 9 294 1.0E-21
sp|O80518|GOLS3_ARATH Galactinol synthase 3 OS=Arabidopsis thaliana GN=GOLS3 PE=1 SV=1 9 295 2.0E-21
sp|C7G304|GOLS2_SOLLC Galactinol synthase 2 OS=Solanum lycopersicum GN=GOLS2 PE=2 SV=1 4 297 3.0E-21
sp|Q8H1S1|GOLS6_ARATH Galactinol synthase 6 OS=Arabidopsis thaliana GN=GOLS6 PE=2 SV=1 9 295 8.0E-21
sp|Q947G8|GOLS1_SOLLC Galactinol synthase 1 OS=Solanum lycopersicum GN=GOLS1 PE=2 SV=1 3 298 2.0E-20
sp|Q9FFA1|GOLS5_ARATH Galactinol synthase 5 OS=Arabidopsis thaliana GN=GOLS5 PE=2 SV=1 9 295 2.0E-19
sp|Q5UNW1|YR707_MIMIV Uncharacterized protein R707 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R707 PE=4 SV=1 6 273 8.0E-19
sp|Q9XGN3|GOLS2_AJURE Galactinol synthase 2 (Fragment) OS=Ajuga reptans GN=GOLS2 PE=1 SV=1 29 262 8.0E-17
sp|F4KED2|GOLSA_ARATH Galactinol synthase 10 OS=Arabidopsis thaliana GN=GOLS10 PE=3 SV=1 9 295 2.0E-13
sp|Q8GWB7|GUX6_ARATH Inositol phosphorylceramide glucuronosyltransferase 1 OS=Arabidopsis thaliana GN=IPUT1 PE=1 SV=1 5 118 1.0E-12
sp|Q9R062|GLYG_MOUSE Glycogenin-1 OS=Mus musculus GN=Gyg1 PE=1 SV=3 9 286 2.0E-12
sp|O08730|GLYG_RAT Glycogenin-1 OS=Rattus norvegicus GN=Gyg1 PE=2 SV=4 9 286 9.0E-12
sp|H2KYQ5|GYG1_CAEEL Glycogenin-1 OS=Caenorhabditis elegans GN=gyg-1 PE=1 SV=1 7 262 1.0E-10
sp|P46976|GLYG_HUMAN Glycogenin-1 OS=Homo sapiens GN=GYG1 PE=1 SV=4 9 282 2.0E-10
sp|O15488|GLYG2_HUMAN Glycogenin-2 OS=Homo sapiens GN=GYG2 PE=1 SV=2 9 282 2.0E-09
sp|P13280|GLYG_RABIT Glycogenin-1 OS=Oryctolagus cuniculus GN=GYG1 PE=1 SV=3 9 282 4.0E-09
sp|Q09680|YA0C_SCHPO Uncharacterized protein C5H10.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC5H10.12c PE=4 SV=1 9 246 2.0E-08
sp|F4HZC3|GUX5_ARATH Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 5 OS=Arabidopsis thaliana GN=GUX5 PE=2 SV=1 9 306 7.0E-08
sp|O43061|MU136_SCHPO Meiotically up-regulated gene 136 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug136 PE=1 SV=1 30 195 1.0E-07
sp|Q9Y761|GNT1A_KLULA Glucose N-acetyltransferase 1-A OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GNT1-A PE=3 SV=1 9 120 3.0E-07
sp|O43062|YGT9_SCHPO Uncharacterized protein C4C3.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4C3.09 PE=4 SV=1 9 119 2.0E-06
sp|Q9LSB1|GUX1_ARATH UDP-glucuronate:xylan alpha-glucuronosyltransferase 1 OS=Arabidopsis thaliana GN=GUX1 PE=2 SV=1 3 120 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|007640
MDLSSPSSAYVTLLTKPSYLPGVLVLDYSLRSVGSKYPLVVMVTPGISRAVKDVLEKRGIRMRDVELLLPVANDQ
IRQFEERFIDTWSKLRAFELHEFKRVVLLDSDMLIKKNMDDLFDLDLANDQIGATFVCACNPRKFKHYPADWIPE
NCPYTRYAEIVASPTQKVPDAPAPHSLLNSGTIVLNPSKELTEKLYGFFSTNDELFTYIFPDQDLLAKFFSGKWK
LIPWYCNALRMLRTIHPDLWNDDEIRCIHYILSDKPWSSRQNPDPEAKHFGILHDWWWQTFDEMGLMMKSTDAEG
WKLVLKHVDVTKNDH*
Coding >Agabi119p4|007640
ATGGACCTTTCTTCACCTTCCAGTGCATATGTCACACTACTCACGAAACCCTCATACTTGCCGGGTGTCCTAGTT
TTGGACTATTCTCTTCGTTCTGTTGGCTCCAAGTATCCGCTTGTGGTAATGGTCACCCCAGGCATTTCAAGAGCT
GTAAAAGACGTCCTTGAGAAAAGAGGAATTCGCATGAGAGACGTGGAACTGTTGCTACCAGTCGCCAATGACCAA
ATCCGCCAATTTGAAGAGCGGTTTATTGATACATGGAGCAAGTTGAGAGCCTTCGAGCTACACGAGTTCAAGCGT
GTCGTGCTGCTAGACTCTGATATGTTAATCAAAAAGAATATGGATGATCTTTTTGACCTTGACCTGGCAAATGAT
CAGATCGGCGCCACATTTGTCTGTGCCTGCAATCCTCGCAAATTCAAGCATTATCCAGCGGATTGGATCCCCGAA
AACTGCCCATATACTCGATATGCTGAGATAGTTGCTTCACCCACACAAAAAGTACCAGATGCACCTGCCCCCCAT
AGCCTTCTTAATTCGGGTACAATTGTCCTGAATCCATCTAAGGAGTTGACAGAAAAACTCTATGGGTTCTTCTCG
ACCAACGACGAACTTTTCACATACATATTCCCGGACCAAGACTTGCTCGCCAAATTTTTTTCAGGAAAGTGGAAG
CTTATTCCGTGGTACTGCAACGCACTGCGTATGCTTCGCACTATCCATCCCGACCTTTGGAACGACGATGAAATT
CGTTGTATCCATTATATTCTATCTGATAAACCTTGGTCTTCCAGACAGAACCCAGACCCCGAAGCAAAGCATTTT
GGCATTCTCCATGATTGGTGGTGGCAGACATTCGACGAGATGGGTCTAATGATGAAGTCGACAGACGCAGAAGGG
TGGAAACTAGTTTTGAAGCATGTGGATGTTACGAAGAATGATCATTAA
Transcript >Agabi119p4|007640
ATGGACCTTTCTTCACCTTCCAGTGCATATGTCACACTACTCACGAAACCCTCATACTTGCCGGGTGTCCTAGTT
TTGGACTATTCTCTTCGTTCTGTTGGCTCCAAGTATCCGCTTGTGGTAATGGTCACCCCAGGCATTTCAAGAGCT
GTAAAAGACGTCCTTGAGAAAAGAGGAATTCGCATGAGAGACGTGGAACTGTTGCTACCAGTCGCCAATGACCAA
ATCCGCCAATTTGAAGAGCGGTTTATTGATACATGGAGCAAGTTGAGAGCCTTCGAGCTACACGAGTTCAAGCGT
GTCGTGCTGCTAGACTCTGATATGTTAATCAAAAAGAATATGGATGATCTTTTTGACCTTGACCTGGCAAATGAT
CAGATCGGCGCCACATTTGTCTGTGCCTGCAATCCTCGCAAATTCAAGCATTATCCAGCGGATTGGATCCCCGAA
AACTGCCCATATACTCGATATGCTGAGATAGTTGCTTCACCCACACAAAAAGTACCAGATGCACCTGCCCCCCAT
AGCCTTCTTAATTCGGGTACAATTGTCCTGAATCCATCTAAGGAGTTGACAGAAAAACTCTATGGGTTCTTCTCG
ACCAACGACGAACTTTTCACATACATATTCCCGGACCAAGACTTGCTCGCCAAATTTTTTTCAGGAAAGTGGAAG
CTTATTCCGTGGTACTGCAACGCACTGCGTATGCTTCGCACTATCCATCCCGACCTTTGGAACGACGATGAAATT
CGTTGTATCCATTATATTCTATCTGATAAACCTTGGTCTTCCAGACAGAACCCAGACCCCGAAGCAAAGCATTTT
GGCATTCTCCATGATTGGTGGTGGCAGACATTCGACGAGATGGGTCTAATGATGAAGTCGACAGACGCAGAAGGG
TGGAAACTAGTTTTGAAGCATGTGGATGTTACGAAGAATGATCATTAA
Gene >Agabi119p4|007640
ATGGACCTTTCTTCACCTTCCAGTGCATATGTCACACTACTCACGAAACCCTCATACTTGCCGGGTGTCCTAGTT
TTGGACTATTCTCTTCGTTCTGTTGGCTCCAAGTATCCGCTTGTGGTAATGGTCACCCCAGGCATTTCAAGAGCT
GTAAAAGACGTCCTTGAGAAAAGAGGAATTCGCATGAGAGACGTGGAACTGTTGCTACCAGTCGCCAATGACCAA
ATCCGCCAATTTGAAGAGCGGTTTATTGATACATGGAGCAAGTTGAGGTGAGATGTCTCGTCCTCGCGGCACTAG
AGCATTTTTTTGACTGGTTCAGAGCCTTCGAGCTACACGAGTTCAAGGTCATTCGTTCTTTGTCCCTTGTTATGC
GTATCAGTGGCTTATTCGGATCTTCAGCGTGTCGTGCTGCTAGACTCTGATATGTTAATCAAAAAGAATATGGAT
GATCTTTTTGACCTTGACCTGGCAAATGATCAGATCGGCGCCACATTTGTCTGTGCCTGCAATCCTCGCAAATTC
AAGCATTATCCAGCGGATTGGTAAACGAGCCATTCCTTTGAATGATTTTCTGTATATTGATTTCTGTACCACAGG
ATCCCCGAAAACTGCCCATATACTCGATATGCTGAGATAGTTGCTTCACCCACACAAAAAGTACCAGATGCACCT
GCCCCCCATAGCCTTCTTAATTCGGGTACAATTGTCCTGAATCCATCTAAGGAGTTGACAGAAAAACTCTATGGG
TTCTTCTCGACCAACGACGAACTTTTCACATACATATTCCCGGACCAAGACTTGCTCGCCAAATTTTTTTCAGGA
AAGTGGAAGCTTATTCCGTGGTACTGCAACGCACTGCGTATGCTTCGCACTATCCATCCCGACCTTTGGAACGAC
GATGAAATTCGTTGTATCCATTATATTCTATCTGATAAACCTTGGTCTTCCAGACAGAACCCAGACCCCGAAGCA
AAGCATTTTGGCATTCTCCATGATTGGTGGTGGCAGACATTCGACGAGATGGGTCTAATGATGAAGTCGACAGAC
GCAGAAGGGTGGAAACTAGTTTTGAAGCATGTGGATGTTACGAAGAATGATCATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail