Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|007250
Gene name
Locationscaffold_01a:1713341..1716197
Strand-
Gene length (bp)2856
Transcript length (bp)2163
Coding sequence length (bp)2163
Protein length (aa) 721

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12333 Ipi1_N Rix1 complex component involved in 60S ribosome maturation 5.7E-17 139 245

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94718|IPI1_SCHPO Pre-rRNA-processing protein ipi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ipi1 PE=3 SV=2 14 283 2.0E-23
sp|A3M0B1|IPI1_PICST Pre-rRNA-processing protein IPI1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=IPI1 PE=3 SV=2 4 242 2.0E-20
sp|Q803M3|TEX10_DANRE Testis-expressed sequence 10 protein homolog OS=Danio rerio GN=tex10 PE=2 SV=2 5 246 4.0E-20
sp|A5E181|IPI1_LODEL Pre-rRNA-processing protein IPI1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=IPI1 PE=3 SV=1 6 281 5.0E-20
sp|Q5A6S9|IPI12_CANAL Pre-rRNA-processing protein IPI1-2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IPI1-2 PE=3 SV=1 4 244 2.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94718|IPI1_SCHPO Pre-rRNA-processing protein ipi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ipi1 PE=3 SV=2 14 283 2.0E-23
sp|A3M0B1|IPI1_PICST Pre-rRNA-processing protein IPI1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=IPI1 PE=3 SV=2 4 242 2.0E-20
sp|Q803M3|TEX10_DANRE Testis-expressed sequence 10 protein homolog OS=Danio rerio GN=tex10 PE=2 SV=2 5 246 4.0E-20
sp|A5E181|IPI1_LODEL Pre-rRNA-processing protein IPI1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=IPI1 PE=3 SV=1 6 281 5.0E-20
sp|Q5A6S9|IPI12_CANAL Pre-rRNA-processing protein IPI1-2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IPI1-2 PE=3 SV=1 4 244 2.0E-19
sp|Q5RDK1|TEX10_PONAB Testis-expressed sequence 10 protein OS=Pongo abelii GN=TEX10 PE=2 SV=1 7 246 2.0E-19
sp|Q9NXF1|TEX10_HUMAN Testis-expressed sequence 10 protein OS=Homo sapiens GN=TEX10 PE=1 SV=2 7 246 3.0E-19
sp|Q3URQ0|TEX10_MOUSE Testis-expressed sequence 10 protein OS=Mus musculus GN=Tex10 PE=1 SV=1 7 246 5.0E-19
sp|Q59JU3|IPI11_CANAL Pre-rRNA-processing protein IPI1-1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IPI1-1 PE=3 SV=1 4 176 7.0E-19
sp|Q5ZM41|TEX10_CHICK Testis-expressed sequence 10 protein homolog OS=Gallus gallus GN=TEX10 PE=2 SV=1 6 182 8.0E-19
sp|Q6BLC4|IPI1_DEBHA Pre-rRNA-processing protein IPI1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IPI1 PE=3 SV=2 4 243 6.0E-18
sp|A5DKN0|IPI1_PICGU Pre-rRNA-processing protein IPI1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=IPI1 PE=3 SV=2 5 175 9.0E-17
sp|P0CT45|IPI1_CHATD Pre-rRNA-processing protein IPI1 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) PE=3 SV=1 14 249 2.0E-16
sp|Q2UU13|IPI1_ASPOR Pre-rRNA-processing protein ipi1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ipi1 PE=3 SV=1 1 343 3.0E-15
sp|Q5ASR2|IPI1_EMENI Pre-rRNA-processing protein ipi1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ipi1 PE=3 SV=1 1 189 8.0E-15
sp|Q4WCP8|IPI1_ASPFU Pre-rRNA-processing protein ipi1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ipi1 PE=3 SV=2 1 189 4.0E-13
sp|Q6FK47|IPI1_CANGA Pre-rRNA-processing protein IPI1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IPI1 PE=3 SV=1 20 187 5.0E-13
sp|P38803|IPI1_YEAST Pre-rRNA-processing protein IPI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IPI1 PE=1 SV=1 14 218 1.0E-11
sp|A6ZSZ4|IPI1_YEAS7 Pre-rRNA-processing protein IPI1 OS=Saccharomyces cerevisiae (strain YJM789) GN=IPI1 PE=3 SV=1 14 218 1.0E-11
sp|A1CMX6|IPI1_ASPCL Pre-rRNA-processing protein ipi1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ipi1 PE=3 SV=1 1 189 3.0E-11
sp|A1DL11|IPI1_NEOFI Pre-rRNA-processing protein ipi1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ipi1 PE=3 SV=1 14 189 4.0E-11
sp|A7EI93|IPI1_SCLS1 Pre-rRNA-processing protein ipi1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=ipi1 PE=3 SV=1 1 189 2.0E-10
sp|A4RBW8|IPI1_MAGO7 Pre-rRNA-processing protein IPI1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=IPI1 PE=3 SV=1 1 189 9.0E-10
sp|Q6CJZ2|IPI1_KLULA Pre-rRNA-processing protein IPI1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPI1 PE=3 SV=1 7 264 4.0E-09
sp|Q7SFQ6|IPI1_NEUCR Pre-rRNA-processing protein ipi1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ipi1 PE=3 SV=1 14 186 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|007250
MPKSAKKRKDKAADFAKAKLKLGKEKRAPSNVIDTSFKARSIALPTQSIAAVKDETAPTTKRKLTINDLLTHLKH
YNPSVKRDALAGLNELLEAHWSLINKNLSLLINQLARLINDEDASVRKQLLAFFTWLLPRIPQEDLIPHASALVL
FTASAQTHIFPEIRIDAVRFLGLLLDFIPVPLVQGWDSTDSTNGKRILEGYLGNLSAGIKYGDGDASSSTVVTSS
GVILSPTSKLAVLQSFLSFLRTGLLIGKRERIRQDSHNALHAWYMSQFFTTQNAFRAFEEALRPRLEQPSRADLS
TSGDYSQTYSLYDYETPWTMQELENTLQSSGDFKRENSGDSTLSFLLRLSRTLHPVLVSTFLDCASAVFTPDGKE
SDTETMMVLVVSRLVSLLYGTILSENEDVPSSTLSELENFLGYMTPYFPFSPSNSRDIKIIESFQDLNIIYCELT
SLLVLHSNSISLNRATNGSSTQTQQSKSSEAMKLRVRLVSEYITKLLRGQSGHVSQSLSGASYLALLPSIWSIVN
NSNAELSLSASDVLQATLEHAKKSPSKSSAKRLAIEFVARLVLLDTESQFRGSFRAGGSDRMGQRFDNWLIHLPQ
GLWEIGGSDPMATEVIFRFLLRLLQRQPSFIVAETISALSARLVPYFAVTHSVRGQRSGPYSQLSAFHKHLCLDM
VSTLLAYVNQSGPDTQRVCPLVKAVRLAVADTGEQSYWTHVWRDI*
Coding >Agabi119p4|007250
ATGCCAAAAAGCGCCAAGAAGCGCAAAGACAAGGCGGCAGATTTCGCTAAAGCGAAACTAAAGCTCGGGAAGGAG
AAAAGGGCTCCCTCCAATGTCATAGATACATCATTCAAAGCCCGCTCTATTGCACTTCCTACTCAGAGCATCGCG
GCCGTCAAAGATGAAACCGCACCAACGACGAAACGGAAGCTCACAATTAACGACCTTCTTACGCATCTCAAACAT
TACAACCCTTCTGTCAAGAGAGATGCACTTGCTGGCTTGAATGAGCTATTAGAGGCTCACTGGTCCCTCATCAAC
AAAAACCTTTCCCTCCTGATCAACCAGCTTGCTCGTCTCATAAACGACGAGGATGCAAGTGTCCGGAAACAACTT
CTCGCGTTCTTCACCTGGTTATTACCCAGGATACCTCAGGAAGATCTGATACCCCATGCATCTGCTCTCGTGTTA
TTCACTGCTTCAGCACAAACGCATATATTTCCTGAAATAAGGATAGATGCTGTCCGATTCCTAGGCCTTCTTCTC
GACTTCATACCAGTACCGTTGGTTCAGGGATGGGACTCAACTGACTCCACTAACGGGAAGCGCATCTTAGAAGGG
TACCTCGGGAATCTTAGTGCTGGCATTAAGTACGGAGACGGAGACGCGTCATCATCAACAGTAGTAACAAGTTCT
GGTGTTATCCTCTCCCCGACATCAAAACTTGCTGTTCTGCAATCATTCTTATCTTTCCTCCGGACAGGATTATTG
ATAGGAAAACGTGAAAGAATACGGCAGGATTCGCATAATGCGTTGCATGCGTGGTATATGTCACAGTTTTTCACA
ACACAAAATGCCTTCCGGGCCTTTGAGGAGGCTCTTCGGCCTCGACTCGAACAGCCATCTCGAGCTGATCTTTCG
ACTTCGGGTGATTATTCCCAGACTTATTCCCTTTATGACTACGAAACACCATGGACGATGCAAGAACTGGAAAAC
ACATTACAATCTTCGGGCGACTTCAAGAGAGAAAACAGTGGGGATTCGACACTCTCGTTTCTCTTGCGTTTATCT
CGAACTTTACATCCAGTCCTTGTTTCAACTTTCCTGGACTGTGCATCCGCTGTTTTCACTCCAGATGGAAAAGAG
AGCGACACAGAGACAATGATGGTCCTAGTTGTTAGCCGGCTCGTATCTCTGCTCTACGGGACAATACTTAGTGAA
AATGAGGACGTGCCTTCTTCGACGCTGTCAGAGTTGGAGAATTTTTTGGGTTACATGACGCCATACTTTCCTTTC
TCTCCCTCGAACTCACGAGATATCAAAATCATCGAGAGCTTCCAGGATCTGAACATCATCTACTGCGAATTGACT
TCCCTACTTGTCCTTCATTCGAATTCTATCTCCCTGAACCGCGCAACGAATGGCTCTTCAACCCAAACTCAGCAA
TCTAAATCAAGTGAAGCTATGAAACTACGAGTGAGACTCGTTAGTGAATACATCACGAAGCTCCTTCGCGGGCAG
AGCGGCCATGTGTCTCAATCGCTGTCCGGGGCTTCCTATCTTGCGCTTCTACCGAGTATATGGTCCATCGTTAAT
AATTCTAATGCTGAACTATCCTTATCCGCGAGTGATGTTCTACAAGCAACTTTGGAACATGCCAAAAAGTCTCCT
TCCAAATCCAGCGCAAAGCGGCTGGCGATTGAATTTGTGGCACGATTGGTATTGCTCGATACGGAATCACAATTC
CGAGGGAGTTTTCGCGCCGGAGGTTCTGATCGAATGGGACAGAGGTTCGATAATTGGCTCATCCACCTGCCTCAG
GGTCTTTGGGAAATTGGTGGCAGTGATCCTATGGCGACGGAGGTCATATTTCGATTTTTATTGCGTTTGCTCCAA
CGTCAACCGTCATTCATTGTTGCAGAGACGATCTCCGCCCTTAGTGCACGCTTGGTGCCTTATTTTGCCGTGACT
CACTCAGTCCGCGGACAACGGTCCGGACCATACAGCCAGCTTTCAGCCTTTCACAAGCATCTCTGTTTAGATATG
GTGTCTACTCTTTTGGCGTACGTGAATCAGAGCGGACCTGACACACAGAGAGTTTGTCCACTCGTCAAGGCAGTT
AGGTTAGCTGTGGCGGATACCGGCGAACAAAGTTATTGGACACACGTATGGAGAGATATTTGA
Transcript >Agabi119p4|007250
ATGCCAAAAAGCGCCAAGAAGCGCAAAGACAAGGCGGCAGATTTCGCTAAAGCGAAACTAAAGCTCGGGAAGGAG
AAAAGGGCTCCCTCCAATGTCATAGATACATCATTCAAAGCCCGCTCTATTGCACTTCCTACTCAGAGCATCGCG
GCCGTCAAAGATGAAACCGCACCAACGACGAAACGGAAGCTCACAATTAACGACCTTCTTACGCATCTCAAACAT
TACAACCCTTCTGTCAAGAGAGATGCACTTGCTGGCTTGAATGAGCTATTAGAGGCTCACTGGTCCCTCATCAAC
AAAAACCTTTCCCTCCTGATCAACCAGCTTGCTCGTCTCATAAACGACGAGGATGCAAGTGTCCGGAAACAACTT
CTCGCGTTCTTCACCTGGTTATTACCCAGGATACCTCAGGAAGATCTGATACCCCATGCATCTGCTCTCGTGTTA
TTCACTGCTTCAGCACAAACGCATATATTTCCTGAAATAAGGATAGATGCTGTCCGATTCCTAGGCCTTCTTCTC
GACTTCATACCAGTACCGTTGGTTCAGGGATGGGACTCAACTGACTCCACTAACGGGAAGCGCATCTTAGAAGGG
TACCTCGGGAATCTTAGTGCTGGCATTAAGTACGGAGACGGAGACGCGTCATCATCAACAGTAGTAACAAGTTCT
GGTGTTATCCTCTCCCCGACATCAAAACTTGCTGTTCTGCAATCATTCTTATCTTTCCTCCGGACAGGATTATTG
ATAGGAAAACGTGAAAGAATACGGCAGGATTCGCATAATGCGTTGCATGCGTGGTATATGTCACAGTTTTTCACA
ACACAAAATGCCTTCCGGGCCTTTGAGGAGGCTCTTCGGCCTCGACTCGAACAGCCATCTCGAGCTGATCTTTCG
ACTTCGGGTGATTATTCCCAGACTTATTCCCTTTATGACTACGAAACACCATGGACGATGCAAGAACTGGAAAAC
ACATTACAATCTTCGGGCGACTTCAAGAGAGAAAACAGTGGGGATTCGACACTCTCGTTTCTCTTGCGTTTATCT
CGAACTTTACATCCAGTCCTTGTTTCAACTTTCCTGGACTGTGCATCCGCTGTTTTCACTCCAGATGGAAAAGAG
AGCGACACAGAGACAATGATGGTCCTAGTTGTTAGCCGGCTCGTATCTCTGCTCTACGGGACAATACTTAGTGAA
AATGAGGACGTGCCTTCTTCGACGCTGTCAGAGTTGGAGAATTTTTTGGGTTACATGACGCCATACTTTCCTTTC
TCTCCCTCGAACTCACGAGATATCAAAATCATCGAGAGCTTCCAGGATCTGAACATCATCTACTGCGAATTGACT
TCCCTACTTGTCCTTCATTCGAATTCTATCTCCCTGAACCGCGCAACGAATGGCTCTTCAACCCAAACTCAGCAA
TCTAAATCAAGTGAAGCTATGAAACTACGAGTGAGACTCGTTAGTGAATACATCACGAAGCTCCTTCGCGGGCAG
AGCGGCCATGTGTCTCAATCGCTGTCCGGGGCTTCCTATCTTGCGCTTCTACCGAGTATATGGTCCATCGTTAAT
AATTCTAATGCTGAACTATCCTTATCCGCGAGTGATGTTCTACAAGCAACTTTGGAACATGCCAAAAAGTCTCCT
TCCAAATCCAGCGCAAAGCGGCTGGCGATTGAATTTGTGGCACGATTGGTATTGCTCGATACGGAATCACAATTC
CGAGGGAGTTTTCGCGCCGGAGGTTCTGATCGAATGGGACAGAGGTTCGATAATTGGCTCATCCACCTGCCTCAG
GGTCTTTGGGAAATTGGTGGCAGTGATCCTATGGCGACGGAGGTCATATTTCGATTTTTATTGCGTTTGCTCCAA
CGTCAACCGTCATTCATTGTTGCAGAGACGATCTCCGCCCTTAGTGCACGCTTGGTGCCTTATTTTGCCGTGACT
CACTCAGTCCGCGGACAACGGTCCGGACCATACAGCCAGCTTTCAGCCTTTCACAAGCATCTCTGTTTAGATATG
GTGTCTACTCTTTTGGCGTACGTGAATCAGAGCGGACCTGACACACAGAGAGTTTGTCCACTCGTCAAGGCAGTT
AGGTTAGCTGTGGCGGATACCGGCGAACAAAGTTATTGGACACACGTATGGAGAGATATTTGA
Gene >Agabi119p4|007250
ATGCCAAAAAGCGCCAAGAAGCGCAAAGACAAGGCGGCAGATTTCGCTGTAGGCCTGCTTCTTTACAATACCCAT
ACAAGTGCTTAGCTGCATCACAGAAAGCGAAACTAAAGCTCGGGAAGGAGAAAAGGGCTCCCTCCAATGTCATAG
ATACATCATTCAAAGCCCGCTGTGAGTCATGTTTTCAGTTATTAAGGACAGCTGTTTGAACCCAGATAGCTATTG
CACTTCCTACTCAGAGCATCGCGGCCGTCAAAGATGAAACCGCACCAACGACGAAACGGAAGCTCACAATTAACG
ACCTTCTTACGCATCTCAAACATTACAACCCTTCTGTCAAGAGAGGTACGTACGTATTGAATCACTGGTCGTTCG
ATTGTCAACCTTGCGTCAGATGCACTTGCTGGCTTGAATGAGCTATTAGAGGCTCACTGGTCCCTCATCAACAAA
AACCTTTCCCTCCTGATCAACCAGCTTGCTCGTCTCATAAACGACGAGGTACGGCACATTCATACTTCTAAAGTG
AGGATTCTCAGAAACATCCCAGGATGCAAGTGTCCGGAAACAACTTCTCGCGTTCTTCACCTGGTTATTACCCAG
GATACCTCAGGTGTGGCCATTTCTAGTCATTGGAATCGCAAGCTAAGGTCATAATGGGTTTTAGGAAGATCTGAT
ACCCCATGCATCTGCTCTCGTGTTATTCACTGCTTCAGCACAAACGCATATATTTCCTGAAATAAGGATAGATGC
TGTCCGATTCCTAGGCCTTCTTCTCGACTTCATACCAGTACCGTTGGTTCAGGGATGGGACTCAACTGACTCCAC
TAACGGGAAGCGCATCTTAGAAGGGTACCTCGGGAATCTTAGTGCTGGCATTAAGTACGGAGACGGAGACGGTAA
GTTCATTCCAGGATGATTTGAGCATCTACTTGAGTTTGGGAACAGCGTCATCATCAACAGTAGTAACAAGTTCTG
GTGTTATCCTCTCCCCGACAGTAAGCCAGCAGGTGACTCATTGACTATAAAGCTGACATAGCTCTAGTCAAAACT
TGCTGTTCTGCAATCATTCTTATCTTTCCTCCGGACAGGATTATTGATAGGAAAACGTGAAAGAATACGGCAGGA
TTCGCATAATGCGTTGCATGCGTGGTATATGTCACAGTTTTTCACAACACAAAATGCCTTCCGGGCCTTTGAGGA
GGCTCTTCGGCCTCGACTCGAACAGCCATCTCGAGCTGATCTTTCGACTTCGGGTGATTATTCCCAGACTTATTC
CCTTTATGACTACGAAACACCATGGACGATGCAAGAACTGGAAAACACATTACAATCTTCGGGCGACTTCAAGAG
AGAAAACAGTGGGGATTCGACACTCTCGTTTCTCTTGGTAAGAACGGTCGCAATTTCGATTTGTATTCCACGCTT
ACGCCGTTCCAGCGTTTATCTCGAACTTTACATCCAGTCCTTGTTTCAACTTTCCTGGACTGTGCATCCGCTGTT
TTCACTCCAGATGGAAAAGAGAGCGACACAGAGACAATGATGGTCCTAGTTGTTAGCCGGCTCGTATCTCTGCTC
TACGGGACAATACTTAGTGAAAATGAGGACGTGAGTGGCTAGGGTTGATTGTTCATCTATTTTCTTATACTGCAT
CAGGTGCCTTCTTCGACGCTGTCAGAGTTGGAGAATTTTTTGGGTTACATGACGCCATACTTTCCTTTCTCTCCC
TCGAACTCACGAGATATCAAAGTTAGGAGCTCTTACTCGTTTGTCGGAGGGTTGTTAACAATGGACTTAGATCAT
CGAGAGCTTCCAGGATCTGAACATCATCTACTGCGAATTGACTTCCCTACTTGTCCTTCATTCGAATTCTATCTC
CCTGAACCGCGCAACGAATGGCTCTTCAACCCAAACTCAGCAATCTAAATCAAGTGAAGCTATGAAACTACGAGT
GAGACTCGTTAGTGAATACATCACGAAGCTCCTTCGCGGGCAGAGCGGCCATGTGTCTCAATCGCTGTCCGGGGC
TTCCTATCTTGCGCTTCTACCGAGTATATGGTCCATCGTTAATAATTCTAATGCTGAACTATCCTTATCCGCGAG
TGATGTTCTACAAGCAACTTTGGAACATGCCAAAAAGTCTCCTTCCAAATCCAGCGCAAAGCGGCTGGCGATTGA
ATTTGTGGCACGATTGGTATTGGTCAGTCGAGGCCGGGCTGCTTTGTCCGTCATCATTTGTTTACTTAAAAATTT
TTTAGCTCGATACGGAATCACAATTCCGAGGGAGTTTTCGCGCCGGAGGTTCTGATCGAATGGGACAGAGGTTCG
ATAATTGGCTCATCCACCTGCCTCAGGGTCTTTGGGAAATTGGTGGCAGTGATCCTATGGCGACGGAGGTATGAC
TTGAGTAAAGCTCTAACTGGTTTTCATTTCTGACGAACTTTGATGATAAACTCGGTTTTTCATTTCATCTTTCAT
TAGGTCATATTTCGATTTTTATTGCGTTTGCTCCAACGTCAACCGTCATTCATTGTTGCAGAGGTATGATTGAAA
TCGATTGACATTGATCCACTGTCTCTGATCTCGGTCGATTATCAGACGATCTCCGCCCTTAGTGCACGCTTGGTG
CCTTATTTTGCCGTGACTCACTCAGTCCGCGGACAACGGTCCGGACCATACAGCCAGCTTTCAGCCTTTCACAAG
CATCTCTGTTTAGATATGGTGTCTACTCTTTTGGCGTACGTGAATCAGAGCGGACCTGACACACAGAGAGTTTGT
CCACTCGTCAAGGCAGTTAGGTTAGCTGTGGCGGATACCGGCGAACAAAGTTATTGGACACACGTATGGAGAGAT
ATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail