Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|007240
Gene name
Locationscaffold_01a:1712047..1713008
Strand+
Gene length (bp)961
Transcript length (bp)804
Coding sequence length (bp)804
Protein length (aa) 268

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03330 DPBB_1 Lytic transglycolase 2.6E-07 165 258

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P86242|PAPI_STRMB Papain inhibitor OS=Streptomyces mobaraensis GN=pi PE=1 SV=2 164 267 1.0E-12
sp|D4B2H3|ALL7_ARTBC Allergen Asp f 7 homolog OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02701 PE=3 SV=1 164 267 3.0E-11
sp|O42799|ALL7_ASPFU Allergen Asp f 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G06670 PE=1 SV=2 165 266 8.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|007240
MSFSKLVLLFVAFVASAGALSSPHPRGIHHRALAGRITVPESPLSPPLPVRRRQNSKRCKSRPSSAALIVSTKDA
TSTKEATHTREATHTKEATPTKEVVPTKEAPTTKETEAPKPTTHETTHKASPTPKPAPPPTTKEEAPAPTKKPPP
PTSNLPSFLTGLNTGDATFYATGLGACGIVNKDTDFIAAASKHLFDAFPGYDGANPNKNPMCNRRVSATYEGTTI
EVVLTDRCEGCALTALDFSPSAFNKLADPSKGRLHGMTWKFI*
Coding >Agabi119p4|007240
ATGTCCTTCTCAAAGCTCGTCCTTCTTTTTGTCGCTTTCGTCGCCTCTGCCGGCGCTCTCTCCAGCCCTCATCCT
CGCGGCATCCATCACCGCGCCCTCGCTGGCCGCATTACGGTTCCTGAGTCTCCACTCTCCCCCCCTCTTCCCGTT
CGCAGGCGCCAGAACAGCAAGCGCTGCAAGTCTCGCCCTTCCTCTGCTGCCCTCATTGTAAGCACGAAGGACGCC
ACTAGCACGAAAGAGGCTACTCACACAAGAGAGGCCACCCACACCAAAGAGGCTACCCCAACGAAAGAAGTCGTC
CCCACGAAAGAGGCTCCTACCACAAAAGAAACTGAGGCTCCTAAACCTACTACTCACGAAACGACTCACAAGGCC
TCTCCTACCCCCAAGCCGGCCCCACCACCAACGACCAAAGAAGAAGCTCCTGCCCCAACCAAGAAACCGCCCCCT
CCCACCTCGAACCTTCCAAGCTTCCTGACTGGTCTTAACACTGGCGATGCAACGTTTTACGCAACTGGTCTTGGT
GCTTGTGGCATCGTAAATAAAGACACTGATTTCATTGCTGCCGCCTCTAAGCACTTGTTCGATGCTTTCCCTGGC
TACGACGGAGCCAACCCCAACAAGAACCCTATGTGTAATCGCAGGGTATCTGCGACATACGAAGGTACCACTATC
GAGGTTGTGCTTACCGACCGGTGTGAGGGATGCGCCCTGACTGCCTTGGATTTCTCTCCATCTGCTTTCAATAAA
CTTGCCGACCCAAGTAAAGGGCGTCTGCATGGCATGACTTGGAAATTCATCTAG
Transcript >Agabi119p4|007240
ATGTCCTTCTCAAAGCTCGTCCTTCTTTTTGTCGCTTTCGTCGCCTCTGCCGGCGCTCTCTCCAGCCCTCATCCT
CGCGGCATCCATCACCGCGCCCTCGCTGGCCGCATTACGGTTCCTGAGTCTCCACTCTCCCCCCCTCTTCCCGTT
CGCAGGCGCCAGAACAGCAAGCGCTGCAAGTCTCGCCCTTCCTCTGCTGCCCTCATTGTAAGCACGAAGGACGCC
ACTAGCACGAAAGAGGCTACTCACACAAGAGAGGCCACCCACACCAAAGAGGCTACCCCAACGAAAGAAGTCGTC
CCCACGAAAGAGGCTCCTACCACAAAAGAAACTGAGGCTCCTAAACCTACTACTCACGAAACGACTCACAAGGCC
TCTCCTACCCCCAAGCCGGCCCCACCACCAACGACCAAAGAAGAAGCTCCTGCCCCAACCAAGAAACCGCCCCCT
CCCACCTCGAACCTTCCAAGCTTCCTGACTGGTCTTAACACTGGCGATGCAACGTTTTACGCAACTGGTCTTGGT
GCTTGTGGCATCGTAAATAAAGACACTGATTTCATTGCTGCCGCCTCTAAGCACTTGTTCGATGCTTTCCCTGGC
TACGACGGAGCCAACCCCAACAAGAACCCTATGTGTAATCGCAGGGTATCTGCGACATACGAAGGTACCACTATC
GAGGTTGTGCTTACCGACCGGTGTGAGGGATGCGCCCTGACTGCCTTGGATTTCTCTCCATCTGCTTTCAATAAA
CTTGCCGACCCAAGTAAAGGGCGTCTGCATGGCATGACTTGGAAATTCATCTAG
Gene >Agabi119p4|007240
ATGTCCTTCTCAAAGCTCGTCCTTCTTTTTGTCGCTTTCGTCGCCTCTGCCGGCGCTCTCTCCAGCCCTCATCCT
CGCGGCATCCATCACCGCGCCCTCGCTGGCCGCATTACGGTTCCTGAGTCTCCACTCTCCCCCCCTCTTCCCGTT
CGCAGGCGCCAGAACAGCAAGCGCTGCAAGTCTCGCCCTTCCTCTGCTGCCCTCATTGTAAGCACGAAGGACGCC
ACTAGCACGAAAGAGGCTACTCACACAAGAGAGGCCACCCACACCAAAGAGGCTACCCCAACGAAAGAAGTCGTC
CCCACGAAAGAGGCTCCTACCACAAAAGAAACTGAGGCTCCTAAACCTACTACTCACGAAACGACTCACAAGGCC
TCTCCTACCCCCAAGCCGGCCCCACCACCAACGACCAAAGAAGAAGCTCCTGCCCCAACCAAGAAACCGCCCCCT
CCCACCTCGAACCTTCCAAGCTTCCTGACTGGTCTTAACACTGGCGATGCAACGTTTTACGCAAGTAGGTTTTCA
TATCCGCTTCATTTTAGTCCGATTTACCTATTGTAACCTAGCTGGTCTTGGTGCTTGTGGCATCGTAAATAAAGA
CACTGATTTCATTGCTGCCGCCTCTAAGCACTTGTTCGATGCTTTCCCGTGCGTTTCCTTCTACCCTTTCTTGAT
TCCCCTCATTCATTCCATGATCTGTAGTGGCTACGACGGAGCCAACCCCAACAAGAACCCTATGTGTAATCGCAG
GGTATCTGCGACATGTGAGTGTAAATTTTTGATTGCAATAATATAGACTGCTTACGGCCCATCAGACGAAGGTAC
CACTATCGAGGTTGTGCTTACCGACCGGTGTGAGGGATGCGCCCTGACTGCCTTGGATTTCTCTCCATCTGCTTT
CAATAAACTTGCCGACCCAAGTAAAGGGCGTCTGCATGGCATGACTTGGAAATTCATCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail