Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|006830
Gene name
Locationscaffold_01a:1642591..1645741
Strand+
Gene length (bp)3150
Transcript length (bp)2589
Coding sequence length (bp)2589
Protein length (aa) 863

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02278 Lyase_8 Polysaccharide lyase family 8, super-sandwich domain 8.0E-70 486 734
PF08124 Lyase_8_N Polysaccharide lyase family 8, N terminal alpha-helical domain 4.2E-15 248 404
PF02884 Lyase_8_C Polysaccharide lyase family 8, C-terminal beta-sandwich domain 4.9E-13 751 821

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q59288|CSLA_PEDHD Chondroitinase-AC OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / NCIB 9290) GN=cslA PE=1 SV=1 128 857 3.0E-40
sp|Q9AQS0|XANLY_BACGL Xanthan lyase OS=Bacillus sp. (strain GL1) GN=xly PE=1 SV=1 254 774 1.0E-09

GO

GO Term Description Terminal node
GO:0005576 extracellular region Yes
GO:0016829 lyase activity Yes
GO:0003824 catalytic activity No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|006830
MKPLFNLPRTLFFHVSLFLSLLACADLVSSASTSTSSTSLSSTHGIVVPSGSSSSRVLSSLTTSHVQSASSSLST
RISQTSATAPNTSKMTTIATSTFVNPSLNSSATATSTATVTAPSDPAIQEEIEMLRTQVIDIIIGPLGQASAIPA
WLTSLGPDGKWPDSEVDYTTGCPARRANWPAQTHWQRILVMAAAWHGGLQGGENFVGDENLRKKTLLAIDYWFGR
DLTNLECMINGGTPSCPCDDPDNTLWNTNWFSNVILIPNLVGSSCILLNETLTAAQLDHCTKITNRSYDLFLRPF
NEVNFLTGANVLDVAKIGIDGALLNPNITQITDAYRRIHEEVVIQPAIKADGIRPDGSFGQHGGVLYNGNYGKDF
TNDIVAFEIEAAETRFAANSESRSALALLFEGDHWMIFRNTITGVLHWDFSALGRFISFPVIDAQATGSIKLNLT
QIEVLGRLWDQPALVQFAESLSEHDMNANAGQLIGNRMFYNNDYMVHRGPNYVTTVKMYSTRTKYGECLNSQNIL
GFHLSDGAVYTYLKGNEYEDIAVAWDWNLIPGITTDYEATKLTCSSGVTGIEDFVGGVSNDDTGIAVMRYTNPLT
GDLNWQKAWFFLEGDVQHTMISNITSTSDSPVFSVLDQRLHDDAIFMDDGEPFRANDGPTPLSSATLWHGGVGYD
LSGLGDDDILHVEVGPKSGNWSAIGTSTEPPSTFDLFAAWIEHGTPASSISYSTFPGTSFTGFMGKQGKLRLQSV
VNDGSVGAIYDEEHQTVMVVFWEEDGGSVTIRPPRLAPITISADGNIALIYRFSDAAVYVSDPSQTLTEVQVNLQ
LGTGWKPPLWGFHRSKDFSIFLPTGGLAGSSVRQPLN*
Coding >Agabi119p4|006830
ATGAAGCCTCTCTTCAATCTCCCTCGTACTCTCTTTTTCCACGTCTCTTTGTTCCTTTCCCTCTTGGCGTGCGCC
GATCTGGTTTCAAGCGCGTCCACCTCTACATCATCCACCTCTTTATCCTCAACTCATGGCATTGTTGTGCCATCC
GGTTCTTCATCATCTCGGGTGCTTTCCTCTCTGACCACCTCACATGTACAATCTGCATCGTCCTCTTTGAGCACT
CGTATATCGCAGACATCTGCTACTGCCCCCAATACATCCAAGATGACGACTATAGCCACTTCAACCTTTGTCAAT
CCTTCTTTGAATTCATCTGCCACAGCAACGTCCACTGCTACGGTGACTGCGCCTTCCGATCCCGCTATACAGGAA
GAAATAGAAATGTTGCGAACCCAAGTAATCGACATTATCATTGGCCCACTTGGTCAAGCGAGTGCAATACCTGCT
TGGTTGACATCCCTGGGTCCTGATGGCAAATGGCCTGATAGTGAAGTTGACTATACAACTGGCTGCCCTGCCCGC
CGGGCCAACTGGCCAGCCCAGACACATTGGCAGCGAATTCTCGTGATGGCAGCTGCATGGCACGGCGGATTACAA
GGAGGGGAAAACTTCGTCGGAGATGAAAATCTCCGTAAGAAAACACTACTGGCTATAGACTATTGGTTCGGGCGT
GATCTCACCAATCTTGAATGCATGATCAACGGTGGTACTCCGTCTTGTCCATGTGATGATCCTGATAATACCCTG
TGGAACACCAACTGGTTTTCTAATGTTATACTGATTCCGAACCTCGTTGGGTCATCATGCATACTGTTGAACGAG
ACTTTGACCGCGGCACAGTTGGATCACTGTACAAAAATAACCAACCGCTCATATGATCTCTTCTTGCGCCCATTT
AATGAAGTCAACTTTCTGACAGGTGCAAATGTTTTGGATGTCGCCAAAATTGGAATTGATGGGGCTCTACTCAAC
CCCAATATCACACAAATAACCGATGCATATCGTCGCATACATGAAGAGGTTGTAATTCAACCAGCTATCAAAGCC
GATGGTATCAGACCTGATGGGTCTTTCGGTCAGCATGGTGGTGTTCTCTACAACGGTAACTACGGCAAGGACTTT
ACAAACGACATCGTGGCCTTTGAAATTGAGGCGGCCGAGACACGTTTTGCTGCAAATTCCGAGTCTCGATCCGCT
CTTGCTCTTCTCTTCGAAGGTGACCATTGGATGATTTTTCGCAACACCATCACGGGGGTGCTACACTGGGATTTC
TCTGCTCTTGGGCGATTTATCAGCTTTCCTGTCATCGATGCTCAGGCCACCGGAAGTATCAAACTAAATCTTACT
CAGATTGAGGTCCTCGGGCGGCTTTGGGATCAACCGGCTCTTGTCCAATTTGCCGAAAGTCTTTCTGAACACGAC
ATGAATGCCAATGCAGGTCAGCTCATCGGCAATCGTATGTTCTACAACAACGACTACATGGTTCACCGTGGCCCG
AACTACGTTACTACTGTTAAGATGTATTCCACAAGAACAAAGTATGGTGAATGTCTAAACTCTCAGAATATATTG
GGTTTCCATCTCTCAGACGGAGCTGTATACACCTATTTGAAGGGCAATGAGTATGAAGATATTGCTGTCGCCTGG
GACTGGAACCTTATTCCGGGAATTACTACCGACTATGAAGCGACCAAACTTACTTGTTCCAGCGGCGTCACTGGG
ATTGAAGATTTCGTTGGTGGTGTGTCTAATGACGACACTGGTATCGCCGTCATGCGCTACACGAATCCCTTGACT
GGCGACTTGAATTGGCAAAAAGCGTGGTTTTTCCTCGAGGGCGACGTCCAGCACACCATGATTTCCAATATCACA
TCCACATCCGACAGCCCTGTCTTCTCCGTACTTGACCAACGTCTCCATGATGACGCTATTTTCATGGATGACGGT
GAACCGTTCAGAGCCAATGATGGACCTACTCCTTTGTCTTCAGCGACGCTTTGGCATGGCGGTGTAGGTTATGAC
CTGTCGGGCCTTGGAGATGATGACATCCTCCACGTTGAGGTTGGTCCAAAGTCAGGGAACTGGTCAGCGATCGGC
ACTTCAACTGAACCACCATCAACATTTGACCTCTTCGCTGCCTGGATTGAACACGGAACGCCCGCATCATCTATT
TCCTATTCCACATTCCCTGGTACCAGTTTCACTGGTTTCATGGGCAAGCAGGGCAAGCTTCGTTTGCAATCTGTT
GTGAATGACGGGAGCGTGGGGGCCATATACGACGAGGAACACCAAACAGTAATGGTTGTGTTTTGGGAAGAAGAT
GGTGGTAGTGTTACAATCAGACCCCCGAGATTGGCCCCGATCACTATTAGCGCGGACGGCAACATAGCTCTGATT
TATCGGTTTTCAGACGCTGCAGTTTATGTGTCAGATCCTTCTCAAACGCTTACGGAAGTACAAGTCAATTTGCAA
TTGGGTACGGGCTGGAAGCCACCATTATGGGGTTTCCACAGGTCCAAAGACTTCAGTATATTCCTTCCAACGGGT
GGCCTAGCAGGTAGTAGCGTGCGCCAGCCATTGAATTAG
Transcript >Agabi119p4|006830
ATGAAGCCTCTCTTCAATCTCCCTCGTACTCTCTTTTTCCACGTCTCTTTGTTCCTTTCCCTCTTGGCGTGCGCC
GATCTGGTTTCAAGCGCGTCCACCTCTACATCATCCACCTCTTTATCCTCAACTCATGGCATTGTTGTGCCATCC
GGTTCTTCATCATCTCGGGTGCTTTCCTCTCTGACCACCTCACATGTACAATCTGCATCGTCCTCTTTGAGCACT
CGTATATCGCAGACATCTGCTACTGCCCCCAATACATCCAAGATGACGACTATAGCCACTTCAACCTTTGTCAAT
CCTTCTTTGAATTCATCTGCCACAGCAACGTCCACTGCTACGGTGACTGCGCCTTCCGATCCCGCTATACAGGAA
GAAATAGAAATGTTGCGAACCCAAGTAATCGACATTATCATTGGCCCACTTGGTCAAGCGAGTGCAATACCTGCT
TGGTTGACATCCCTGGGTCCTGATGGCAAATGGCCTGATAGTGAAGTTGACTATACAACTGGCTGCCCTGCCCGC
CGGGCCAACTGGCCAGCCCAGACACATTGGCAGCGAATTCTCGTGATGGCAGCTGCATGGCACGGCGGATTACAA
GGAGGGGAAAACTTCGTCGGAGATGAAAATCTCCGTAAGAAAACACTACTGGCTATAGACTATTGGTTCGGGCGT
GATCTCACCAATCTTGAATGCATGATCAACGGTGGTACTCCGTCTTGTCCATGTGATGATCCTGATAATACCCTG
TGGAACACCAACTGGTTTTCTAATGTTATACTGATTCCGAACCTCGTTGGGTCATCATGCATACTGTTGAACGAG
ACTTTGACCGCGGCACAGTTGGATCACTGTACAAAAATAACCAACCGCTCATATGATCTCTTCTTGCGCCCATTT
AATGAAGTCAACTTTCTGACAGGTGCAAATGTTTTGGATGTCGCCAAAATTGGAATTGATGGGGCTCTACTCAAC
CCCAATATCACACAAATAACCGATGCATATCGTCGCATACATGAAGAGGTTGTAATTCAACCAGCTATCAAAGCC
GATGGTATCAGACCTGATGGGTCTTTCGGTCAGCATGGTGGTGTTCTCTACAACGGTAACTACGGCAAGGACTTT
ACAAACGACATCGTGGCCTTTGAAATTGAGGCGGCCGAGACACGTTTTGCTGCAAATTCCGAGTCTCGATCCGCT
CTTGCTCTTCTCTTCGAAGGTGACCATTGGATGATTTTTCGCAACACCATCACGGGGGTGCTACACTGGGATTTC
TCTGCTCTTGGGCGATTTATCAGCTTTCCTGTCATCGATGCTCAGGCCACCGGAAGTATCAAACTAAATCTTACT
CAGATTGAGGTCCTCGGGCGGCTTTGGGATCAACCGGCTCTTGTCCAATTTGCCGAAAGTCTTTCTGAACACGAC
ATGAATGCCAATGCAGGTCAGCTCATCGGCAATCGTATGTTCTACAACAACGACTACATGGTTCACCGTGGCCCG
AACTACGTTACTACTGTTAAGATGTATTCCACAAGAACAAAGTATGGTGAATGTCTAAACTCTCAGAATATATTG
GGTTTCCATCTCTCAGACGGAGCTGTATACACCTATTTGAAGGGCAATGAGTATGAAGATATTGCTGTCGCCTGG
GACTGGAACCTTATTCCGGGAATTACTACCGACTATGAAGCGACCAAACTTACTTGTTCCAGCGGCGTCACTGGG
ATTGAAGATTTCGTTGGTGGTGTGTCTAATGACGACACTGGTATCGCCGTCATGCGCTACACGAATCCCTTGACT
GGCGACTTGAATTGGCAAAAAGCGTGGTTTTTCCTCGAGGGCGACGTCCAGCACACCATGATTTCCAATATCACA
TCCACATCCGACAGCCCTGTCTTCTCCGTACTTGACCAACGTCTCCATGATGACGCTATTTTCATGGATGACGGT
GAACCGTTCAGAGCCAATGATGGACCTACTCCTTTGTCTTCAGCGACGCTTTGGCATGGCGGTGTAGGTTATGAC
CTGTCGGGCCTTGGAGATGATGACATCCTCCACGTTGAGGTTGGTCCAAAGTCAGGGAACTGGTCAGCGATCGGC
ACTTCAACTGAACCACCATCAACATTTGACCTCTTCGCTGCCTGGATTGAACACGGAACGCCCGCATCATCTATT
TCCTATTCCACATTCCCTGGTACCAGTTTCACTGGTTTCATGGGCAAGCAGGGCAAGCTTCGTTTGCAATCTGTT
GTGAATGACGGGAGCGTGGGGGCCATATACGACGAGGAACACCAAACAGTAATGGTTGTGTTTTGGGAAGAAGAT
GGTGGTAGTGTTACAATCAGACCCCCGAGATTGGCCCCGATCACTATTAGCGCGGACGGCAACATAGCTCTGATT
TATCGGTTTTCAGACGCTGCAGTTTATGTGTCAGATCCTTCTCAAACGCTTACGGAAGTACAAGTCAATTTGCAA
TTGGGTACGGGCTGGAAGCCACCATTATGGGGTTTCCACAGGTCCAAAGACTTCAGTATATTCCTTCCAACGGGT
GGCCTAGCAGGTAGTAGCGTGCGCCAGCCATTGAATTAG
Gene >Agabi119p4|006830
ATGAAGCCTCTCTTCAATCTCCCTCGTACTCTCTTTTTCCACGTCTCTTTGTTCCTTTCCCTCTTGGCGTGCGCC
GATCTGGTTTCAAGCGCGTCCACCTCTACATCATCCACCTCTTTATCCTCAACTCATGGCATTGTTGTGCCATCC
GGTTCTTCATCATCTCGGGTGCTTTCCTCTCTGACCACCTCACATGTACAATCTGCATCGTCCTCTTTGAGCACT
CGTATATCGCAGACATCTGCTACTGCCCCCAATACATCCAAGATGACGACTATAGCCACTTCAACCTTTGTCAAT
CCTTCTTTGAATTCATCTGCCACAGCAACGTCCACTGCTACGGTGACTGCGCCTTCCGATCCCGCTATACAGGAA
GAAATAGAAATGTTGCGAACCCAAGTAATCGACATTATCATTGGCCCACTTGGTCAAGCGAGTGCAATACCTGCT
TGGTTTGTGTTGAACATTATAACCAGGTCTCGAACAGCAATAGCTAATCCACACTAGGTTGACATCCCTGGGTCC
TGATGGCAAATGGCCTGATAGTGAAGTTGACTATACAACTGGCTGCCCTGCCCGCCGGGCCAACTGGCCAGCCCA
GACACATTGGCAGCGAATTCGTGAGTTCTTGCTTGGGGAGATCGTGGAAAAGCCTTCTCATGAATTTTAGTCGTG
ATGGCAGCTGCATGGCACGGCGGATTACAAGGAGGGGAAAACTTCGTCGGAGATGAAAATCTCCGTAAGAAAACA
CTACTGGCTATAGACTATTGGTTCGGGCGTGATCTCACCAATCTTGAATGCATGATCAACGGTGGTACTCCGTCT
TGTCCATGTGATGATCCTGATAATACCCTGTGGTATGAAGATGCCGCATTGAAATAAGGGCTGCTACTGAAATAT
TCTTTCAAGGAACACCAACTGGTTTTCTAATGTTCGTCGCTGTCTTCTGTTTAGCACCCATCACCAATTGATTGT
ACTAGGTTATACTGATTCCGAACCTCGTTGGGTCATCATGCATACTGTTGAACGAGACTTTGACCGCGGCACAGT
TGGATCACTGTACAAAAATAACCAACCGCTCATATGATCTCTTCTTGCGCCCATTTAATGAAGTCAACTTTCTGA
CAGGTGCAAATGTTTTGGATGTCGCCAAAATTGGAATTGATGGGGCTCTACTCAACCCCAATATCACACAAATAA
CCGATGCATATCGTCGCATACATGAAGAGGTTGTAATTCAACCAGCTATCAAAGCCGATGGTATCAGACCTGATG
GGTCTTTCGGTGCGATATCATCTGCATTCTGATTCCTTGTCTCATTTCTGTATTTCAGGTCAGCATGGTGGTGTT
CTCTACAACGGTAACTACGGTAAGTGGGGTTGATTGAGTTCATAATATGTTTCGTGTGCTCAGGTTTTTTGCAGG
CAAGGACTTGTGAGTGAAGAATTGGAATTGAGGAACTCTCATATTGATTCTTCGAAGTACAAACGACATCGTGGC
CTTTGAAATTGAGGCGGCCGAGACACGTTTTGCTGCAAATTCCGAGTCTCGATCCGCTCTTGCTCTTCTCTTCGA
AGGTGACCATTGGATGATTTTTCGCAACACCATCACGGGGGTGCTACACTGGGATTTCGTGAGTACCTCACTAAT
CTCATTTGACTCTTACTCAGTCAGGTCTAGTCTGCTCTTGGGCGATTTATCAGCTTTCCTGTCATCGATGCTCAG
TACGTTCTATTCTACTTTTCCCTATCGGATAAACGTAAAATAATCTCTTTAGGGCCACCGGAAGTATCAAACTAA
ATCTTACTCAGATTGAGGTCCTCGGGCGGCTTTGGGATCAACCGGCTCTTGTCCAATTTGCCGAAAGTCTTTCTG
AACACGACATGAATGCCAATGCAGGTCAGCTCATCGGCAATCGTATGTTCTACAACAACGACTACATGGTTAGCT
TCCTCGCCTCCAAGCCTAGATTCTGATTTATAGTTCGTCAGGTTCACCGTGGCCCGAACTACGTTACTACTGTTA
AGATGTATTCCACAAGAACAAAGTATGGTGAATGTCTAAACTCTCAGAATGTATGTATTGTTGGACTTCCATTGT
TCGGGCTCTCCTTCATCGATACTCCTTTAGATATTGGGTTTCCATCTCTCAGACGGAGCTGTATACACCTATTTG
AAGGGCAATGAGTATGAAGATATTGCTGTCGCCTGGGACTGGAACCTTATTCCGGGAATTACTACCGACTATGAA
GCGACCAAACTTACTTGTTCCAGCGGCGTCACTGGGATTGAAGATTTCGTTGGTGGTGTGTCTAATGACGACACT
GGTATCGCCGTCATGCGCTACACGAATCCCTTGACTGGCGACTTGAATTGGCAAAAAGCGTGGTTTTTCCTCGAG
GGCGACGTCCAGCACACCATGATTTCCAATATCACATCCACATCCGACAGCCCTGTCTTCTCCGTACTTGACCAA
CGTCTCCATGATGACGCTATTTTCATGGATGACGGTGAACCGTTCAGAGCCAATGATGGACCTACTCCTTTGTCT
TCAGCGACGCTTTGGCATGGCGGTGTAGGTTATGACCTGTCGGGCCTTGGAGATGATGACATCCTCCACGTTGAG
GTTGGTCCAAAGTCAGGGAACTGGTCAGCGATCGGCACTTCAACTGAACCACCATCAACATTTGACCTCTTCGCT
GCCTGGATTGAACACGGAACGCCCGCATCATCTATTTCCTATTCCACATTCCCTGGTACCAGTTTCACTGGTTTC
ATGGGCAAGCAGGGCAAGCTTCGTTTGCAATCTGTTGTGAATGACGGGAGCGTGGGGGCCATATACGACGAGGAA
CACCAAACAGTAATGGTTGTGTTTTGGGAAGAAGATGGTGGTAGTGTTACAATCAGACCCCCGAGATTGGCCCCG
ATCACTATTAGCGCGGACGGCAACATAGCTCTGATTTATCGGTTTTCAGACGCTGCAGTTTATGTGTCAGATCCT
TCTCAAACGCTTACGGAAGTACAAGTCAATTTGCAATTGGGTACGGGCTGGAAGCCACCATTATGGGGTTTCCAC
AGGTCCAAAGACTTCAGTATATTCCTTCCAACGGGTGGCCTAGCAGGTAGTAGCGTGCGCCAGCCATTGAATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail