Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|006580
Gene name
Locationscaffold_01a:1582097..1587794
Strand-
Gene length (bp)5697
Transcript length (bp)4521
Coding sequence length (bp)4521
Protein length (aa) 1507

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00136 DNA_pol_B DNA polymerase family B 1.6E-100 887 1334
PF03104 DNA_pol_B_exo1 DNA polymerase family B, exonuclease domain 8.8E-06 41 139
PF03104 DNA_pol_B_exo1 DNA polymerase family B, exonuclease domain 6.0E-13 655 821
PF14260 zf-C4pol C4-type zinc-finger of DNA polymerase delta 2.4E-12 1394 1463

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P14284|DPOZ_YEAST DNA polymerase zeta catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REV3 PE=1 SV=1 501 1470 0.0E+00
sp|O60673|DPOLZ_HUMAN DNA polymerase zeta catalytic subunit OS=Homo sapiens GN=REV3L PE=1 SV=2 626 1483 0.0E+00
sp|Q61493|DPOLZ_MOUSE DNA polymerase zeta catalytic subunit OS=Mus musculus GN=Rev3l PE=1 SV=3 626 1483 0.0E+00
sp|Q9P6L6|DPOZ_SCHPO DNA polymerase zeta catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rev3 PE=3 SV=1 489 1468 0.0E+00
sp|Q766Z3|REV3_ARATH DNA polymerase zeta catalytic subunit OS=Arabidopsis thaliana GN=REV3 PE=2 SV=1 609 1470 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P14284|DPOZ_YEAST DNA polymerase zeta catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REV3 PE=1 SV=1 501 1470 0.0E+00
sp|O60673|DPOLZ_HUMAN DNA polymerase zeta catalytic subunit OS=Homo sapiens GN=REV3L PE=1 SV=2 626 1483 0.0E+00
sp|Q61493|DPOLZ_MOUSE DNA polymerase zeta catalytic subunit OS=Mus musculus GN=Rev3l PE=1 SV=3 626 1483 0.0E+00
sp|Q9P6L6|DPOZ_SCHPO DNA polymerase zeta catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rev3 PE=3 SV=1 489 1468 0.0E+00
sp|Q766Z3|REV3_ARATH DNA polymerase zeta catalytic subunit OS=Arabidopsis thaliana GN=REV3 PE=2 SV=1 609 1470 0.0E+00
sp|Q54N97|DPOD1_DICDI DNA polymerase delta catalytic subunit OS=Dictyostelium discoideum GN=pold1 PE=3 SV=1 659 1479 9.0E-84
sp|P30316|DPOD_SCHPO DNA polymerase delta catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol3 PE=1 SV=2 657 1479 3.0E-81
sp|P30315|DPOD1_PLAFK DNA polymerase delta catalytic subunit OS=Plasmodium falciparum (isolate K1 / Thailand) GN=POLD1 PE=3 SV=1 657 1472 5.0E-81
sp|P46588|DPOD_CANAX DNA polymerase delta catalytic subunit OS=Candida albicans GN=POL3 PE=3 SV=2 724 1467 4.0E-80
sp|P54358|DPOD1_DROME DNA polymerase delta catalytic subunit OS=Drosophila melanogaster GN=DNApol-delta PE=2 SV=2 722 1471 1.0E-79
sp|Q9LRE6|DPOD1_ORYSJ DNA polymerase delta catalytic subunit OS=Oryza sativa subsp. japonica GN=POLD1 PE=2 SV=1 623 1475 1.0E-79
sp|P97283|DPOD1_MESAU DNA polymerase delta catalytic subunit OS=Mesocricetus auratus GN=POLD1 PE=2 SV=1 657 1471 1.0E-78
sp|P52431|DPOD1_MOUSE DNA polymerase delta catalytic subunit OS=Mus musculus GN=Pold1 PE=1 SV=2 657 1471 1.0E-78
sp|P28340|DPOD1_HUMAN DNA polymerase delta catalytic subunit OS=Homo sapiens GN=POLD1 PE=1 SV=2 657 1476 4.0E-78
sp|Q9LVN7|DPOD1_ARATH DNA polymerase delta catalytic subunit OS=Arabidopsis thaliana GN=POLD1 PE=2 SV=2 633 1470 9.0E-78
sp|O54747|DPOD1_RAT DNA polymerase delta catalytic subunit OS=Rattus norvegicus GN=Pold1 PE=2 SV=1 657 1471 1.0E-77
sp|P28339|DPOD1_BOVIN DNA polymerase delta catalytic subunit OS=Bos taurus GN=POLD1 PE=1 SV=1 657 1471 5.0E-77
sp|P90829|DPOD1_CAEEL DNA polymerase delta catalytic subunit OS=Caenorhabditis elegans GN=F10C2.4 PE=3 SV=1 727 1492 6.0E-73
sp|O48901|DPOD1_SOYBN DNA polymerase delta catalytic subunit OS=Glycine max GN=POLD1 PE=2 SV=1 644 1333 2.0E-70
sp|P15436|DPOD_YEAST DNA polymerase delta catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL3 PE=1 SV=4 723 1329 4.0E-67
sp|P03198|DPOL_EBVB9 DNA polymerase catalytic subunit OS=Epstein-Barr virus (strain B95-8) GN=BALF5 PE=1 SV=1 723 1304 1.0E-52
sp|Q3KSP1|DPOL_EBVG DNA polymerase catalytic subunit OS=Epstein-Barr virus (strain GD1) GN=BALF5 PE=3 SV=1 723 1304 2.0E-52
sp|Q1HVC1|DPOL_EBVA8 DNA polymerase catalytic subunit OS=Epstein-Barr virus (strain AG876) GN=BALF5 PE=3 SV=1 723 1304 2.0E-52
sp|P52367|DPOL_EHV2 DNA polymerase catalytic subunit OS=Equine herpesvirus 2 (strain 86/87) GN=9 PE=3 SV=1 723 1304 9.0E-50
sp|P24907|DPOL_SHV21 DNA polymerase catalytic subunit OS=Saimiriine herpesvirus 2 (strain 11) GN=9 PE=3 SV=1 723 1304 2.0E-49
sp|Q2HRD0|DPOL_HHV8P DNA polymerase catalytic subunit OS=Human herpesvirus 8 type P (isolate GK18) GN=ORF9 PE=3 SV=1 723 1304 1.0E-47
sp|O36363|DPOL_ALHV1 DNA polymerase catalytic subunit OS=Alcelaphine herpesvirus 1 (strain C500) GN=9 PE=3 SV=1 723 1304 2.0E-46
sp|P52342|DPOL_HHV7J DNA polymerase catalytic subunit OS=Human herpesvirus 7 (strain JI) GN=U38 PE=3 SV=1 723 1288 3.0E-46
sp|Q9QJ32|DPOL_HHV6Z DNA polymerase catalytic subunit OS=Human herpesvirus 6B (strain Z29) GN=U38 PE=3 SV=1 712 1304 1.0E-45
sp|P28857|DPOL_HHV6U DNA polymerase catalytic subunit OS=Human herpesvirus 6A (strain Uganda-1102) GN=U38 PE=3 SV=1 712 1304 2.0E-45
sp|Q69025|DPOL_GPCMV DNA polymerase OS=Guinea pig cytomegalovirus (strain 22122) GN=UL54 PE=3 SV=3 681 1295 4.0E-40
sp|P09252|DPOL_VZVD DNA polymerase catalytic subunit OS=Varicella-zoster virus (strain Dumas) GN=ORF28 PE=3 SV=1 722 1288 6.0E-39
sp|P04292|DPOL_HHV1K DNA polymerase catalytic subunit OS=Human herpesvirus 1 (strain KOS) GN=UL30 PE=1 SV=1 722 1219 9.0E-39
sp|Q9DKT8|DPOL_ELHVK DNA polymerase catalytic subunit OS=Elephantid herpesvirus 1 (isolate Asian elephant/Berlin/Kiba/1998) PE=3 SV=1 723 1325 1.0E-38
sp|Q4JQU7|DPOL_VZVO DNA polymerase catalytic subunit OS=Varicella-zoster virus (strain Oka vaccine) GN=ORF28 PE=3 SV=1 722 1288 1.0E-38
sp|P07917|DPOL_HHV1A DNA polymerase catalytic subunit OS=Human herpesvirus 1 (strain Angelotti) GN=UL30 PE=1 SV=1 722 1219 2.0E-38
sp|P09854|DPOL_HHV1S DNA polymerase catalytic subunit OS=Human herpesvirus 1 (strain SC16) GN=UL30 PE=3 SV=1 722 1219 2.0E-38
sp|P04293|DPOL_HHV11 DNA polymerase catalytic subunit OS=Human herpesvirus 1 (strain 17) GN=UL30 PE=1 SV=2 722 1219 2.0E-38
sp|P07918|DPOL_HHV21 DNA polymerase catalytic subunit OS=Human herpesvirus 2 (strain 186) GN=UL30 PE=3 SV=1 722 1219 2.0E-36
sp|P56689|DPOL_THEGO DNA polymerase OS=Thermococcus gorgonarius GN=pol PE=1 SV=1 688 1337 5.0E-36
sp|Q6UDK1|DPOL_PSHV1 DNA polymerase catalytic subunit OS=Psittacid herpesvirus 1 (isolate Amazon parrot/-/97-0001/1997) GN=UL30 PE=3 SV=1 697 1341 9.0E-36
sp|P89453|DPOL_HHV2H DNA polymerase catalytic subunit OS=Human herpesvirus 2 (strain HG52) GN=UL30 PE=3 SV=1 722 1219 1.0E-35
sp|P30321|DPOL_PBCV1 DNA polymerase OS=Paramecium bursaria Chlorella virus 1 GN=DPO PE=3 SV=2 724 1333 1.0E-35
sp|O71121|DPOL_RHCM6 DNA polymerase catalytic subunit OS=Rhesus cytomegalovirus (strain 68-1) GN=UL54 PE=3 SV=1 723 1220 7.0E-34
sp|Q56366|DPOL_THES9 DNA polymerase OS=Thermococcus sp. (strain 9oN-7) GN=pol PE=1 SV=1 717 1337 1.0E-33
sp|P30320|DPOL_PBCVN DNA polymerase OS=Paramecium bursaria Chlorella virus NY2A GN=DPO PE=3 SV=1 793 1357 5.0E-33
sp|P27172|DPOL_MUHVS DNA polymerase catalytic subunit OS=Murid herpesvirus 1 (strain Smith) GN=UL54 PE=3 SV=1 713 1358 1.0E-32
sp|A7U6F2|DPOL_POV01 DNA polymerase OS=Pyramimonas orientalis virus GN=dpo PE=3 SV=1 723 1335 1.0E-32
sp|P28040|DPOA_SCHPO DNA polymerase alpha catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol1 PE=1 SV=1 723 1346 3.0E-31
sp|Q85428|DPOL_RCMVM DNA polymerase catalytic subunit OS=Rat cytomegalovirus (strain Maastricht) GN=UL54 PE=3 SV=2 919 1289 5.0E-31
sp|Q9E6N9|DPOL_GAHVM DNA polymerase catalytic subunit OS=Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) GN=MDV043 PE=3 SV=1 722 1293 8.0E-31
sp|Q7SIG7|DPOL_DESST DNA polymerase OS=Desulfurococcus sp. (strain Tok) GN=pol PE=1 SV=1 688 1337 1.0E-30
sp|P08546|DPOL_HCMVA DNA polymerase catalytic subunit OS=Human cytomegalovirus (strain AD169) GN=UL54 PE=1 SV=2 935 1298 4.0E-29
sp|Q6SW77|DPOL_HCMVM DNA polymerase catalytic subunit OS=Human cytomegalovirus (strain Merlin) GN=UL54 PE=3 SV=1 935 1298 4.0E-29
sp|P28858|DPOL_EHV1B DNA polymerase catalytic subunit OS=Equine herpesvirus 1 (strain Ab4p) GN=30 PE=3 SV=1 722 1288 5.0E-29
sp|Q6S6P1|DPOL_EHV1V DNA polymerase catalytic subunit OS=Equine herpesvirus 1 (strain V592) GN=30 PE=3 SV=1 722 1288 5.0E-29
sp|Q94636|DPOLA_STENO DNA polymerase alpha catalytic subunit OS=Sterkiella nova PE=3 SV=1 695 1333 7.0E-29
sp|Q54SV8|DPOLA_DICDI DNA polymerase alpha catalytic subunit OS=Dictyostelium discoideum GN=pola1 PE=3 SV=1 717 1339 7.0E-28
sp|O89042|DPOLA_RAT DNA polymerase alpha catalytic subunit (Fragment) OS=Rattus norvegicus GN=Pola1 PE=2 SV=1 714 1332 3.0E-27
sp|Q9HH06|DPOL_PYRGL DNA polymerase OS=Pyrococcus glycovorans GN=pol PE=3 SV=1 717 1337 5.0E-27
sp|P27727|DPOLA_TRYBB DNA polymerase alpha catalytic subunit OS=Trypanosoma brucei brucei PE=3 SV=1 647 1332 8.0E-27
sp|Q196U0|DPOL_IIV3 DNA polymerase 120R OS=Invertebrate iridescent virus 3 GN=IIV3-120R PE=3 SV=1 723 1258 1.0E-26
sp|P26019|DPOLA_DROME DNA polymerase alpha catalytic subunit OS=Drosophila melanogaster GN=DNApol-alpha180 PE=1 SV=2 797 1397 5.0E-26
sp|P61876|DPOL_PYRWO DNA polymerase OS=Pyrococcus woesei GN=pol PE=1 SV=1 690 1337 1.0E-25
sp|P61875|DPOL_PYRFU DNA polymerase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pol PE=1 SV=1 690 1337 1.0E-25
sp|P0CL77|DPOL_PYRAB DNA polymerase 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=polI PE=1 SV=1 655 1337 9.0E-25
sp|P14284|DPOZ_YEAST DNA polymerase zeta catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REV3 PE=1 SV=1 2 255 2.0E-24
sp|P0CL76|DPOL_PYRAY DNA polymerase 1 OS=Pyrococcus abyssi GN=polI PE=1 SV=1 655 1337 2.0E-24
sp|P33609|DPOLA_MOUSE DNA polymerase alpha catalytic subunit OS=Mus musculus GN=Pola1 PE=1 SV=2 714 1332 3.0E-24
sp|P09884|DPOLA_HUMAN DNA polymerase alpha catalytic subunit OS=Homo sapiens GN=POLA1 PE=1 SV=2 714 1332 4.0E-24
sp|O00874|DPOLA_LEIDO DNA polymerase alpha catalytic subunit OS=Leishmania donovani PE=3 SV=1 934 1332 8.0E-24
sp|Q27152|DPOLA_OXYTR DNA polymerase alpha catalytic subunit OS=Oxytricha trifallax PE=3 SV=1 928 1340 2.0E-23
sp|O48653|DPOLA_ORYSJ DNA polymerase alpha catalytic subunit OS=Oryza sativa subsp. japonica GN=Os01g0868300 PE=2 SV=2 718 1332 4.0E-23
sp|O29753|DPOL_ARCFU DNA polymerase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pol PE=3 SV=1 657 1337 2.0E-22
sp|Q9DE46|DPOLA_XENLA DNA polymerase alpha catalytic subunit OS=Xenopus laevis GN=pola1 PE=1 SV=1 714 1332 4.0E-22
sp|Q9FHA3|DPOLA_ARATH DNA polymerase alpha catalytic subunit OS=Arabidopsis thaliana GN=POLA PE=3 SV=2 718 1332 6.0E-22
sp|Q61493|DPOLZ_MOUSE DNA polymerase zeta catalytic subunit OS=Mus musculus GN=Rev3l PE=1 SV=3 1 243 2.0E-21
sp|O93746|DPOL2_AERPE DNA polymerase 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=polB PE=3 SV=3 674 1338 2.0E-21
sp|O70736|DPOL_RSIV DNA polymerase OS=Red sea bream iridovirus PE=3 SV=1 793 1325 2.0E-21
sp|O60673|DPOLZ_HUMAN DNA polymerase zeta catalytic subunit OS=Homo sapiens GN=REV3L PE=1 SV=2 1 243 3.0E-21
sp|Q9P6L6|DPOZ_SCHPO DNA polymerase zeta catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rev3 PE=3 SV=1 2 242 1.0E-20
sp|O27276|DPOL1_METTH DNA polymerase PolB subunit 1 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=polB1 PE=1 SV=1 645 1126 2.0E-20
sp|Q9YUS2|DPOL_TUHV2 DNA polymerase catalytic subunit OS=Tupaiid herpesvirus (strain 2) GN=DPOL PE=3 SV=1 1011 1325 2.0E-18
sp|Q9YUS3|DPOL_TUHV1 DNA polymerase catalytic subunit OS=Tupaiid herpesvirus 1 (strain 1) GN=DPOL PE=3 SV=1 1011 1325 2.0E-18
sp|P52025|DPOL_METVO DNA polymerase OS=Methanococcus voltae GN=pol PE=3 SV=1 718 1337 3.0E-18
sp|A7U6F1|DPOL_CEV01 DNA polymerase OS=Chrysochromulina ericina virus GN=dpo PE=3 SV=1 1059 1356 5.0E-18
sp|P21189|DPO2_ECOLI DNA polymerase II OS=Escherichia coli (strain K12) GN=polB PE=1 SV=2 715 1336 4.0E-17
sp|Q766Z3|REV3_ARATH DNA polymerase zeta catalytic subunit OS=Arabidopsis thaliana GN=REV3 PE=2 SV=1 1 162 3.0E-16
sp|Q4U3V0|DPOL_TNAVC DNA polymerase OS=Trichoplusia ni ascovirus 2c GN=ORF1 PE=3 SV=2 1012 1249 2.0E-15
sp|A4KX57|DPOL_HVAVE DNA polymerase OS=Heliothis virescens ascovirus 3e GN=ORF1 PE=3 SV=1 1017 1249 4.0E-14
sp|P13382|DPOA_YEAST DNA polymerase alpha catalytic subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL1 PE=1 SV=2 934 1344 4.0E-14
sp|P77933|DPOL_THEKO DNA polymerase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pol PE=1 SV=3 1082 1337 8.0E-13
sp|Q9YUS2|DPOL_TUHV2 DNA polymerase catalytic subunit OS=Tupaiid herpesvirus (strain 2) GN=DPOL PE=3 SV=1 723 971 1.0E-12
sp|Q5UQR0|DPOL_MIMIV DNA polymerase OS=Acanthamoeba polyphaga mimivirus GN=POLB PE=3 SV=1 1105 1344 1.0E-12
sp|Q9YUS3|DPOL_TUHV1 DNA polymerase catalytic subunit OS=Tupaiid herpesvirus 1 (strain 1) GN=DPOL PE=3 SV=1 723 971 2.0E-12
sp|Q6GZR5|DPOL_FRG3G Putative DNA polymerase 060R OS=Frog virus 3 (isolate Goorha) GN=FV3-060R PE=3 SV=1 1009 1337 2.0E-12
sp|Q9HH05|DPOL_THEHY DNA polymerase (Fragment) OS=Thermococcus hydrothermalis GN=pol PE=1 SV=1 717 1064 3.0E-11
sp|Q58295|DPOL_METJA DNA polymerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pol PE=3 SV=2 1061 1338 2.0E-10
sp|Q779J8|DPOL_SFAVA DNA polymerase OS=Spodoptera frugiperda ascovirus 1a GN=ORF1 PE=3 SV=1 1017 1249 1.0E-09
sp|P28339|DPOD1_BOVIN DNA polymerase delta catalytic subunit OS=Bos taurus GN=POLD1 PE=1 SV=1 5 249 2.0E-09
sp|O54747|DPOD1_RAT DNA polymerase delta catalytic subunit OS=Rattus norvegicus GN=Pold1 PE=2 SV=1 27 249 4.0E-09
sp|Q51334|DPOL_PYRSD DNA polymerase OS=Pyrococcus sp. (strain GB-D) GN=pol PE=1 SV=1 1082 1337 4.0E-09
sp|Q51334|DPOL_PYRSD DNA polymerase OS=Pyrococcus sp. (strain GB-D) GN=pol PE=1 SV=1 717 1064 6.0E-09
sp|P52431|DPOD1_MOUSE DNA polymerase delta catalytic subunit OS=Mus musculus GN=Pold1 PE=1 SV=2 5 249 7.0E-09
sp|O59610|DPOL_PYRHO DNA polymerase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pol PE=3 SV=1 1082 1337 7.0E-09
sp|P28340|DPOD1_HUMAN DNA polymerase delta catalytic subunit OS=Homo sapiens GN=POLD1 PE=1 SV=2 5 249 1.0E-07
sp|Q6GZR5|DPOL_FRG3G Putative DNA polymerase 060R OS=Frog virus 3 (isolate Goorha) GN=FV3-060R PE=3 SV=1 714 976 1.0E-07
sp|Q9HH05|DPOL_THEHY DNA polymerase (Fragment) OS=Thermococcus hydrothermalis GN=pol PE=1 SV=1 1112 1337 2.0E-07
sp|P30317|DPOL_THELI DNA polymerase OS=Thermococcus litoralis GN=pol PE=1 SV=1 690 1064 2.0E-07
sp|Q9HH84|DPOL_THEG8 DNA polymerase OS=Thermococcus sp. (strain GE8) GN=pol PE=3 SV=1 1112 1337 6.0E-07
sp|Q9QSK2|DPOL_IIV6 DNA polymerase 037L OS=Invertebrate iridescent virus 6 GN=DPOL PE=3 SV=1 1018 1221 6.0E-07
sp|P74918|DPOL_THEFM DNA polymerase OS=Thermococcus fumicolans GN=pol PE=1 SV=1 1112 1337 1.0E-06
sp|P21402|DPOL_FOWPN DNA polymerase OS=Fowlpox virus (strain NVSL) GN=POL PE=3 SV=2 1018 1287 2.0E-06
sp|P97283|DPOD1_MESAU DNA polymerase delta catalytic subunit OS=Mesocricetus auratus GN=POLD1 PE=2 SV=1 27 249 3.0E-06
sp|P30319|DPOL_CBEPV DNA polymerase OS=Choristoneura biennis entomopoxvirus GN=POL PE=3 SV=1 1112 1287 4.0E-06
sp|P54358|DPOD1_DROME DNA polymerase delta catalytic subunit OS=Drosophila melanogaster GN=DNApol-delta PE=2 SV=2 27 150 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000166 nucleotide binding Yes
GO:0003677 DNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|006580
MFSVQIYQIDYVLSPPGPLDRSHYPRVPILRIFGQSSVGLRTCLHVHQVYPYCYIEYQGDLDLRHVKQYVRKFKK
SLNHAIALSLKRDPNSTKSQYVCAVVLVKGVKFYGFHSQYSPFLKIILLDPRLMNRVATILQSGSFMCDFGLYGC
GSVGISKAYRRAVLGSETDILPEQVTSFEPSPYPPQSHMPIELDVISPEITNRTQIKERCLHHRLVIPGPERPSE
PIVTSIRELWEEERVRRRALGMEPSPELPQDPSEGSRETGSGWIAEARWWDEIHSRLERERPVNQSHSSSTPPWE
SQVMSIFESTEALWESSYRRWKPDKQTMYETSKRDGAVLNESDLSAIEEVVEGGEVDVNEDLLAYRTIDDLGDME
EDEVYNEGRDPTDGDLDEDNAEVKEIEEESDDEDTSENRGASRSSSPNPFLDDGTTKCSRLFSSSQAQSAEIQEN
DKQKKAQLQEQRSTPTFLSSDHKESLQSIPLASTIRISCSQLTKAYNLCRRGSQNSYAYYKQAPGAAEITTSFES
LGLPSKIYKPPFYSNEDDAPEQPKEFSGLVYHLRGEGTSLLEGFAFPFTGMAGEHDKDKLLFHACTGWEYASLPP
SRKVIKNWLQHQGHLKQEMSTKMPHSQIDGPTQFNIYGFKGSPIAHVYATSRSKQSMTILSVEVMAPTHGKNVPN
PESDPICIAVYGFQVAGTDDVHTGVIAIQNIQLNPRRIRDFHLEIVDTELDLLNRLSDIVAELDPDILTGWEVQQ
ASWGYLWLRAKHYDFDFQDFLSRAPPLKAGSNDRWDGQTTSNIKVAGRHVLNVWRIMRSELALTSYTLSNVAFHV
MRQRVPFYSFATLSRWYDSTGPSHMVALMHYLIQRNCTTLQILEATELVTKTAEFARIFGVDFHSVISRGSQFKV
ESFMFRIAKSENFVLLSPSKSDVGLQNAAECMPLIMEPMSAFYTSPLVVLDFQSLYPSVMIAYNYCYSTCLGRIK
PFQGNYKFGVTNLDLGPGILDALQEHITVAPNGIMYVKSNVRKGLLGRMLVELLNTRVMVKQALKSAKSDKALAR
VLHARQLALKYIANVTYGYTSATYSGRMPAVEIADSIVQTGRETLEKAINFINGSGKWGAKVVYGDTDSLFVYLP
GKTREQAFRIGNEMADAVTRQNPVPIKLKFEKVYLPCVLMAKKRYVGFKYENPDETEPEFDAKGIETVRRDGVLA
QRKLVENSLKILFRTQDLSQVKDYCCRSWYQIMENKVPIQDFIFAKEVRMGTYSEKGPPPPGAVVAARRMVLDPN
DEPQYGDRIPYIISRGEPGALLAERALDPLEMINDPRLQLDALYYITRVLIPPLERVFNLVGADVRHWFAEMPKI
SNTVSELALASPGRRRKVEDSDREESPSSPGRRDLEEHLENNQCLVCGEVSFTELCEECIFLPQTSLTILGAKTG
RREERMLTTHKVCVTCTSIAPSEPVECECLDCPWFYARKRAEHKLDMIETMDILIDEFDSKLSRSPTASPNSASD
SNLTRM*
Coding >Agabi119p4|006580
ATGTTCTCTGTGCAGATATATCAGATTGACTACGTTCTATCTCCTCCTGGCCCGCTTGACCGCTCTCACTACCCC
AGGGTGCCTATTCTGCGAATATTTGGCCAGTCTTCTGTTGGATTACGAACCTGCCTTCATGTGCACCAAGTTTAT
CCTTACTGCTATATTGAATATCAAGGAGATCTCGATCTCCGACATGTGAAACAATACGTCCGAAAATTCAAAAAG
TCGTTAAATCATGCCATTGCTTTATCTTTAAAACGAGACCCTAACTCCACCAAATCTCAATATGTCTGTGCCGTT
GTGCTGGTTAAAGGCGTCAAATTCTATGGATTCCACTCGCAATATTCGCCATTCCTGAAAATAATACTGTTGGAC
CCACGGCTCATGAATCGTGTGGCCACCATTTTACAGTCTGGCTCGTTCATGTGCGATTTCGGTCTATACGGATGT
GGGTCCGTTGGAATCAGCAAGGCTTATCGACGAGCTGTATTGGGGTCCGAGACAGATATACTACCGGAGCAAGTC
ACGTCTTTTGAACCGTCACCCTACCCTCCACAGTCGCACATGCCCATAGAACTGGACGTAATCTCGCCAGAAATA
ACTAATCGAACACAAATCAAGGAGCGCTGCCTTCACCATCGCCTTGTGATACCTGGTCCTGAGCGACCATCCGAA
CCGATCGTTACGAGTATTCGCGAGTTATGGGAAGAAGAACGCGTGCGTCGTCGTGCTCTTGGTATGGAACCTTCA
CCCGAGCTGCCCCAAGATCCAAGCGAGGGGTCCAGGGAGACCGGCAGCGGTTGGATAGCAGAAGCTCGCTGGTGG
GATGAGATCCATTCTCGACTCGAACGCGAGCGCCCAGTGAATCAATCTCATTCTTCGAGTACCCCGCCGTGGGAG
AGCCAAGTAATGTCTATCTTCGAGAGCACAGAGGCACTTTGGGAATCAAGTTACAGAAGATGGAAACCTGACAAG
CAGACAATGTATGAGACTTCAAAACGTGATGGGGCAGTTCTTAACGAGTCGGATTTGTCGGCTATTGAGGAAGTT
GTAGAAGGTGGCGAAGTGGATGTGAACGAGGATTTACTGGCCTACAGGACGATCGATGACCTTGGGGACATGGAA
GAAGATGAGGTTTATAACGAAGGCCGCGACCCCACGGACGGAGACCTGGACGAAGATAATGCGGAGGTCAAAGAA
ATAGAGGAAGAAAGTGACGACGAAGACACATCGGAAAACAGAGGAGCTTCCAGATCTTCGTCCCCCAACCCTTTC
TTAGATGATGGGACAACTAAGTGCTCTCGTCTCTTTTCTTCAAGCCAAGCCCAGAGTGCAGAAATACAGGAAAAT
GATAAGCAAAAGAAGGCCCAATTACAAGAACAACGCAGCACACCTACCTTTCTATCATCTGATCACAAAGAAAGT
CTTCAAAGCATACCCTTAGCGTCGACAATTCGAATTTCGTGTTCGCAGCTGACGAAGGCATATAACTTATGTCGA
AGAGGTAGTCAAAACAGTTATGCATATTATAAGCAGGCCCCCGGAGCAGCTGAAATTACGACCAGCTTTGAATCA
CTGGGCCTGCCGTCGAAAATCTATAAACCGCCATTTTATTCCAATGAGGATGACGCGCCAGAACAGCCTAAAGAG
TTCTCAGGATTAGTATATCATCTGAGAGGAGAAGGTACTTCGCTGCTCGAAGGCTTTGCATTTCCTTTTACAGGC
ATGGCAGGCGAACATGACAAGGACAAGTTATTGTTCCATGCTTGTACCGGGTGGGAATACGCCAGTTTGCCCCCT
AGCAGAAAGGTCATCAAGAACTGGCTACAGCATCAAGGTCATTTAAAGCAGGAAATGTCCACAAAAATGCCCCAC
TCACAGATCGATGGCCCCACGCAATTCAATATATATGGTTTTAAAGGCTCGCCGATAGCGCACGTTTATGCTACC
TCGAGGAGTAAACAAAGTATGACTATCTTGTCTGTCGAAGTCATGGCTCCTACTCATGGAAAAAACGTTCCGAAC
CCTGAGAGTGATCCAATATGCATCGCTGTCTATGGATTTCAAGTCGCTGGAACTGATGATGTTCACACCGGGGTC
ATTGCGATTCAAAACATCCAGCTTAATCCAAGACGAATACGAGACTTCCACCTGGAAATTGTCGATACAGAGCTC
GATCTCCTGAATAGATTATCAGATATTGTTGCTGAGCTCGATCCTGATATTCTTACTGGGTGGGAGGTACAACAG
GCATCCTGGGGATACCTCTGGTTGCGTGCAAAACATTACGATTTTGATTTTCAGGATTTCCTATCTCGAGCCCCT
CCTTTAAAAGCCGGTAGCAATGACCGTTGGGACGGGCAAACAACATCGAACATCAAGGTCGCGGGTAGGCACGTT
TTGAACGTCTGGCGTATTATGAGGTCCGAATTGGCCTTGACGTCCTATACGCTGTCCAACGTAGCCTTTCATGTC
ATGCGGCAAAGGGTACCGTTCTACAGCTTTGCAACGTTATCAAGATGGTATGATAGTACGGGACCAAGCCACATG
GTGGCATTAATGCATTACCTGATACAACGGAACTGCACAACTCTTCAAATACTAGAAGCAACTGAACTTGTTACC
AAGACAGCGGAATTTGCTCGTATCTTCGGCGTGGATTTCCACTCTGTCATCAGCCGCGGATCACAGTTCAAGGTA
GAATCTTTCATGTTCCGTATTGCCAAATCCGAGAATTTTGTTTTGCTCTCCCCGAGTAAAAGTGATGTAGGGTTG
CAAAATGCAGCCGAATGCATGCCGCTCATCATGGAACCCATGTCGGCCTTTTACACAAGTCCTCTTGTCGTTTTG
GATTTTCAATCTCTTTATCCCTCTGTCATGATCGCTTATAATTACTGCTACTCAACTTGTCTTGGTCGTATCAAA
CCATTCCAAGGAAATTATAAATTCGGGGTCACCAATCTTGATTTAGGTCCTGGTATTCTGGACGCGCTGCAGGAA
CATATCACTGTCGCACCGAACGGTATCATGTACGTCAAATCGAACGTCCGAAAGGGTCTGTTAGGTCGTATGCTT
GTTGAACTTTTGAACACACGTGTGATGGTGAAGCAAGCTTTGAAATCTGCGAAGTCTGACAAGGCCTTAGCTCGT
GTTCTTCATGCACGCCAACTCGCATTGAAGTATATCGCGAATGTTACTTATGGATACACTAGCGCAACTTATTCT
GGTCGTATGCCCGCCGTAGAAATTGCCGACAGTATTGTCCAAACAGGCAGGGAAACACTTGAAAAAGCTATCAAC
TTTATCAACGGCAGTGGAAAATGGGGAGCGAAGGTCGTTTATGGTGACACTGATAGCTTGTTTGTCTACCTTCCT
GGAAAAACGAGAGAGCAAGCTTTTCGAATTGGCAATGAGATGGCGGACGCGGTCACAAGACAAAATCCGGTTCCT
ATTAAACTGAAGTTCGAGAAGGTCTACCTTCCCTGCGTCCTGATGGCTAAAAAACGTTATGTCGGATTCAAATAC
GAGAACCCTGATGAAACGGAACCAGAGTTTGACGCAAAAGGCATAGAAACCGTTCGAAGAGACGGTGTTTTAGCC
CAAAGAAAACTCGTCGAAAACTCCTTAAAGATTTTGTTTCGTACTCAGGATCTTAGCCAGGTCAAAGACTACTGC
TGCCGCTCTTGGTACCAGATCATGGAGAATAAAGTTCCTATTCAGGACTTTATATTTGCCAAAGAAGTGAGAATG
GGAACGTATAGCGAGAAAGGACCGCCACCACCTGGGGCTGTGGTAGCTGCTCGTAGAATGGTGCTTGACCCGAAC
GACGAACCTCAATATGGAGATCGAATCCCGTATATAATCAGTCGGGGAGAACCAGGGGCATTACTTGCAGAACGG
GCGCTGGATCCGCTTGAGATGATCAATGACCCCCGCCTTCAATTGGACGCGTTATATTATATCACACGCGTTTTG
ATTCCACCCCTGGAACGAGTGTTCAACCTGGTAGGGGCTGACGTACGGCATTGGTTTGCAGAAATGCCAAAGATT
AGCAATACTGTCTCAGAGCTAGCATTAGCCTCGCCAGGCAGACGTAGAAAAGTGGAAGATAGTGATAGAGAAGAG
TCACCTTCCTCACCCGGTCGGCGAGACCTCGAAGAGCACCTCGAAAACAATCAATGTCTTGTTTGTGGTGAAGTT
TCTTTTACCGAATTATGCGAGGAGTGTATCTTCTTACCTCAAACCAGTCTGACCATCCTTGGAGCGAAAACCGGC
AGACGAGAAGAGCGGATGCTGACCACACACAAGGTCTGCGTGACTTGCACAAGTATTGCTCCCAGCGAACCAGTC
GAATGCGAGTGTTTGGATTGTCCATGGTTTTACGCTCGAAAGAGGGCAGAGCATAAATTAGACATGATCGAAACC
ATGGATATCCTGATAGACGAGTTTGATTCAAAACTTTCAAGATCCCCTACAGCGAGTCCCAATAGCGCTTCAGAT
TCCAACCTCACTAGAATGTAA
Transcript >Agabi119p4|006580
ATGTTCTCTGTGCAGATATATCAGATTGACTACGTTCTATCTCCTCCTGGCCCGCTTGACCGCTCTCACTACCCC
AGGGTGCCTATTCTGCGAATATTTGGCCAGTCTTCTGTTGGATTACGAACCTGCCTTCATGTGCACCAAGTTTAT
CCTTACTGCTATATTGAATATCAAGGAGATCTCGATCTCCGACATGTGAAACAATACGTCCGAAAATTCAAAAAG
TCGTTAAATCATGCCATTGCTTTATCTTTAAAACGAGACCCTAACTCCACCAAATCTCAATATGTCTGTGCCGTT
GTGCTGGTTAAAGGCGTCAAATTCTATGGATTCCACTCGCAATATTCGCCATTCCTGAAAATAATACTGTTGGAC
CCACGGCTCATGAATCGTGTGGCCACCATTTTACAGTCTGGCTCGTTCATGTGCGATTTCGGTCTATACGGATGT
GGGTCCGTTGGAATCAGCAAGGCTTATCGACGAGCTGTATTGGGGTCCGAGACAGATATACTACCGGAGCAAGTC
ACGTCTTTTGAACCGTCACCCTACCCTCCACAGTCGCACATGCCCATAGAACTGGACGTAATCTCGCCAGAAATA
ACTAATCGAACACAAATCAAGGAGCGCTGCCTTCACCATCGCCTTGTGATACCTGGTCCTGAGCGACCATCCGAA
CCGATCGTTACGAGTATTCGCGAGTTATGGGAAGAAGAACGCGTGCGTCGTCGTGCTCTTGGTATGGAACCTTCA
CCCGAGCTGCCCCAAGATCCAAGCGAGGGGTCCAGGGAGACCGGCAGCGGTTGGATAGCAGAAGCTCGCTGGTGG
GATGAGATCCATTCTCGACTCGAACGCGAGCGCCCAGTGAATCAATCTCATTCTTCGAGTACCCCGCCGTGGGAG
AGCCAAGTAATGTCTATCTTCGAGAGCACAGAGGCACTTTGGGAATCAAGTTACAGAAGATGGAAACCTGACAAG
CAGACAATGTATGAGACTTCAAAACGTGATGGGGCAGTTCTTAACGAGTCGGATTTGTCGGCTATTGAGGAAGTT
GTAGAAGGTGGCGAAGTGGATGTGAACGAGGATTTACTGGCCTACAGGACGATCGATGACCTTGGGGACATGGAA
GAAGATGAGGTTTATAACGAAGGCCGCGACCCCACGGACGGAGACCTGGACGAAGATAATGCGGAGGTCAAAGAA
ATAGAGGAAGAAAGTGACGACGAAGACACATCGGAAAACAGAGGAGCTTCCAGATCTTCGTCCCCCAACCCTTTC
TTAGATGATGGGACAACTAAGTGCTCTCGTCTCTTTTCTTCAAGCCAAGCCCAGAGTGCAGAAATACAGGAAAAT
GATAAGCAAAAGAAGGCCCAATTACAAGAACAACGCAGCACACCTACCTTTCTATCATCTGATCACAAAGAAAGT
CTTCAAAGCATACCCTTAGCGTCGACAATTCGAATTTCGTGTTCGCAGCTGACGAAGGCATATAACTTATGTCGA
AGAGGTAGTCAAAACAGTTATGCATATTATAAGCAGGCCCCCGGAGCAGCTGAAATTACGACCAGCTTTGAATCA
CTGGGCCTGCCGTCGAAAATCTATAAACCGCCATTTTATTCCAATGAGGATGACGCGCCAGAACAGCCTAAAGAG
TTCTCAGGATTAGTATATCATCTGAGAGGAGAAGGTACTTCGCTGCTCGAAGGCTTTGCATTTCCTTTTACAGGC
ATGGCAGGCGAACATGACAAGGACAAGTTATTGTTCCATGCTTGTACCGGGTGGGAATACGCCAGTTTGCCCCCT
AGCAGAAAGGTCATCAAGAACTGGCTACAGCATCAAGGTCATTTAAAGCAGGAAATGTCCACAAAAATGCCCCAC
TCACAGATCGATGGCCCCACGCAATTCAATATATATGGTTTTAAAGGCTCGCCGATAGCGCACGTTTATGCTACC
TCGAGGAGTAAACAAAGTATGACTATCTTGTCTGTCGAAGTCATGGCTCCTACTCATGGAAAAAACGTTCCGAAC
CCTGAGAGTGATCCAATATGCATCGCTGTCTATGGATTTCAAGTCGCTGGAACTGATGATGTTCACACCGGGGTC
ATTGCGATTCAAAACATCCAGCTTAATCCAAGACGAATACGAGACTTCCACCTGGAAATTGTCGATACAGAGCTC
GATCTCCTGAATAGATTATCAGATATTGTTGCTGAGCTCGATCCTGATATTCTTACTGGGTGGGAGGTACAACAG
GCATCCTGGGGATACCTCTGGTTGCGTGCAAAACATTACGATTTTGATTTTCAGGATTTCCTATCTCGAGCCCCT
CCTTTAAAAGCCGGTAGCAATGACCGTTGGGACGGGCAAACAACATCGAACATCAAGGTCGCGGGTAGGCACGTT
TTGAACGTCTGGCGTATTATGAGGTCCGAATTGGCCTTGACGTCCTATACGCTGTCCAACGTAGCCTTTCATGTC
ATGCGGCAAAGGGTACCGTTCTACAGCTTTGCAACGTTATCAAGATGGTATGATAGTACGGGACCAAGCCACATG
GTGGCATTAATGCATTACCTGATACAACGGAACTGCACAACTCTTCAAATACTAGAAGCAACTGAACTTGTTACC
AAGACAGCGGAATTTGCTCGTATCTTCGGCGTGGATTTCCACTCTGTCATCAGCCGCGGATCACAGTTCAAGGTA
GAATCTTTCATGTTCCGTATTGCCAAATCCGAGAATTTTGTTTTGCTCTCCCCGAGTAAAAGTGATGTAGGGTTG
CAAAATGCAGCCGAATGCATGCCGCTCATCATGGAACCCATGTCGGCCTTTTACACAAGTCCTCTTGTCGTTTTG
GATTTTCAATCTCTTTATCCCTCTGTCATGATCGCTTATAATTACTGCTACTCAACTTGTCTTGGTCGTATCAAA
CCATTCCAAGGAAATTATAAATTCGGGGTCACCAATCTTGATTTAGGTCCTGGTATTCTGGACGCGCTGCAGGAA
CATATCACTGTCGCACCGAACGGTATCATGTACGTCAAATCGAACGTCCGAAAGGGTCTGTTAGGTCGTATGCTT
GTTGAACTTTTGAACACACGTGTGATGGTGAAGCAAGCTTTGAAATCTGCGAAGTCTGACAAGGCCTTAGCTCGT
GTTCTTCATGCACGCCAACTCGCATTGAAGTATATCGCGAATGTTACTTATGGATACACTAGCGCAACTTATTCT
GGTCGTATGCCCGCCGTAGAAATTGCCGACAGTATTGTCCAAACAGGCAGGGAAACACTTGAAAAAGCTATCAAC
TTTATCAACGGCAGTGGAAAATGGGGAGCGAAGGTCGTTTATGGTGACACTGATAGCTTGTTTGTCTACCTTCCT
GGAAAAACGAGAGAGCAAGCTTTTCGAATTGGCAATGAGATGGCGGACGCGGTCACAAGACAAAATCCGGTTCCT
ATTAAACTGAAGTTCGAGAAGGTCTACCTTCCCTGCGTCCTGATGGCTAAAAAACGTTATGTCGGATTCAAATAC
GAGAACCCTGATGAAACGGAACCAGAGTTTGACGCAAAAGGCATAGAAACCGTTCGAAGAGACGGTGTTTTAGCC
CAAAGAAAACTCGTCGAAAACTCCTTAAAGATTTTGTTTCGTACTCAGGATCTTAGCCAGGTCAAAGACTACTGC
TGCCGCTCTTGGTACCAGATCATGGAGAATAAAGTTCCTATTCAGGACTTTATATTTGCCAAAGAAGTGAGAATG
GGAACGTATAGCGAGAAAGGACCGCCACCACCTGGGGCTGTGGTAGCTGCTCGTAGAATGGTGCTTGACCCGAAC
GACGAACCTCAATATGGAGATCGAATCCCGTATATAATCAGTCGGGGAGAACCAGGGGCATTACTTGCAGAACGG
GCGCTGGATCCGCTTGAGATGATCAATGACCCCCGCCTTCAATTGGACGCGTTATATTATATCACACGCGTTTTG
ATTCCACCCCTGGAACGAGTGTTCAACCTGGTAGGGGCTGACGTACGGCATTGGTTTGCAGAAATGCCAAAGATT
AGCAATACTGTCTCAGAGCTAGCATTAGCCTCGCCAGGCAGACGTAGAAAAGTGGAAGATAGTGATAGAGAAGAG
TCACCTTCCTCACCCGGTCGGCGAGACCTCGAAGAGCACCTCGAAAACAATCAATGTCTTGTTTGTGGTGAAGTT
TCTTTTACCGAATTATGCGAGGAGTGTATCTTCTTACCTCAAACCAGTCTGACCATCCTTGGAGCGAAAACCGGC
AGACGAGAAGAGCGGATGCTGACCACACACAAGGTCTGCGTGACTTGCACAAGTATTGCTCCCAGCGAACCAGTC
GAATGCGAGTGTTTGGATTGTCCATGGTTTTACGCTCGAAAGAGGGCAGAGCATAAATTAGACATGATCGAAACC
ATGGATATCCTGATAGACGAGTTTGATTCAAAACTTTCAAGATCCCCTACAGCGAGTCCCAATAGCGCTTCAGAT
TCCAACCTCACTAGAATGTAA
Gene >Agabi119p4|006580
ATGTTCTCTGTGCAGATATATCAGATTGACTACGTTCTATCTCCTCCTGGCCCGCTTGACCGCTCTCACTACCCC
AGGGTGCCTATTCTGCGAATATTTGGCCAGTCTTCTGTTGGATTACGAACCTGCCTTCATGTGCACCAAGTTTAT
CCTTACTGCTATATTGAATATCAAGGAGATCTCGATCTCCGACATGGTACGTTTATGAGCTGTCCAGTATTTATC
AACCTGAGGCCCCGCACAGTGAAACAATACGTCCGAAAATTCAAAAAGTCGTTAAATCATGCCATTGCTTTATCT
TTAAAACGAGACCCTAACTCCACCAAATCTCAATATGTCTGTGCCGTTGTGCTGGTTAAAGGCGTCAAATTCTAT
GGATTCCACTCGCAATATTCGCCATTCCTGAAAATAATACTGTTGGACCCACGGCTCATGAATCGTGTGGCCACC
ATTTTACAGTCTGGCTCGGTAATGAGTCAGCGCTTTCCAGTGTATGAAAGTCACCTCAGTTTCACTCTGCAGTTC
ATGTGCGATTTCGGTCTATACGGATGTGGGTCCGTTGGAATCAGCAAGGCTTATCGACGAGCTGTATTGGGGTCC
GAGACAGATATACTACCGGAGCAAGTCACGTCTTTTGAACCGTCACCCTACCCTCCACAGTCGCACATGCCCATA
GAACTGGACGTAATCTCGCCAGAAATAACTAATCGAACACAAATCAAGGAGCGCTGCCTTCACCATCGCCTTGTG
ATACCTGGTCCTGAGCGACCATCCGAACCGATCGTTACGAGTATTCGCGAGTTATGGGAAGAAGAACGCGTGCGT
CGTCGTGCTCTTGGTATGGAACCTTCACCCGAGCTGCCCCAAGATCCAAGCGAGGGGTCCAGGGAGACCGGCAGC
GGTTGGATAGCAGAAGCTCGCTGGTGGGATGAGATCCATTCTCGACTCGAACGCGAGCGCCCAGTGAATCAATCT
CATTCTTCGAGTACCCCGCCGTGGGAGAGCCAAGTAATGTCTATCTTCGAGAGCACAGAGGCACTTTGGGAATCA
AGTTACAGAAGATGGAAACCTGACAAGCAGACAATGTATGAGACTTCAAAACGTGATGGGGCAGTTCTTAACGAG
TCGGATTTGTCGGCTATTGAGGAAGTTGTAGAAGGTGGCGAAGTGGATGTGAACGAGGATTTACTGGCCTACAGG
ACGATCGATGACCTTGGGGACATGGAAGAAGATGAGGTTTATAACGAAGGCCGCGACCCCACGGACGGAGACCTG
GACGAAGATAATGCGGAGGTCAAAGAAATAGAGGAAGAAAGTGACGACGAAGACACATCGGAAAACAGAGGAGCT
TCCAGGTTTGTGTGTGAAATACTAGAACTTGATCCGCCCGCTTACTCTACACCAGATCTTCGTCCCCCAACCCTT
TCTTAGATGATGGGACAACTAAGTGCTCTCGTCTCTTTTCTTCAAGGTTGGACTCGGCTATCATCATCTGAGCGT
ATTGATTGAGCCATTTCGATAGCCAAGCCCAGAGGTAAGTGGATTGAAAACGCGTCTCGGAAACGCGAAATCAGA
ATGGCAGCACCGGATATTCACTTAAAAGAAAGTGCAGAAATACAGGAAAATGATAAGCAAAAGTGAGCCTCCGAT
AATCTGTACTGATGCCGCGTTTTCTGTATGGAGACCTCACCTACGGCTAGGAAGGCCCAATTACAAGAACAACGC
AGCACACCTACCTTTCTATCATCTGATCACAAAGAAAGTCTTCAAAGCATACCCTTAGCGTCGACAATTCGAATT
TCGTGTTCGCAGCTGACGAAGGCATATAACTTATGTCGAAGAGGTAGTCAAAACAGTTATGCATATTATAAGCAG
GCCCCCGGAGCAGCTGAAATTACGACCAGCTTTGAATCACTGGGCCTGCCGTCGAAAATCTATAAACCGCCATTT
TATTCCAATGAGGATGACGCGCCAGAACAGCCTAAAGAGTTCTCAGGATTAGTATATCATCTGAGAGGAGAAGGT
ACTTCGCTGCTCGAAGGCTTTGCATTTCCTTTTACAGGCATGGCAGGCGAACATGACAAGGACAAGTTATTGTTC
CATGCTTGTACCGGGTGGGAATACGCCAGTTTGCCCCCTAGCAGAAAGGTCATCAAGAACTGGCTACAGCATCAA
GGTCATTTAAAGCAGGAAATGTCCACAAAAATGCCCCACTCACAGGTTTGACTCCTTCCGTTCTACGACGACAGA
TTTATTCATTTAATTTTCGCTTTAACTAAGATCGATGGCCCCACGCAATTCAATATATATGGTTTTAAAGGCTCG
CCGATAGCGCACGTTTATGCTACCTCGAGGAGTAAACAAAGTATGACTATCTTGTCTGTCGAAGTCATGGGTACA
ATTTCTACGTTTCATCAAAGACGAGAATCTTACGACTAATTTCCGAAGCTCCTACTCATGGAAAAAACGTTCCGA
ACCCTGAGAGTGATCCAATATGCATCGCTGTCTATGGATTTCAAGTCGCTGGAACTGATGATGTTCACACCGGGG
TCATTGCGATTCAAAACATCCAGCTTAATCCAAGACGAATACGAGACTTCCACCTGGAAATTGTCGATACAGAGC
TCGATCTCCTGAATAGATTATCAGATATTGTTGCTGAGCTCGATCCTGATATTCTTACTGGGTGGGAGGTACAAC
AGGCATCCTGGGGATACCTCTGGTTGCGTGCAAAACATTACGGTCGATGTTTTATTATCTCATGCGTCCTTTCAG
GTGCTTACGGCCGCTTCACAGATTTTGATTTTCAGGATTTCCTATCTCGAGCCCCTCCTTTAAAAGCCGGTAGCA
ATGACCGTTGGGACGGGCAAACAACATCGAACATCAAGGTCGCGGGTAGGCACGTTTTGAACGTCTGGCGTATTA
TGAGGTCCGAATTGGCCTTGACGTCCTATACGCTGTCCAACGTAGCCTTTCATGTCATGCGGCAAAGGTACTACT
TGAGTCAAACAATACCTCTCCGCAAACGGTCTTACTGATATCGCTGTCCAGGGTACCGTTCTACAGCTTTGCAAC
GTTATCAAGATGGTATGATAGTACGGGACCAAGCCACATGGTGGCATTAATGCATTACCTGATACAACGGAACTG
CACAACTCTTCAAATACTAGAAGCAACTGAACTTGTTACCAAGACAGCGTACGTCTGTTGTTTATCTACAATATC
TCGTAACTTATTCAATGTCTAGGGAATTTGCTCGTATCTTCGGCGTGGATTTCCACTCTGTCATCAGCCGCGGAT
CACAGTTCAAGGTAGAATCTTTCATGTTCCGTATTGCCAAATCCGAGAATTTTGTTTTGCTCTCCCCGAGTAAAA
GTGATGTCTGTATTTTTTTCTCTTCCAAGGCCGTAGATCTCAAGGCATACATCACAGGTAGGGTTGCAAAATGCA
GCCGAATGCATGCCGCTCATCATGGAACCCATGTCGGCCTTTTACACAAGTCCTCTTGTCGTTTTGGATTTTCAA
TCTCTTTATCCCTCTGTCATGATCGCTTATAATTACTGCTACTCAACTTGTCTTGGTCGTATCAAACCATTCCAA
GGAAATTATAAATTCGGGGTCACCAATCTTGATTTAGGTCCTGGTATTCTGGACGCGCTGCAGGAACATATCACT
GGTAGTGATGATGGTTCGTCCCTCATGCAATTGCCTGACTCCTGTACTTTACAGTCGCACCGAACGGTATCATGT
ACGTCAAATCGAACGTCCGAAAGGGTCTGTTAGGTCGTATGCTTGTTGAACTTTTGAACACACGTGTGATGGTGA
AGCAAGCTTTGAAATCTGCGAAGTCTGACAAGGCGGGTTTTATCCTTTCATCAATGAAGGGTTCCAATATGCTTA
TCCTTTGTCGGCAGGCCTTAGCTCGTGTTCTTCATGCACGCCAACTCGCATTGAAGTATATCGCGAATGTTACTT
ATGGATACACTAGCGCAACTTATTCTGGTCGTATGCCCGCCGTAGAAATTGCCGACAGTATTGTCCAAACAGGCA
GGGAAACACTTGAAAAAGTGGGGGGCGTTTCGTTCGGATTGAACGAAGTCGTCTCTGATTATACTTTTCTAGGCT
ATCAACTTTATCAACGGCAGTGGAAAATGGGGAGCGAAGGTAAGATATCCAAGCAAATTCAAAGAATATGACCCT
GTGATGCTCTGCTAGGTCGTTTATGGTGACACTGATAGCTTGTTTGTGTGAGTCGGGAGAAAACTACTCGGCGTA
TCCTTACTTTTGATGTCAGCTACCTTCCTGGAAAAACGAGAGAGCAAGCTTTTCGAATTGGCAATGAGATGGCGG
ACGCGGTCACAAGACAAAATCCGGTTCCTATTAAACTGAAGTTCGAGAAGGTGGGCTTTCCTCACCAGTCTTGGT
TTCCTACTGGAGCAGAAGTAGGTCTACCTTCCCTGCGTCCTGATGGCTAAAAAACGTTATGTCGGATTCAAATAC
GAGAACCCTGATGAAACGGAACCAGAGTTTGACGCAAAAGGCATAGAAACCGTTCGAAGAGACGGTGTTTTAGCC
CAAAGAAAACTCGTCGAAAACTCCTTAAAGTGCACCTCTATCCTTGTTGATATCCACTTCATATTGACCGCATGT
TAGGATTTTGTTTCGTACTCAGGATCTTAGCCAGGTCAAAGACTACTGCTGCCGCTCTTGGTACCAGATCATGGA
GAATAAAGTTCCTATTCAGGACTTTATATTTGCCAAAGAAGTGAGAATGGGAACGTATAGGTGGGCTGGCTTCTT
TGAATCTAGCATATCTCTCTTTCTGAGGCTGTCGCATAGCGAGAAAGGACCGCCACCACCTGGGGCTGTGGTAGC
TGCTCGTAGAATGGTGCTTGACCCGAACGACGAACCTCAATATGGAGATCGAATCCCGTATATAATCAGTCGGGG
AGAACCAGGGGCATTACTTGCAGAACGGGCGCTGGATCCGCTTGAGATGATCAATGACCCGTGAGTTCTCATCGC
CGAAACAAGGATCCTGTCTGACACTCGAAGCAGCCGCCTTCAATTGGACGCGTTATATTATATCACACGCGTTTT
GATTCCACCCCTGGAACGAGTGTTCAACCTGGTAGGGGCTGACGTACGGCATTGGTTTGCAGAAATGCCAAAGAT
TAGCAATACTGTCTCAGAGCTAGCATTAGCCTCGCCAGGCAGACGTAGAAAAGTGGAAGATAGTGATAGAGAAGA
GTCACCTTCCTCACCCGGTCGGCGAGACCTCGAAGAGCACCTCGAAAACAATCAATGTCTTGTTTGTGGTGAAGT
TTCTTTTACCGGTATGTCTGGTTAAATTTTGTGCGCCGAGTATTTCAAACAGAGAGAACAGAATTATGCGAGGAG
TGTATCTTCTTACCTCAAACCAGTCTGACCATCCTTGGAGCGAAAACCGGCAGACGAGAAGAGCGGATGCTGACC
ACACACAAGGTCTGCGTGACTTGCACAAGTATTGCTCCCAGCGAACCAGTCGAATGCGAGTGTTTGGATTGTCCA
TGGTTTTACGCTCGAAAGAGGGCAGAGCATAAATTAGACATGATCGAAACCATGGATATCCTGATAGACGAGTTT
GATTCAAAACTTTCAAGATCCCCTACAGCGAGTCCCAATAGCGCTTCAGATTCCAACCTCACTAGAATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail