Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|006300
Gene name
Locationscaffold_01a:1510686..1511436
Strand-
Gene length (bp)750
Transcript length (bp)468
Coding sequence length (bp)468
Protein length (aa) 156

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16205 Ribosomal_S17_N Ribosomal_S17 N-terminal 4.1E-31 5 71
PF00366 Ribosomal_S17 Ribosomal protein S17 1.3E-25 73 140

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT74|RS11B_SCHPO 40S ribosomal protein S11-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1102 PE=3 SV=1 5 155 6.0E-73
sp|P0CT73|RS11A_SCHPO 40S ribosomal protein S11-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1101 PE=2 SV=1 5 155 6.0E-73
sp|P0CX48|RS11B_YEAST 40S ribosomal protein S11-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS11B PE=1 SV=1 5 155 4.0E-68
sp|P0CX47|RS11A_YEAST 40S ribosomal protein S11-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS11A PE=1 SV=1 5 155 4.0E-68
sp|P41115|RS11_XENLA 40S ribosomal protein S11 OS=Xenopus laevis GN=rps11 PE=2 SV=1 1 155 1.0E-65
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT74|RS11B_SCHPO 40S ribosomal protein S11-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1102 PE=3 SV=1 5 155 6.0E-73
sp|P0CT73|RS11A_SCHPO 40S ribosomal protein S11-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1101 PE=2 SV=1 5 155 6.0E-73
sp|P0CX48|RS11B_YEAST 40S ribosomal protein S11-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS11B PE=1 SV=1 5 155 4.0E-68
sp|P0CX47|RS11A_YEAST 40S ribosomal protein S11-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS11A PE=1 SV=1 5 155 4.0E-68
sp|P41115|RS11_XENLA 40S ribosomal protein S11 OS=Xenopus laevis GN=rps11 PE=2 SV=1 1 155 1.0E-65
sp|P62282|RS11_RAT 40S ribosomal protein S11 OS=Rattus norvegicus GN=Rps11 PE=1 SV=3 1 155 2.0E-65
sp|P62281|RS11_MOUSE 40S ribosomal protein S11 OS=Mus musculus GN=Rps11 PE=1 SV=3 1 155 2.0E-65
sp|P61270|RS11_MACFA 40S ribosomal protein S11 OS=Macaca fascicularis GN=RPS11 PE=2 SV=3 1 155 2.0E-65
sp|P62280|RS11_HUMAN 40S ribosomal protein S11 OS=Homo sapiens GN=RPS11 PE=1 SV=3 1 155 2.0E-65
sp|Q3T0V4|RS11_BOVIN 40S ribosomal protein S11 OS=Bos taurus GN=RPS11 PE=2 SV=3 1 155 2.0E-65
sp|Q54S90|RS11_DICDI 40S ribosomal protein S11 OS=Dictyostelium discoideum GN=rps11 PE=1 SV=1 1 155 5.0E-65
sp|Q9XSU4|RS11_CANLF 40S ribosomal protein S11 OS=Canis lupus familiaris GN=RPS11 PE=1 SV=2 1 155 6.0E-65
sp|Q292D0|RS11_DROPS 40S ribosomal protein S11 OS=Drosophila pseudoobscura pseudoobscura GN=RpS11 PE=3 SV=2 1 155 1.0E-61
sp|P42756|RS11_DUNTE 40S ribosomal protein S11 OS=Dunaliella tertiolecta GN=RPS11 PE=2 SV=1 1 155 4.0E-60
sp|P52812|RS11_ANOGA 40S ribosomal protein S11 OS=Anopheles gambiae GN=RpS11 PE=2 SV=2 1 155 9.0E-60
sp|Q6XHX5|RS11_DROYA 40S ribosomal protein S11 OS=Drosophila yakuba GN=RpS11 PE=2 SV=1 1 155 1.0E-59
sp|Q0E9B6|RS11_DROME 40S ribosomal protein S11 OS=Drosophila melanogaster GN=RpS11 PE=1 SV=1 1 155 1.0E-59
sp|O65569|RS112_ARATH 40S ribosomal protein S11-2 OS=Arabidopsis thaliana GN=RPS11B PE=2 SV=2 1 154 4.0E-57
sp|P17093|RS11_SOYBN 40S ribosomal protein S11 OS=Glycine max GN=RPS11 PE=2 SV=2 1 142 5.0E-57
sp|P16181|RS111_ARATH 40S ribosomal protein S11-1 OS=Arabidopsis thaliana GN=RPS11A PE=2 SV=1 1 154 1.0E-56
sp|P42733|RS113_ARATH 40S ribosomal protein S11-3 OS=Arabidopsis thaliana GN=RPS11C PE=2 SV=2 1 154 2.0E-56
sp|Q9M5M1|RS11_EUPES 40S ribosomal protein S11 OS=Euphorbia esula GN=RPS11 PE=2 SV=1 1 142 4.0E-56
sp|P25460|RS11_MAIZE 40S ribosomal protein S11 OS=Zea mays GN=RPS11 PE=2 SV=1 1 142 3.0E-54
sp|B8GKE2|RS17_METPE 30S ribosomal protein S17P OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=rps17p PE=3 SV=1 36 144 2.0E-29
sp|Q2FT32|RS17_METHJ 30S ribosomal protein S17P OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rps17p PE=3 SV=1 36 144 9.0E-29
sp|Q0W1X9|RS17_METAR 30S ribosomal protein S17P OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rps17p PE=3 SV=1 36 148 1.0E-27
sp|Q46GA4|RS17_METBF 30S ribosomal protein S17P OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rps17p PE=3 SV=1 36 141 1.0E-27
sp|A7I5P8|RS17_METB6 30S ribosomal protein S17P OS=Methanoregula boonei (strain 6A8) GN=rps17p PE=3 SV=1 36 144 1.0E-27
sp|Q8TW21|RS17_METKA 30S ribosomal protein S17P OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rps17p PE=3 SV=1 28 142 2.0E-27
sp|Q8TRT8|RS17_METAC 30S ribosomal protein S17P OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rps17p PE=3 SV=1 36 141 2.0E-27
sp|Q8PV41|RS17_METMA 30S ribosomal protein S17P OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rps17p PE=3 SV=2 36 141 3.0E-27
sp|A2SPL1|RS17_METLZ 30S ribosomal protein S17P OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rps17p PE=3 SV=1 36 142 3.0E-26
sp|A3CT06|RS17_METMJ 30S ribosomal protein S17P OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rps17p PE=3 SV=1 36 142 2.0E-25
sp|Q12ZU2|RS17_METBU 30S ribosomal protein S17P OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rps17p PE=3 SV=1 36 141 4.0E-25
sp|Q6LXE4|RS17_METMP 30S ribosomal protein S17P OS=Methanococcus maripaludis (strain S2 / LL) GN=rps17p PE=3 SV=1 37 145 2.0E-24
sp|P54036|RS17_METJA 30S ribosomal protein S17P OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rps17p PE=3 SV=1 36 140 2.0E-24
sp|O24786|RS17_HALSA 30S ribosomal protein S17P OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rps17p PE=3 SV=1 38 143 3.0E-24
sp|B0R665|RS17_HALS3 30S ribosomal protein S17P OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rps17p PE=3 SV=1 38 143 3.0E-24
sp|O26120|RS17_METTH 30S ribosomal protein S17P OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rps17p PE=3 SV=1 38 142 4.0E-24
sp|P14042|RS17_METVA 30S ribosomal protein S17P OS=Methanococcus vannielii GN=rps17p PE=3 SV=1 37 145 2.0E-23
sp|P12741|RS17_HALMA 30S ribosomal protein S17P OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rps17p PE=1 SV=3 38 134 3.0E-23
sp|Q2NFW6|RS17_METST 30S ribosomal protein S17P OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rps17p PE=3 SV=1 38 142 4.0E-23
sp|O28363|RS17_ARCFU 30S ribosomal protein S17P OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rps17p PE=3 SV=1 36 148 2.0E-22
sp|Q9UX98|RS17_SULSO 30S ribosomal protein S17P OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rps17p PE=3 SV=1 55 140 1.0E-21
sp|Q9HIR8|RS17_THEAC 30S ribosomal protein S17P OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rps17p PE=3 SV=1 34 141 2.0E-21
sp|Q8U008|RS17_PYRFU 30S ribosomal protein S17P OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rps17p PE=1 SV=1 36 142 2.0E-21
sp|Q97BW7|RS17_THEVO 30S ribosomal protein S17P OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rps17p PE=3 SV=1 36 141 2.0E-21
sp|Q9V1U5|RS17_PYRAB 30S ribosomal protein S17P OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rps17p PE=3 SV=2 36 142 2.0E-21
sp|O59426|RS17_PYRHO 30S ribosomal protein S17P OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rps17p PE=3 SV=1 36 142 3.0E-21
sp|Q975I9|RS17_SULTO 30S ribosomal protein S17P OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rps17p PE=3 SV=2 36 140 4.0E-21
sp|Q6L1B8|RS17_PICTO 30S ribosomal protein S17P OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rps17p PE=3 SV=1 36 140 1.0E-20
sp|A9A5I6|RS17_NITMS 30S ribosomal protein S17P OS=Nitrosopumilus maritimus (strain SCM1) GN=rps17p PE=3 SV=1 36 142 5.0E-20
sp|Q4JB49|RS17_SULAC 30S ribosomal protein S17P OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rps17p PE=3 SV=1 36 144 5.0E-20
sp|Q5JDH9|RS17_THEKO 30S ribosomal protein S17P OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rps17p PE=3 SV=1 36 142 1.0E-19
sp|Q18GF8|RS17_HALWD 30S ribosomal protein S17P OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rps17p PE=3 SV=1 38 134 3.0E-18
sp|Q8TP90|RS17L_METAC Putative 30S ribosomal protein S17P-like OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_2024 PE=3 SV=1 36 145 4.0E-18
sp|Q9YF81|RS17_AERPE 30S ribosomal protein S17P OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rps17p PE=3 SV=2 55 144 2.0E-17
sp|Q74NJ4|RS17_NANEQ 30S ribosomal protein S17P OS=Nanoarchaeum equitans (strain Kin4-M) GN=rps17p PE=3 SV=1 42 140 8.0E-13
sp|Q1R0G6|RS17_CHRSD 30S ribosomal protein S17 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rpsQ PE=3 SV=1 68 142 2.0E-09
sp|Q6LVA7|RS17_PHOPR 30S ribosomal protein S17 OS=Photobacterium profundum GN=rpsQ PE=3 SV=1 64 142 2.0E-09
sp|Q8ZWL3|RS17_PYRAE 30S ribosomal protein S17P OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rps17p PE=3 SV=2 36 140 4.0E-09
sp|C6C194|RS17_DESAD 30S ribosomal protein S17 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=rpsQ PE=3 SV=1 62 142 7.0E-09
sp|Q493J9|RS17_BLOPB 30S ribosomal protein S17 OS=Blochmannia pennsylvanicus (strain BPEN) GN=rpsQ PE=3 SV=1 64 134 2.0E-08
sp|A7NR54|RS17_ROSCS 30S ribosomal protein S17 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=rpsQ PE=3 SV=1 72 149 3.0E-08
sp|A1TYK6|RS17_MARHV 30S ribosomal protein S17 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rpsQ PE=3 SV=1 68 147 3.0E-08
sp|A5USI0|RS17_ROSS1 30S ribosomal protein S17 OS=Roseiflexus sp. (strain RS-1) GN=rpsQ PE=3 SV=1 72 149 3.0E-08
sp|Q21M49|RS17_SACD2 30S ribosomal protein S17 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rpsQ PE=3 SV=1 69 144 4.0E-08
sp|Q5E8A6|RS17_VIBF1 30S ribosomal protein S17 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rpsQ PE=3 SV=1 69 142 9.0E-08
sp|C0Q9W4|RS17_DESAH 30S ribosomal protein S17 OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=rpsQ PE=3 SV=1 67 139 1.0E-07
sp|A7N0I6|RS17_VIBCB 30S ribosomal protein S17 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rpsQ PE=3 SV=1 69 142 2.0E-07
sp|Q089P5|RS17_SHEFN 30S ribosomal protein S17 OS=Shewanella frigidimarina (strain NCIMB 400) GN=rpsQ PE=3 SV=1 64 142 3.0E-07
sp|B8GV49|RS17_THISH 30S ribosomal protein S17 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=rpsQ PE=3 SV=1 69 147 3.0E-07
sp|Q2LQB1|RS17_SYNAS 30S ribosomal protein S17 OS=Syntrophus aciditrophicus (strain SB) GN=rpsQ PE=3 SV=1 68 142 4.0E-07
sp|A1ALV0|RS17_PELPD 30S ribosomal protein S17 OS=Pelobacter propionicus (strain DSM 2379) GN=rpsQ PE=3 SV=1 64 143 7.0E-07
sp|A4WFB9|RS17_ENT38 30S ribosomal protein S17 OS=Enterobacter sp. (strain 638) GN=rpsQ PE=3 SV=1 69 142 7.0E-07
sp|Q12SV0|RS17_SHEDO 30S ribosomal protein S17 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rpsQ PE=3 SV=1 69 142 8.0E-07
sp|Q1LTC9|RS17_BAUCH 30S ribosomal protein S17 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rpsQ PE=3 SV=1 60 142 8.0E-07
sp|P38519|RS17_THEMA 30S ribosomal protein S17 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rpsQ PE=3 SV=2 71 142 8.0E-07
sp|B1LBN1|RS17_THESQ 30S ribosomal protein S17 OS=Thermotoga sp. (strain RQ2) GN=rpsQ PE=3 SV=1 71 142 9.0E-07
sp|B3PK46|RS17_CELJU 30S ribosomal protein S17 OS=Cellvibrio japonicus (strain Ueda107) GN=rpsQ PE=3 SV=1 68 147 1.0E-06
sp|A9NAX9|RS17_COXBR 30S ribosomal protein S17 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rpsQ PE=3 SV=1 69 144 1.0E-06
sp|A6TEW3|RS17_KLEP7 30S ribosomal protein S17 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rpsQ PE=3 SV=1 69 142 1.0E-06
sp|C5CGQ5|RS17_KOSOT 30S ribosomal protein S17 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=rpsQ PE=3 SV=1 71 144 1.0E-06
sp|Q88QM6|RS17_PSEPK 30S ribosomal protein S17 OS=Pseudomonas putida (strain KT2440) GN=rpsQ PE=3 SV=1 69 142 1.0E-06
sp|A5VXQ6|RS17_PSEP1 30S ribosomal protein S17 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rpsQ PE=3 SV=1 69 142 1.0E-06
sp|A5IM92|RS17_THEP1 30S ribosomal protein S17 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rpsQ PE=3 SV=1 71 142 1.0E-06
sp|C1DKM2|RS17_AZOVD 30S ribosomal protein S17 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rpsQ PE=3 SV=1 69 134 2.0E-06
sp|Q0I096|RS17_SHESR 30S ribosomal protein S17 OS=Shewanella sp. (strain MR-7) GN=rpsQ PE=3 SV=1 69 142 2.0E-06
sp|Q0HNS8|RS17_SHESM 30S ribosomal protein S17 OS=Shewanella sp. (strain MR-4) GN=rpsQ PE=3 SV=1 69 142 2.0E-06
sp|A0KRN3|RS17_SHESA 30S ribosomal protein S17 OS=Shewanella sp. (strain ANA-3) GN=rpsQ PE=3 SV=1 69 142 2.0E-06
sp|Q8EK60|RS17_SHEON 30S ribosomal protein S17 OS=Shewanella oneidensis (strain MR-1) GN=rpsQ PE=3 SV=1 69 142 2.0E-06
sp|Q5QXX3|RS17_IDILO 30S ribosomal protein S17 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rpsQ PE=3 SV=1 67 133 2.0E-06
sp|C5BQ70|RS17_TERTT 30S ribosomal protein S17 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=rpsQ PE=3 SV=1 69 144 2.0E-06
sp|Q3YWU8|RS17_SHISS 30S ribosomal protein S17 OS=Shigella sonnei (strain Ss046) GN=rpsQ PE=3 SV=1 69 142 2.0E-06
sp|P0AG66|RS17_SHIFL 30S ribosomal protein S17 OS=Shigella flexneri GN=rpsQ PE=3 SV=2 69 142 2.0E-06
sp|Q0SZZ1|RS17_SHIF8 30S ribosomal protein S17 OS=Shigella flexneri serotype 5b (strain 8401) GN=rpsQ PE=3 SV=1 69 142 2.0E-06
sp|Q32B40|RS17_SHIDS 30S ribosomal protein S17 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rpsQ PE=3 SV=1 69 142 2.0E-06
sp|Q31VW5|RS17_SHIBS 30S ribosomal protein S17 OS=Shigella boydii serotype 4 (strain Sb227) GN=rpsQ PE=3 SV=1 69 142 2.0E-06
sp|B2U2S9|RS17_SHIB3 30S ribosomal protein S17 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rpsQ PE=3 SV=1 69 142 2.0E-06
sp|B7LRS7|RS17_ESCF3 30S ribosomal protein S17 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rpsQ PE=3 SV=1 69 142 2.0E-06
sp|Q1R616|RS17_ECOUT 30S ribosomal protein S17 OS=Escherichia coli (strain UTI89 / UPEC) GN=rpsQ PE=3 SV=1 69 142 2.0E-06
sp|B1LHC5|RS17_ECOSM 30S ribosomal protein S17 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rpsQ PE=3 SV=1 69 142 2.0E-06
sp|B6I225|RS17_ECOSE 30S ribosomal protein S17 OS=Escherichia coli (strain SE11) GN=rpsQ PE=3 SV=1 69 142 2.0E-06
sp|B7NDT2|RS17_ECOLU 30S ribosomal protein S17 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rpsQ PE=3 SV=1 69 142 2.0E-06
sp|P0AG63|RS17_ECOLI 30S ribosomal protein S17 OS=Escherichia coli (strain K12) GN=rpsQ PE=1 SV=2 69 142 2.0E-06
sp|B1IPY8|RS17_ECOLC 30S ribosomal protein S17 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rpsQ PE=3 SV=1 69 142 2.0E-06
sp|P0AG64|RS17_ECOL6 30S ribosomal protein S17 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rpsQ PE=3 SV=2 69 142 2.0E-06
sp|Q0TCF0|RS17_ECOL5 30S ribosomal protein S17 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rpsQ PE=3 SV=1 69 142 2.0E-06
sp|A1AGK0|RS17_ECOK1 30S ribosomal protein S17 OS=Escherichia coli O1:K1 / APEC GN=rpsQ PE=3 SV=1 69 142 2.0E-06
sp|A8A5B6|RS17_ECOHS 30S ribosomal protein S17 OS=Escherichia coli O9:H4 (strain HS) GN=rpsQ PE=3 SV=1 69 142 2.0E-06
sp|B1X6G3|RS17_ECODH 30S ribosomal protein S17 OS=Escherichia coli (strain K12 / DH10B) GN=rpsQ PE=3 SV=1 69 142 2.0E-06
sp|C4ZUG6|RS17_ECOBW 30S ribosomal protein S17 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rpsQ PE=3 SV=1 69 142 2.0E-06
sp|B7M1M5|RS17_ECO8A 30S ribosomal protein S17 OS=Escherichia coli O8 (strain IAI1) GN=rpsQ PE=3 SV=1 69 142 2.0E-06
sp|B7N0V1|RS17_ECO81 30S ribosomal protein S17 OS=Escherichia coli O81 (strain ED1a) GN=rpsQ PE=3 SV=1 69 142 2.0E-06
sp|B7NLN0|RS17_ECO7I 30S ribosomal protein S17 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rpsQ PE=3 SV=1 69 142 2.0E-06
sp|B5YTN2|RS17_ECO5E 30S ribosomal protein S17 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rpsQ PE=3 SV=1 69 142 2.0E-06
sp|P0AG65|RS17_ECO57 30S ribosomal protein S17 OS=Escherichia coli O157:H7 GN=rpsQ PE=3 SV=2 69 142 2.0E-06
sp|B7L4K0|RS17_ECO55 30S ribosomal protein S17 OS=Escherichia coli (strain 55989 / EAEC) GN=rpsQ PE=3 SV=1 69 142 2.0E-06
sp|B7MCS6|RS17_ECO45 30S ribosomal protein S17 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rpsQ PE=3 SV=1 69 142 2.0E-06
sp|B7UK35|RS17_ECO27 30S ribosomal protein S17 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rpsQ PE=3 SV=1 69 142 2.0E-06
sp|A7ZSK0|RS17_ECO24 30S ribosomal protein S17 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rpsQ PE=3 SV=1 69 142 2.0E-06
sp|A7MPH2|RS17_CROS8 30S ribosomal protein S17 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rpsQ PE=3 SV=1 69 142 2.0E-06
sp|Q7MPH9|RS17_VIBVY 30S ribosomal protein S17 OS=Vibrio vulnificus (strain YJ016) GN=rpsQ PE=3 SV=1 69 142 2.0E-06
sp|Q8DE48|RS17_VIBVU 30S ribosomal protein S17 OS=Vibrio vulnificus (strain CMCP6) GN=rpsQ PE=3 SV=1 69 142 2.0E-06
sp|A9KD22|RS17_COXBN 30S ribosomal protein S17 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rpsQ PE=3 SV=1 69 144 2.0E-06
sp|Q89A75|RS17_BUCBP 30S ribosomal protein S17 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rpsQ PE=3 SV=1 69 144 2.0E-06
sp|A8G1D9|RS17_SHESH 30S ribosomal protein S17 OS=Shewanella sediminis (strain HAW-EB3) GN=rpsQ PE=3 SV=1 69 142 3.0E-06
sp|Q83ER7|RS17_COXBU 30S ribosomal protein S17 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rpsQ PE=3 SV=1 69 144 3.0E-06
sp|B8DNA5|RS17_DESVM 30S ribosomal protein S17 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=rpsQ PE=3 SV=1 67 142 3.0E-06
sp|Q2NQN1|RS17_SODGM 30S ribosomal protein S17 OS=Sodalis glossinidius (strain morsitans) GN=rpsQ PE=3 SV=1 69 142 3.0E-06
sp|B7VLE8|RS17_VIBTL 30S ribosomal protein S17 OS=Vibrio tasmaniensis (strain LGP32) GN=rpsQ PE=3 SV=1 68 142 3.0E-06
sp|P24321|RS17_THETH 30S ribosomal protein S17 OS=Thermus thermophilus GN=rpsQ PE=1 SV=4 69 142 3.0E-06
sp|P62658|RS17_THET2 30S ribosomal protein S17 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpsQ PE=1 SV=2 69 142 3.0E-06
sp|Q5SHP7|RS17_THET8 30S ribosomal protein S17 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpsQ PE=1 SV=3 69 142 3.0E-06
sp|B3E7U4|RS17_GEOLS 30S ribosomal protein S17 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rpsQ PE=3 SV=1 69 147 3.0E-06
sp|C3LRP9|RS17_VIBCM 30S ribosomal protein S17 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rpsQ PE=3 SV=1 69 142 3.0E-06
sp|Q9KNZ3|RS17_VIBCH 30S ribosomal protein S17 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rpsQ PE=3 SV=1 69 142 3.0E-06
sp|A5F557|RS17_VIBC3 30S ribosomal protein S17 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rpsQ PE=3 SV=1 69 142 3.0E-06
sp|Q87T04|RS17_VIBPA 30S ribosomal protein S17 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rpsQ PE=3 SV=1 69 142 3.0E-06
sp|P66451|RS17_SALTY 30S ribosomal protein S17 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rpsQ PE=3 SV=2 69 142 4.0E-06
sp|P66452|RS17_SALTI 30S ribosomal protein S17 OS=Salmonella typhi GN=rpsQ PE=3 SV=2 69 142 4.0E-06
sp|B4TXD3|RS17_SALSV 30S ribosomal protein S17 OS=Salmonella schwarzengrund (strain CVM19633) GN=rpsQ PE=3 SV=1 69 142 4.0E-06
sp|B5BGX7|RS17_SALPK 30S ribosomal protein S17 OS=Salmonella paratyphi A (strain AKU_12601) GN=rpsQ PE=3 SV=1 69 142 4.0E-06
sp|C0Q0A7|RS17_SALPC 30S ribosomal protein S17 OS=Salmonella paratyphi C (strain RKS4594) GN=rpsQ PE=3 SV=1 69 142 4.0E-06
sp|A9MSY9|RS17_SALPB 30S ribosomal protein S17 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rpsQ PE=3 SV=1 69 142 4.0E-06
sp|Q5PIU2|RS17_SALPA 30S ribosomal protein S17 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rpsQ PE=3 SV=1 69 142 4.0E-06
sp|B4SUT1|RS17_SALNS 30S ribosomal protein S17 OS=Salmonella newport (strain SL254) GN=rpsQ PE=3 SV=1 69 142 4.0E-06
sp|B4TKK6|RS17_SALHS 30S ribosomal protein S17 OS=Salmonella heidelberg (strain SL476) GN=rpsQ PE=3 SV=1 69 142 4.0E-06
sp|B5RH24|RS17_SALG2 30S ribosomal protein S17 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rpsQ PE=3 SV=1 69 142 4.0E-06
sp|B5R282|RS17_SALEP 30S ribosomal protein S17 OS=Salmonella enteritidis PT4 (strain P125109) GN=rpsQ PE=3 SV=1 69 142 4.0E-06
sp|B5FJK5|RS17_SALDC 30S ribosomal protein S17 OS=Salmonella dublin (strain CT_02021853) GN=rpsQ PE=3 SV=1 69 142 4.0E-06
sp|Q57J41|RS17_SALCH 30S ribosomal protein S17 OS=Salmonella choleraesuis (strain SC-B67) GN=rpsQ PE=3 SV=1 69 142 4.0E-06
sp|A9MN57|RS17_SALAR 30S ribosomal protein S17 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rpsQ PE=3 SV=1 69 142 4.0E-06
sp|B5F7T6|RS17_SALA4 30S ribosomal protein S17 OS=Salmonella agona (strain SL483) GN=rpsQ PE=3 SV=1 69 142 4.0E-06
sp|B1JDX5|RS17_PSEPW 30S ribosomal protein S17 OS=Pseudomonas putida (strain W619) GN=rpsQ PE=3 SV=1 69 142 4.0E-06
sp|B0KK76|RS17_PSEPG 30S ribosomal protein S17 OS=Pseudomonas putida (strain GB-1) GN=rpsQ PE=3 SV=1 69 142 4.0E-06
sp|Q1IFV7|RS17_PSEE4 30S ribosomal protein S17 OS=Pseudomonas entomophila (strain L48) GN=rpsQ PE=3 SV=1 69 142 4.0E-06
sp|A9NEE2|RS17_ACHLI 30S ribosomal protein S17 OS=Acholeplasma laidlawii (strain PG-8A) GN=rpsQ PE=3 SV=1 69 144 4.0E-06
sp|B6EPT4|RS17_ALISL 30S ribosomal protein S17 OS=Aliivibrio salmonicida (strain LFI1238) GN=rpsQ PE=3 SV=1 69 142 4.0E-06
sp|A9BH96|RS17_PETMO 30S ribosomal protein S17 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=rpsQ PE=3 SV=1 69 144 4.0E-06
sp|C6DG65|RS17_PECCP 30S ribosomal protein S17 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rpsQ PE=3 SV=1 69 142 4.0E-06
sp|Q6CZX9|RS17_PECAS 30S ribosomal protein S17 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rpsQ PE=3 SV=1 69 142 4.0E-06
sp|Q2S921|RS17_HAHCH 30S ribosomal protein S17 OS=Hahella chejuensis (strain KCTC 2396) GN=rpsQ PE=3 SV=1 69 142 5.0E-06
sp|A1S227|RS17_SHEAM 30S ribosomal protein S17 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rpsQ PE=3 SV=1 69 142 6.0E-06
sp|Q8D203|RS17_WIGBR 30S ribosomal protein S17 OS=Wigglesworthia glossinidia brevipalpis GN=rpsQ PE=3 SV=1 69 145 6.0E-06
sp|C3K2W7|RS17_PSEFS 30S ribosomal protein S17 OS=Pseudomonas fluorescens (strain SBW25) GN=rpsQ PE=3 SV=1 69 142 6.0E-06
sp|A8AQK7|RS17_CITK8 30S ribosomal protein S17 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rpsQ PE=3 SV=1 69 142 6.0E-06
sp|Q9HWE4|RS17_PSEAE 30S ribosomal protein S17 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rpsQ PE=3 SV=1 69 134 6.0E-06
sp|Q02T71|RS17_PSEAB 30S ribosomal protein S17 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rpsQ PE=3 SV=1 69 134 6.0E-06
sp|B7V653|RS17_PSEA8 30S ribosomal protein S17 OS=Pseudomonas aeruginosa (strain LESB58) GN=rpsQ PE=3 SV=1 69 134 6.0E-06
sp|A6UZJ7|RS17_PSEA7 30S ribosomal protein S17 OS=Pseudomonas aeruginosa (strain PA7) GN=rpsQ PE=3 SV=1 69 134 6.0E-06
sp|P46175|RS17_BUCAK 30S ribosomal protein S17 OS=Buchnera aphidicola subsp. Acyrthosiphon kondoi GN=rpsQ PE=3 SV=1 69 142 7.0E-06
sp|B8CNE2|RS17_SHEPW 30S ribosomal protein S17 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rpsQ PE=3 SV=1 69 142 8.0E-06
sp|Q9CL40|RS17_PASMU 30S ribosomal protein S17 OS=Pasteurella multocida (strain Pm70) GN=rpsQ PE=3 SV=1 69 149 9.0E-06
sp|B8F764|RS17_HAEPS 30S ribosomal protein S17 OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=rpsQ PE=3 SV=1 69 142 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0003735 structural constituent of ribosome Yes
GO:0009059 macromolecule biosynthetic process No
GO:0009058 biosynthetic process No
GO:0043226 organelle No
GO:0019538 protein metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044238 primary metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0008152 metabolic process No
GO:0043228 non-membrane-bounded organelle No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0043043 peptide biosynthetic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006518 peptide metabolic process No
GO:0043604 amide biosynthetic process No
GO:0110165 cellular anatomical entity No
GO:0043603 cellular amide metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0005198 structural molecule activity No
GO:1901566 organonitrogen compound biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|006300
MADAQIEKAFQKQHLFQNTKARGGKKVVTRQKRWYKDVGLGFKTPSDAINGTYIDKKCPFTGDVSIRGRILTGKV
VSTKMTRTIIIRRDYLRYISKYSRYEKRHTNLAAHVSPAFRVELGDTVTVGQCRPLSKTVRFNVLRVSRNKATAK
SFGKF*
Coding >Agabi119p4|006300
ATGGCCGACGCACAAATCGAAAAGGCTTTCCAAAAGCAACACCTCTTCCAAAACACCAAAGCCCGTGGCGGCAAG
AAGGTCGTGACCAGGCAGAAGAGATGGTATAAGGATGTTGGTCTGGGGTTCAAGACGCCCTCGGACGCCATCAAC
GGAACTTATATTGACAAAAAGTGCCCTTTCACTGGCGATGTTTCCATTCGAGGCCGCATCCTCACCGGCAAAGTT
GTGTCTACGAAAATGACGCGCACGATCATCATCCGAAGGGATTACTTGCGCTACATCTCCAAATACAGTCGTTAC
GAAAAGCGGCACACCAATCTGGCTGCCCATGTTTCTCCTGCTTTCCGTGTTGAACTTGGCGACACTGTTACAGTT
GGACAATGCCGACCATTGTCAAAGACGGTGCGGTTCAACGTGTTGCGGGTGTCGAGGAACAAGGCGACGGCCAAG
TCGTTTGGCAAGTTCTAG
Transcript >Agabi119p4|006300
ATGGCCGACGCACAAATCGAAAAGGCTTTCCAAAAGCAACACCTCTTCCAAAACACCAAAGCCCGTGGCGGCAAG
AAGGTCGTGACCAGGCAGAAGAGATGGTATAAGGATGTTGGTCTGGGGTTCAAGACGCCCTCGGACGCCATCAAC
GGAACTTATATTGACAAAAAGTGCCCTTTCACTGGCGATGTTTCCATTCGAGGCCGCATCCTCACCGGCAAAGTT
GTGTCTACGAAAATGACGCGCACGATCATCATCCGAAGGGATTACTTGCGCTACATCTCCAAATACAGTCGTTAC
GAAAAGCGGCACACCAATCTGGCTGCCCATGTTTCTCCTGCTTTCCGTGTTGAACTTGGCGACACTGTTACAGTT
GGACAATGCCGACCATTGTCAAAGACGGTGCGGTTCAACGTGTTGCGGGTGTCGAGGAACAAGGCGACGGCCAAG
TCGTTTGGCAAGTTCTAG
Gene >Agabi119p4|006300
ATGGCCGACGCACAAGTGTGTATGATACAAATTTCTTCTCGAAGTTGTGAACTTATTAGCGTTCCCGTTGCAGAT
CGAAAAGGCTTTCCAAAAGCAACACCTCTTCCAAAACACCAAAGCCCGTGGTGCGTCAGGATCTTTCTAGGTCTT
ATTGGACTGGATTTGATGCATCATTGGCTTCTTATTGCATAGGCGGCAAGAAGGTCGTGACCAGGCAGAAGAGAT
GGTATAAGGATGTTGGTCTGGGGTTCAAGACGCCCTCGGACGCCATCAACGGAACTTATATTGGTGTGTTGCATG
CATGATATTGTATGATTGTCCTTAATTGACGATAATGCACAGACAAAAAGTGCCCTTTCACTGGCGATGTTTCCA
TTCGAGGCCGCATCCTCACCGGCAAAGTTGTGTCTACGAAAATGACGCGCACGATCATCATCCGAAGGGATTACT
TGCGCTACATCTCCAAATACAGTGAGTATTGAGTGACGTGCTAATTCACACTCTAACAAATGTGACAACAGGTCG
TTACGAAAAGCGGCACACCAATCTGGCTGCCCATGTTTCTCCTGCTTTCCGTGTTGAACTTGGCGACACTGTTAC
AGTTGGTGAGTGGTACGAATGCAGTCGTGTTTGACAAAGTGGCTAACCGGGCGTGGAGGACAATGCCGACCATTG
TCAAAGACGGTGCGGTTCAACGTGTTGCGGGTGTCGAGGAACAAGGCGACGGCCAAGTCGTTTGGCAAGTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail