Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|006010
Gene name
Locationscaffold_01a:1450530..1453624
Strand-
Gene length (bp)3094
Transcript length (bp)2367
Coding sequence length (bp)2367
Protein length (aa) 789

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04227 Indigoidine_A Indigoidine synthase A like protein 2.8E-121 41 333
PF00294 PfkB pfkB family carbohydrate kinase 6.9E-07 379 487
PF00294 PfkB pfkB family carbohydrate kinase 1.2E-06 711 775

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USY1|YOW5_SCHPO Pseudouridine-metabolizing bifunctional protein C1861.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1861.05 PE=3 SV=1 31 782 5.0E-116
sp|Q8NYD0|PSUG_STAAW Pseudouridine-5'-phosphate glycosidase OS=Staphylococcus aureus (strain MW2) GN=psuG PE=3 SV=1 36 338 1.0E-88
sp|A7GCK7|PSUG_CLOBL Pseudouridine-5'-phosphate glycosidase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=psuG PE=3 SV=1 36 338 4.0E-88
sp|Q9RS16|PSUG_DEIRA Pseudouridine-5'-phosphate glycosidase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=psuG PE=3 SV=1 30 323 1.0E-86
sp|C0ZIY1|PSUG_BREBN Pseudouridine-5'-phosphate glycosidase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=psuG PE=3 SV=1 41 340 5.0E-86
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USY1|YOW5_SCHPO Pseudouridine-metabolizing bifunctional protein C1861.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1861.05 PE=3 SV=1 31 782 5.0E-116
sp|Q8NYD0|PSUG_STAAW Pseudouridine-5'-phosphate glycosidase OS=Staphylococcus aureus (strain MW2) GN=psuG PE=3 SV=1 36 338 1.0E-88
sp|A7GCK7|PSUG_CLOBL Pseudouridine-5'-phosphate glycosidase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=psuG PE=3 SV=1 36 338 4.0E-88
sp|Q9RS16|PSUG_DEIRA Pseudouridine-5'-phosphate glycosidase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=psuG PE=3 SV=1 30 323 1.0E-86
sp|C0ZIY1|PSUG_BREBN Pseudouridine-5'-phosphate glycosidase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=psuG PE=3 SV=1 41 340 5.0E-86
sp|B1HV79|PSUG_LYSSC Pseudouridine-5'-phosphate glycosidase OS=Lysinibacillus sphaericus (strain C3-41) GN=psuG PE=3 SV=1 36 338 1.0E-85
sp|C0QZV6|PSUG_BRAHW Pseudouridine-5'-phosphate glycosidase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=psuG PE=3 SV=1 36 339 1.0E-84
sp|P33025|PSUG_ECOLI Pseudouridine-5'-phosphate glycosidase OS=Escherichia coli (strain K12) GN=psuG PE=1 SV=1 36 339 1.0E-84
sp|Q1M4T3|PSUG2_RHIL3 Pseudouridine-5'-phosphate glycosidase 2 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=psuG2 PE=3 SV=1 41 343 2.0E-84
sp|Q2SM69|PSUG_HAHCH Pseudouridine-5'-phosphate glycosidase OS=Hahella chejuensis (strain KCTC 2396) GN=psuG PE=3 SV=1 33 323 1.0E-83
sp|B8F668|PSUG_HAEPS Pseudouridine-5'-phosphate glycosidase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=psuG PE=3 SV=1 41 337 3.0E-83
sp|A6TL60|PSUG_ALKMQ Pseudouridine-5'-phosphate glycosidase OS=Alkaliphilus metalliredigens (strain QYMF) GN=psuG PE=3 SV=1 36 332 7.0E-83
sp|Q01RY8|PSUG_SOLUE Pseudouridine-5'-phosphate glycosidase OS=Solibacter usitatus (strain Ellin6076) GN=psuG PE=3 SV=1 36 334 9.0E-83
sp|A1SQN1|PSUG_NOCSJ Pseudouridine-5'-phosphate glycosidase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=psuG PE=3 SV=1 41 338 6.0E-82
sp|A9BJN0|PSUG_PETMO Pseudouridine-5'-phosphate glycosidase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=psuG PE=3 SV=1 36 335 1.0E-81
sp|A5IXG3|PSUG_MYCAP Pseudouridine-5'-phosphate glycosidase OS=Mycoplasma agalactiae (strain PG2) GN=psuG PE=3 SV=1 41 337 1.0E-80
sp|A1B316|PSUG_PARDP Pseudouridine-5'-phosphate glycosidase OS=Paracoccus denitrificans (strain Pd 1222) GN=psuG PE=3 SV=1 36 323 2.0E-80
sp|Q28PY7|PSUG_JANSC Pseudouridine-5'-phosphate glycosidase OS=Jannaschia sp. (strain CCS1) GN=psuG PE=3 SV=1 35 333 3.0E-80
sp|B6IRJ4|PSUG_RHOCS Pseudouridine-5'-phosphate glycosidase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=psuG PE=3 SV=1 36 338 7.0E-80
sp|Q7MZE1|PSUG2_PHOLL Pseudouridine-5'-phosphate glycosidase 2 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=psuG2 PE=3 SV=1 32 335 7.0E-80
sp|Q98NQ8|PSUG_RHILO Pseudouridine-5'-phosphate glycosidase OS=Rhizobium loti (strain MAFF303099) GN=psuG PE=3 SV=1 26 333 4.0E-79
sp|Q8RCT3|PSUG_CALS4 Pseudouridine-5'-phosphate glycosidase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=psuG PE=3 SV=1 33 338 1.0E-78
sp|A9NGD7|PSUG_ACHLI Pseudouridine-5'-phosphate glycosidase OS=Acholeplasma laidlawii (strain PG-8A) GN=psuG PE=3 SV=1 33 338 6.0E-78
sp|Q5L078|PSUG_GEOKA Pseudouridine-5'-phosphate glycosidase OS=Geobacillus kaustophilus (strain HTA426) GN=psuG PE=3 SV=1 41 322 7.0E-78
sp|Q165S4|PSUG_ROSDO Pseudouridine-5'-phosphate glycosidase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=psuG PE=3 SV=1 50 333 4.0E-77
sp|Q5ZU79|PSUG_LEGPH Pseudouridine-5'-phosphate glycosidase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=psuG PE=3 SV=1 36 337 9.0E-77
sp|Q46PS3|PSUG_CUPPJ Pseudouridine-5'-phosphate glycosidase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=psuG PE=3 SV=2 52 327 7.0E-75
sp|A8LQI0|PSUG_DINSH Pseudouridine-5'-phosphate glycosidase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=psuG PE=3 SV=1 36 332 1.0E-74
sp|Q1MFZ6|PSUG1_RHIL3 Pseudouridine-5'-phosphate glycosidase 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=psuG1 PE=3 SV=1 35 332 1.0E-73
sp|A9GT78|PSUG_SORC5 Pseudouridine-5'-phosphate glycosidase OS=Sorangium cellulosum (strain So ce56) GN=psuG PE=3 SV=1 36 323 2.0E-73
sp|Q1D739|PSUG_MYXXD Pseudouridine-5'-phosphate glycosidase OS=Myxococcus xanthus (strain DK 1622) GN=psuG PE=3 SV=1 41 337 1.0E-72
sp|B5Y6G9|PSUG_COPPD Pseudouridine-5'-phosphate glycosidase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=psuG PE=3 SV=1 36 333 2.0E-72
sp|A5UT22|PSUG_ROSS1 Pseudouridine-5'-phosphate glycosidase OS=Roseiflexus sp. (strain RS-1) GN=psuG PE=3 SV=1 30 338 3.0E-71
sp|C6CFY1|PSUG_DICZE Pseudouridine-5'-phosphate glycosidase OS=Dickeya zeae (strain Ech1591) GN=psuG PE=3 SV=1 41 344 4.0E-68
sp|A9B4S4|PSUG_HERA2 Pseudouridine-5'-phosphate glycosidase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=psuG PE=3 SV=1 40 321 5.0E-68
sp|B9LGZ1|PSUG_CHLSY Pseudouridine-5'-phosphate glycosidase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=psuG PE=3 SV=1 36 338 1.0E-67
sp|B1W0X1|PSUG_STRGG Pseudouridine-5'-phosphate glycosidase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=psuG PE=3 SV=1 18 323 3.0E-66
sp|A8GCG3|PSUG_SERP5 Pseudouridine-5'-phosphate glycosidase OS=Serratia proteamaculans (strain 568) GN=psuG PE=3 SV=1 35 337 7.0E-66
sp|B7ID34|PSUG_THEAB Pseudouridine-5'-phosphate glycosidase OS=Thermosipho africanus (strain TCF52B) GN=psuG PE=3 SV=1 38 337 8.0E-66
sp|Q67N11|PSUG_SYMTH Pseudouridine-5'-phosphate glycosidase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=psuG PE=3 SV=1 40 332 8.0E-65
sp|Q7N4X5|PSUG1_PHOLL Pseudouridine-5'-phosphate glycosidase 1 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=psuG1 PE=3 SV=1 35 332 4.0E-64
sp|A4F929|PSUG_SACEN Pseudouridine-5'-phosphate glycosidase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=psuG PE=3 SV=1 38 336 4.0E-64
sp|B8II14|PSUG_METNO Pseudouridine-5'-phosphate glycosidase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=psuG PE=3 SV=1 36 323 1.0E-62
sp|A7HMA1|PSUG_FERNB Pseudouridine-5'-phosphate glycosidase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=psuG PE=3 SV=1 38 339 5.0E-61
sp|C5CDZ1|PSUG_KOSOT Pseudouridine-5'-phosphate glycosidase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=psuG PE=3 SV=1 50 332 1.0E-60
sp|Q0RBB8|PSUG_FRAAA Pseudouridine-5'-phosphate glycosidase OS=Frankia alni (strain ACN14a) GN=psuG PE=3 SV=1 42 336 6.0E-58
sp|B3GW58|PSUG_CORA7 Pseudouridine-5'-phosphate glycosidase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=psuG PE=3 SV=1 33 332 9.0E-56
sp|A4X4Y7|PSUG_SALTO Pseudouridine-5'-phosphate glycosidase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=psuG PE=3 SV=1 41 323 4.0E-53
sp|Q1AYR4|PSUG_RUBXD Pseudouridine-5'-phosphate glycosidase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=psuG PE=3 SV=1 35 321 5.0E-53
sp|A8F8N4|PSUG_PSELT Pseudouridine-5'-phosphate glycosidase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=psuG PE=3 SV=1 50 338 4.0E-50
sp|Q72JF9|PSUG_THET2 Pseudouridine-5'-phosphate glycosidase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=psuG PE=3 SV=1 50 321 2.0E-48
sp|C1AA54|PSUG_GEMAT Pseudouridine-5'-phosphate glycosidase OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=psuG PE=3 SV=1 42 332 2.0E-48
sp|B1LBK3|PSUG_THESQ Pseudouridine-5'-phosphate glycosidase OS=Thermotoga sp. (strain RQ2) GN=psuG PE=3 SV=1 42 337 2.0E-44
sp|Q9X1H5|PSUG_THEMA Pseudouridine-5'-phosphate glycosidase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=psuG PE=1 SV=1 42 337 3.0E-44
sp|A5IMC0|PSUG_THEP1 Pseudouridine-5'-phosphate glycosidase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=psuG PE=3 SV=1 42 337 1.0E-43
sp|B8JB61|PSUG_ANAD2 Pseudouridine-5'-phosphate glycosidase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=psuG PE=3 SV=1 33 330 4.0E-42
sp|B9K8C2|PSUG_THENN Pseudouridine-5'-phosphate glycosidase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=psuG PE=3 SV=1 42 342 2.0E-40
sp|P30235|PSUK_ECOLI Pseudouridine kinase OS=Escherichia coli (strain K12) GN=psuK PE=1 SV=2 379 556 5.0E-10
sp|P33020|YEII_ECOLI Uncharacterized sugar kinase YeiI OS=Escherichia coli (strain K12) GN=yeiI PE=3 SV=2 380 584 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004730 pseudouridylate synthase activity Yes
GO:0016835 carbon-oxygen lyase activity No
GO:0016836 hydro-lyase activity No
GO:0003824 catalytic activity No
GO:0016829 lyase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|006010
MVSCARYIRIVNKACAGSARRHVSRLSPIERANAPIDIHPEVEEALGTAKPVVSLETAVITHGLPYPNNLELGLE
LENIIRSTGSIPATIGMLDGRIKVGLERFELERLADPDRKKAKISRRDIAPAVASKADGGTTCSATLIFSAMTGI
KVFSTGGMGGVHRGAETTMDISADLHELTRCPVGLVSAGVKSILDIGRTLEYLETLGIPVVAYGEGRDFPAFFSR
TSGFTVPWSVNDPLLAARILYTQTELRLQNGAIFAVPIPQEYEAKGEMIQGLVNQAIAESEANGMSKRGKDVTPW
LLARVVELTKGESMESNMALLRNTARVGGQIANQYAKLASGRNNLATSVTPLPAEEPAAGVGSAGPGIEEDVALP
PADLIIIGSAAVDITAQTMTDSDTRLSQHSTSPGKVSLSLGGVARNVAEASHRILAAQEHATSSLLVAPVGEDVL
GKLLFEETQRLGMRTDGFLKSDKRTAVCNMVLDNTGNLVGGVADMDITQAITDEQIIPRLRKHIPKLVAIDGNFS
PATTKGIVSYCIKNDIKVFFEPTSVIKSTSILPLIQDLLVNTDLKKPPIAFFSPNLPELVHVYNTIQAEPYNLSN
NSYWWTCIDSMGLGSAFRMDLEQLARRNATDLDVSKGTLSFLIDQGIAQMAVNLLPIFQHLIIKCGERGAIVVMR
IDPEDAATSPWGRQRSNPLARYVVVQGNSKEIIVLQHFPGLNVDNITNVTGAGDSFVGAVLASISNNPQALLNPE
DLEHTISTAQQAALLTLQSDLAVSPLLSDSLKLQSSAI*
Coding >Agabi119p4|006010
ATGGTGTCGTGCGCGCGCTATATACGTATCGTCAACAAGGCTTGTGCAGGCAGTGCACGACGGCATGTATCGCGT
CTCTCGCCTATCGAACGAGCGAATGCACCCATTGATATACATCCGGAAGTCGAGGAAGCTCTGGGCACCGCAAAA
CCTGTCGTATCTCTTGAAACTGCTGTCATAACCCATGGTCTGCCGTATCCCAACAATCTGGAGCTCGGCCTCGAG
TTGGAAAATATTATCAGGTCGACCGGGTCTATCCCTGCAACTATTGGAATGCTGGACGGAAGAATCAAAGTTGGT
CTGGAAAGATTTGAACTTGAGAGGCTTGCAGATCCTGACAGGAAAAAGGCGAAAATCTCGAGGAGGGACATCGCC
CCTGCGGTTGCTTCAAAAGCAGACGGAGGTACGACTTGTAGTGCAACGCTTATATTCTCTGCCATGACAGGCATT
AAGGTGTTTTCGACTGGGGGCATGGGTGGAGTACATCGAGGAGCCGAAACGACTATGGATATCTCTGCTGATCTC
CATGAGCTAACTCGATGTCCTGTGGGTCTCGTATCCGCAGGTGTCAAGTCCATACTTGATATAGGAAGGACATTG
GAGTACCTCGAAACGTTGGGTATTCCTGTGGTGGCTTATGGTGAAGGCCGCGATTTTCCTGCATTCTTTTCTCGA
ACAAGTGGGTTCACGGTTCCATGGAGTGTGAACGACCCTTTACTTGCAGCTAGAATCCTGTACACCCAAACAGAA
TTAAGACTTCAAAATGGTGCCATCTTTGCCGTTCCTATTCCTCAAGAGTATGAAGCAAAAGGAGAAATGATCCAA
GGACTGGTTAACCAGGCAATTGCAGAATCCGAAGCTAATGGAATGAGTAAGCGAGGAAAGGATGTTACACCATGG
CTTTTGGCTCGTGTGGTAGAGTTAACGAAAGGCGAATCCATGGAGTCTAACATGGCTTTACTGAGAAATACGGCA
CGTGTTGGTGGCCAAATTGCTAATCAATATGCAAAACTGGCTAGTGGTCGTAATAATCTTGCCACGTCCGTCACT
CCATTACCAGCCGAAGAGCCCGCCGCCGGTGTGGGTTCTGCCGGCCCAGGAATCGAGGAAGACGTGGCATTGCCA
CCAGCTGATCTCATAATTATTGGTTCTGCGGCAGTGGACATTACGGCACAGACAATGACTGACTCCGATACTAGG
TTGTCGCAGCACTCTACTTCTCCTGGAAAAGTTTCTTTATCATTAGGAGGTGTGGCGAGGAACGTAGCCGAGGCA
TCCCATCGTATCTTAGCCGCACAGGAACATGCGACATCGTCACTGTTGGTGGCACCTGTGGGTGAGGATGTTTTG
GGGAAGCTGCTTTTTGAGGAAACGCAAAGACTAGGTATGAGAACTGACGGGTTTTTGAAAAGCGACAAGAGGACA
GCTGTTTGTAACATGGTTCTTGATAATACGGGCAATCTCGTTGGAGGAGTGGCGGATATGGATATCACTCAAGCC
ATCACCGATGAACAAATCATCCCTCGGTTGCGAAAGCACATTCCCAAGCTTGTAGCTATTGATGGGAATTTTTCT
CCCGCGACAACAAAGGGAATCGTCAGTTATTGCATCAAAAACGATATCAAAGTGTTCTTCGAACCCACCTCAGTC
ATCAAATCCACGTCTATTCTACCGTTGATACAAGATCTCCTGGTGAATACTGACCTCAAGAAACCTCCCATTGCA
TTCTTTTCACCAAACCTCCCGGAGCTCGTCCACGTCTATAACACGATCCAAGCGGAACCCTATAATTTATCCAAC
AATTCATACTGGTGGACATGTATTGACAGCATGGGGCTCGGTTCCGCGTTCCGTATGGATTTGGAGCAACTCGCA
AGGAGGAATGCGACGGATTTGGATGTTAGCAAAGGCACACTGTCCTTTTTGATTGACCAGGGCATTGCGCAGATG
GCCGTCAACCTTCTTCCGATATTCCAACACCTCATTATTAAATGCGGGGAACGCGGGGCCATCGTTGTTATGCGT
ATTGACCCCGAAGATGCAGCGACGTCACCATGGGGACGGCAAAGGAGTAACCCCCTTGCCCGGTATGTCGTTGTA
CAAGGGAACAGCAAGGAGATTATTGTCTTGCAACACTTCCCGGGTCTAAATGTGGATAACATTACCAACGTGACT
GGAGCGGGAGATTCGTTTGTAGGCGCTGTTCTCGCTTCGATTTCAAACAACCCTCAAGCTTTATTGAATCCGGAG
GACCTCGAGCATACAATAAGCACAGCTCAACAAGCAGCTCTGTTGACGCTGCAGAGCGATTTGGCGGTTTCGCCG
TTGCTCTCTGATTCTTTGAAACTCCAATCATCAGCCATATGA
Transcript >Agabi119p4|006010
ATGGTGTCGTGCGCGCGCTATATACGTATCGTCAACAAGGCTTGTGCAGGCAGTGCACGACGGCATGTATCGCGT
CTCTCGCCTATCGAACGAGCGAATGCACCCATTGATATACATCCGGAAGTCGAGGAAGCTCTGGGCACCGCAAAA
CCTGTCGTATCTCTTGAAACTGCTGTCATAACCCATGGTCTGCCGTATCCCAACAATCTGGAGCTCGGCCTCGAG
TTGGAAAATATTATCAGGTCGACCGGGTCTATCCCTGCAACTATTGGAATGCTGGACGGAAGAATCAAAGTTGGT
CTGGAAAGATTTGAACTTGAGAGGCTTGCAGATCCTGACAGGAAAAAGGCGAAAATCTCGAGGAGGGACATCGCC
CCTGCGGTTGCTTCAAAAGCAGACGGAGGTACGACTTGTAGTGCAACGCTTATATTCTCTGCCATGACAGGCATT
AAGGTGTTTTCGACTGGGGGCATGGGTGGAGTACATCGAGGAGCCGAAACGACTATGGATATCTCTGCTGATCTC
CATGAGCTAACTCGATGTCCTGTGGGTCTCGTATCCGCAGGTGTCAAGTCCATACTTGATATAGGAAGGACATTG
GAGTACCTCGAAACGTTGGGTATTCCTGTGGTGGCTTATGGTGAAGGCCGCGATTTTCCTGCATTCTTTTCTCGA
ACAAGTGGGTTCACGGTTCCATGGAGTGTGAACGACCCTTTACTTGCAGCTAGAATCCTGTACACCCAAACAGAA
TTAAGACTTCAAAATGGTGCCATCTTTGCCGTTCCTATTCCTCAAGAGTATGAAGCAAAAGGAGAAATGATCCAA
GGACTGGTTAACCAGGCAATTGCAGAATCCGAAGCTAATGGAATGAGTAAGCGAGGAAAGGATGTTACACCATGG
CTTTTGGCTCGTGTGGTAGAGTTAACGAAAGGCGAATCCATGGAGTCTAACATGGCTTTACTGAGAAATACGGCA
CGTGTTGGTGGCCAAATTGCTAATCAATATGCAAAACTGGCTAGTGGTCGTAATAATCTTGCCACGTCCGTCACT
CCATTACCAGCCGAAGAGCCCGCCGCCGGTGTGGGTTCTGCCGGCCCAGGAATCGAGGAAGACGTGGCATTGCCA
CCAGCTGATCTCATAATTATTGGTTCTGCGGCAGTGGACATTACGGCACAGACAATGACTGACTCCGATACTAGG
TTGTCGCAGCACTCTACTTCTCCTGGAAAAGTTTCTTTATCATTAGGAGGTGTGGCGAGGAACGTAGCCGAGGCA
TCCCATCGTATCTTAGCCGCACAGGAACATGCGACATCGTCACTGTTGGTGGCACCTGTGGGTGAGGATGTTTTG
GGGAAGCTGCTTTTTGAGGAAACGCAAAGACTAGGTATGAGAACTGACGGGTTTTTGAAAAGCGACAAGAGGACA
GCTGTTTGTAACATGGTTCTTGATAATACGGGCAATCTCGTTGGAGGAGTGGCGGATATGGATATCACTCAAGCC
ATCACCGATGAACAAATCATCCCTCGGTTGCGAAAGCACATTCCCAAGCTTGTAGCTATTGATGGGAATTTTTCT
CCCGCGACAACAAAGGGAATCGTCAGTTATTGCATCAAAAACGATATCAAAGTGTTCTTCGAACCCACCTCAGTC
ATCAAATCCACGTCTATTCTACCGTTGATACAAGATCTCCTGGTGAATACTGACCTCAAGAAACCTCCCATTGCA
TTCTTTTCACCAAACCTCCCGGAGCTCGTCCACGTCTATAACACGATCCAAGCGGAACCCTATAATTTATCCAAC
AATTCATACTGGTGGACATGTATTGACAGCATGGGGCTCGGTTCCGCGTTCCGTATGGATTTGGAGCAACTCGCA
AGGAGGAATGCGACGGATTTGGATGTTAGCAAAGGCACACTGTCCTTTTTGATTGACCAGGGCATTGCGCAGATG
GCCGTCAACCTTCTTCCGATATTCCAACACCTCATTATTAAATGCGGGGAACGCGGGGCCATCGTTGTTATGCGT
ATTGACCCCGAAGATGCAGCGACGTCACCATGGGGACGGCAAAGGAGTAACCCCCTTGCCCGGTATGTCGTTGTA
CAAGGGAACAGCAAGGAGATTATTGTCTTGCAACACTTCCCGGGTCTAAATGTGGATAACATTACCAACGTGACT
GGAGCGGGAGATTCGTTTGTAGGCGCTGTTCTCGCTTCGATTTCAAACAACCCTCAAGCTTTATTGAATCCGGAG
GACCTCGAGCATACAATAAGCACAGCTCAACAAGCAGCTCTGTTGACGCTGCAGAGCGATTTGGCGGTTTCGCCG
TTGCTCTCTGATTCTTTGAAACTCCAATCATCAGCCATATGA
Gene >Agabi119p4|006010
ATGGTGTCGTGCGCGCGCTATATACGTATCGTCAACAAGGCTTGTGCAGGCAGTGCACGACGGCATGTATCGCGT
CTCTCGCCTATCGAACGAGCGAATGCACCCATTGATATACATCCGGAAGTCGAGGAAGCTCTGGGCACCGCAAAA
CCTGTCGTATCTCTTGAAACTGCTGTCATAACCCATGGTCTGCCGTATCCCAACAATCTGGAGCTCGGCCTCGAG
TTGGAAAATATTATCAGGTCGACCGGGTCTATCCCTGCAACTATTGGAATGCTGGACGGAAGAATCAAAGTTGGT
CTGGAAAGATTTGAACTTGAGAGGCTTGCAGATCCTGACAGGAAAAAGGCGAAAATCTCGAGGAGGGACATCGCC
CCTGCGGTTGCTTCAAAAGCAGACGGAGGTCAGTCAAGAGCACTTGAAGAAAATTCTAATAGTTCAAAGCATGGA
CCTAGGTACGACTTGTAGTGCAACGCTTATATTCTCTGCCATGACAGGCATTAAGGTACGCATCGGCATCCCTAT
ATTTCTCGCCTCAGCTATTCATAAAACACTGCAGGTGTTTTCGACTGGGGGGTACGTCTATCTCAGACGCAGGTG
TACAGTGTGCTGAAGTTAATGCTAAAGCATGGGTGGAGTACATCGAGGAGCCGAAACGAGTATGTGATCTTGCTT
TGCTCAGCTTTGATTATCCCTGACATACTAGCTGCTAGCTATGGATATCTCTGCTGATCTCCATGAGCTAACTCG
ATGTCCTGTGGGTCTCGTATCCGCAGGTGTCAAGTCCATACTTGATATAGGAAGGTTCGTGGTATCATAAGAACT
ATTTGTGTACTGCCTCATCTGCATCGCTGCTAGGACATTGGAGTACCTCGTATGTCATGGCATGTTTCTTTTCAA
AAGCCTATGATGCTTATGCCATTCCAGGAAACGTTGGGTATTCCTGTGGTGGCTTATGGTGAAGGCCGCGATTTT
CCTGCATTCTTTTCTCGAACAAGTGGGTTCACGGTACGTATTTGTTGTCTCAACCAAGCACGGCTGGTACCACGA
GAATAGGTTCCATGGAGTGTGAACGACCCTTTACTTGCAGCTAGAATCCTGTGTTGGTATTGTCTCGTCGCTTCG
ATTCATCCCACGACTTAAGCCGAATTCTAGACACCCAAACAGAATTAAGACTTCAAAATGGTGCCATCTTTGCCG
TTCCTATTCCTCAAGAGTATGAAGCAAAAGGAGAAATGATCCAAGGACTGGTTAACCAGGCAATTGCAGAATCCG
AAGCTAATGGAATGAGTAAGCGAGGAAAGGATGTTACACCATGGCTTTTGGCTCGTGTGGTAGAGTTAACGAAAG
GCGAATCCATGGAGTCTAACATGGCTTTACTGAGAAATACGGCACGTGTTGGTAAGATTGGGAGTCCAACCATGA
CACCAAGGACATCACCTCATGAATTATGGACAGGTGGCCAAATTGCTAATCAATATGCAAAACTGGCTAGTGGTC
GTGTAAGAACTTCTTTTGCTCGTTGAGGTAATGCTGAATCGCTTCACAGAATAATCTTGCCACGTCCGTCACTCC
ATTACCAGCCGAAGAGCCCGCCGCCGGTGTGGGTTCTGCCGGCCCAGGAATCGAGGAAGACGTGGCATTGGTACG
TTACAATATGCCTTGAGCGAGGGCATCGATGATTGACTCGACTGTAAAGCCACCAGCTGATCTCATAATTATTGG
TTCTGCGGCAGTGGACATTACGGCACAGACAATGACTGACTCCGATACTAGGTTGTCGCAGCACTCTACTTCTCC
TGGAAAAGTTTCTTTATCATTAGGAGGTGTGGCGAGGAACGTAGCCGAGGCATCCCATCGTATCTTAGCCGCACA
GGAACATGCGACATCGTCACTGTTGGTGGCACCTGTGGGTGAGGATGTTTTGGGGAAGCTGCTTTTTGAGGAAAC
GCAAAGACTAGGTATGAGAACTGACGGGTTTTTGAAAAGCGACAAGAGGACAGCTGTTTGTAACATGGTTCTTGA
TAATACGGGCAATCTCGTTGGAGGAGTGGCGGATATGGATATCACTCAAGCCATCACCGATGAACAAGTTTGTCT
ATCCACGAGTTTCGACAGAATACTCAAGTGATAAAAATAAATAGATCATCCCTCGGTTGCGAAAGCACATTCCCA
AGCTTGTAGCTATTGATGGGAATTTTTCTCCCGCGACAACAAAGGGAATCGTCAGTTATTGCATCAAAAACGATA
TCAAAGGTGAGCGCTTCCTGTTATTGACGGCTATAGGCTCATAGCCCTGTCAGTGTTCTTGTAGGTGGACCAATT
CACCGAAGCATATGGTGGCAACTGACCATGTATCAGCGAACCCACCTCAGTCATCAAATCCACGTCTATTCTACC
GTTGATACAAGATCTCCTGGTGAATACTGACCTCAAGAAACCTCCCATTGCATTCTTTTCACCAAACCTCCCGGA
GCTCGTCCACGTCTATAACACGATCCAAGCGGAACCCTATAATTTATCCAACAATTCATACTGGTGGACATGTAT
TGACAGCATGGGGCTCGGTTCCGCGTTCCGTATGGATTTGGAGCAACTCGCAAGGAGGAATGCGACGGATTTGGA
TGTTAGCAAAGGCACACTGTCCTTTTTGATTGACCAGGGCATTGCGCAGATGGCCGTCAACCTTCTTCCGATATT
CCAACACCTCATTATTAAATGCGGGGAACGCGGGGCCATCGTTGTTATGCGTATTGACCCCGAAGATGCAGCGAC
GTCACCATGGGGACGGCAAAGGAGTAACCCCCTTGCCCGGTATGTCGTTGTACAAGGGAACAGCAAGGAGATTAT
TGTCTTGCAACACTTCCCGGGTCTAAATGTGGATAACATTACCAACGTGACTGGAGCGGGAGATTCGTTTGTAGG
CGCTGTTCTCGCTTCGATTTCAAACAACCCTCAAGCTTTATTGAATCCGGAGGACCTCGAGCATACAATAAGCAC
AGCTCAACAAGCAGCTCTGTTGACGCTGCAGAGCGATTTGGCGGTTTCGCCGTTGCTCTCTGATTCTTTGAAACT
CCAATCATCAGCCATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail