Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|005660
Gene name
Locationscaffold_01a:1374511..1377029
Strand+
Gene length (bp)2518
Transcript length (bp)2217
Coding sequence length (bp)2217
Protein length (aa) 739

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11957 efThoc1 THO complex subunit 1 transcription elongation factor 7.1E-89 80 529

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8R3N6|THOC1_MOUSE THO complex subunit 1 OS=Mus musculus GN=Thoc1 PE=1 SV=1 77 492 1.0E-42
sp|Q96FV9|THOC1_HUMAN THO complex subunit 1 OS=Homo sapiens GN=THOC1 PE=1 SV=1 77 492 3.0E-42
sp|Q93VM9|THOC1_ARATH THO complex subunit 1 OS=Arabidopsis thaliana GN=THO1 PE=1 SV=1 76 491 4.0E-39
sp|Q9URT2|YJU3_SCHPO Uncharacterized protein P25A2.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCP25A2.03 PE=1 SV=1 83 524 1.0E-27

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|005660
MLPLQPFLDTLLSSLPPLPISQAQYNSLVKNTLDDSRGKSSPDNRKNQWEYLLKNEVFKLAMTEGVAFREDSARY
YEQVKVRLDLVLTFTEQDACEQTFPFIVLQDLLETQTINSCSHIFSWIEARSSRLTEGMVPQKGKALILLRTLND
LLRRLSKSGSTTVFCGRILTFLSGVFPLGERSGVNLRGEYGPTWEDVWYPKHDEDTNTEMTDFRGESSRSDEVPE
DNAMQVDSNKETKATPTGQAKGDNKEDFYNTFWHLQYPFSKPSIFANKEAFPQFQEAIDKVLPVIKEATAKERAM
MGSRVAAGVVLTKRKREPEAEESNVNEYFFAKFLTSPDLLDLEIADTHFRRQFLFQLMILLQHLLTFTKGAKAAW
ATQRNRSLQMDFTLEAEDTQWVQDTLSKSMEELKQTTPNGRAFAETTQTILEREKNWVKWKNELCAPFDKEPWST
RVDDRNVGLFEATKELRERMRTTREDWPFTLGSAPLTDIWQMGYCDLHDLENAFQPGDVKDFVKKIKLEDNRIEL
RRKTLAQKEAPAQAQDAGKEAAGDDAVMSVDAPATPAPTPAPTPATLASAPSSQASSVAMASPLHPSLPPRPNAQ
TQPLSNTPAPAPASSPAPPAPALPSPVKKLEALDSQIAKFDENKQRWAWLALRTARDQHLQHFGKIGTGDVGLLV
QEIEKERQEREKVQKAEETGSTIDEGNPKTPASEPLMRTDSQSSVVTAGVPKSDPDVRAEMQS*
Coding >Agabi119p4|005660
ATGCTCCCTCTTCAACCGTTTCTCGACACCCTTCTCTCATCTCTCCCACCGCTTCCTATATCTCAAGCTCAGTAT
AACTCCCTCGTAAAAAACACCCTTGACGACTCTCGCGGAAAATCCTCTCCTGACAATAGGAAGAATCAATGGGAA
TATCTATTGAAAAATGAAGTGTTCAAGTTAGCGATGACTGAGGGAGTGGCTTTTAGGGAAGACAGTGCCAGGTAT
TATGAACAAGTTAAAGTTCGACTAGACCTCGTCCTGACTTTCACTGAACAAGATGCCTGCGAGCAAACTTTCCCA
TTCATTGTGTTACAAGATCTCCTAGAGACGCAAACCATCAATTCGTGTTCGCATATCTTTTCCTGGATCGAGGCT
CGCTCCTCAAGGCTTACTGAAGGCATGGTGCCTCAGAAGGGAAAGGCTCTCATTCTCCTTCGTACGCTGAATGAT
TTGCTCCGTCGTCTATCAAAATCAGGATCTACCACCGTTTTCTGTGGTCGGATTTTAACATTCCTAAGTGGTGTT
TTCCCTCTGGGTGAGCGCAGCGGCGTCAACCTGCGGGGAGAATATGGTCCAACTTGGGAGGATGTATGGTATCCA
AAACACGATGAGGATACAAATACGGAGATGACGGACTTCCGGGGAGAGTCTTCGCGGTCGGACGAAGTCCCCGAG
GATAATGCAATGCAAGTTGACTCCAACAAAGAAACTAAAGCAACGCCGACGGGTCAGGCCAAAGGAGACAACAAA
GAAGATTTTTACAATACATTTTGGCACCTTCAGTACCCATTTTCGAAACCTTCGATCTTCGCCAACAAAGAGGCT
TTCCCTCAGTTCCAAGAAGCTATCGATAAGGTTTTGCCCGTCATCAAGGAAGCGACAGCAAAAGAAAGGGCTATG
ATGGGAAGTCGAGTTGCGGCTGGTGTCGTTCTGACCAAGAGGAAACGAGAACCTGAGGCCGAGGAGTCGAATGTT
AATGAGTATTTTTTCGCCAAATTTTTGACCTCTCCCGACCTTCTTGATCTCGAGATTGCCGACACGCATTTCCGT
CGTCAATTCCTCTTCCAGTTGATGATCTTACTGCAACATCTTCTCACCTTTACCAAAGGTGCAAAGGCTGCATGG
GCAACACAACGGAATAGGTCATTACAAATGGACTTCACCTTGGAGGCGGAAGATACACAATGGGTTCAGGATACG
CTAAGCAAGTCCATGGAGGAGCTCAAACAAACTACTCCAAATGGCCGCGCATTTGCTGAGACAACTCAAACAATC
TTAGAGCGCGAGAAGAATTGGGTTAAGTGGAAGAACGAGCTTTGTGCTCCTTTTGACAAGGAACCTTGGTCAACT
CGGGTGGACGATAGGAATGTAGGATTATTCGAGGCGACCAAAGAGCTACGCGAGAGAATGAGGACGACTCGTGAA
GACTGGCCATTCACGTTAGGATCAGCTCCGCTGACGGACATATGGCAAATGGGCTATTGTGACCTCCACGACTTG
GAAAATGCTTTCCAGCCTGGTGACGTGAAAGACTTCGTCAAGAAAATTAAACTAGAGGACAATCGTATCGAGCTA
CGCAGGAAGACCCTTGCCCAGAAGGAAGCTCCAGCTCAGGCCCAGGATGCCGGGAAAGAGGCAGCCGGTGATGAT
GCAGTAATGAGCGTCGATGCTCCAGCAACACCCGCACCTACACCCGCACCCACACCTGCAACACTCGCATCCGCC
CCCTCAAGCCAGGCATCTAGTGTTGCGATGGCATCTCCACTTCATCCATCTCTTCCACCGCGGCCCAATGCTCAG
ACGCAACCCTTATCGAACACACCTGCACCAGCGCCAGCATCCAGCCCTGCACCTCCGGCGCCTGCTCTACCATCG
CCCGTAAAGAAACTAGAAGCTTTAGATTCACAGATTGCCAAATTTGACGAAAATAAACAACGATGGGCTTGGCTA
GCCCTCCGGACAGCCCGCGATCAGCATCTGCAGCACTTTGGAAAAATTGGCACGGGTGACGTAGGGCTTCTCGTG
CAGGAAATTGAGAAAGAAAGGCAAGAGAGAGAGAAAGTTCAAAAGGCGGAGGAAACGGGCAGCACGATCGATGAA
GGAAACCCTAAAACTCCGGCGTCTGAGCCGCTCATGCGAACAGACTCTCAGTCATCTGTAGTAACAGCTGGTGTA
CCAAAGTCGGACCCAGATGTAAGGGCGGAGATGCAGTCTTGA
Transcript >Agabi119p4|005660
ATGCTCCCTCTTCAACCGTTTCTCGACACCCTTCTCTCATCTCTCCCACCGCTTCCTATATCTCAAGCTCAGTAT
AACTCCCTCGTAAAAAACACCCTTGACGACTCTCGCGGAAAATCCTCTCCTGACAATAGGAAGAATCAATGGGAA
TATCTATTGAAAAATGAAGTGTTCAAGTTAGCGATGACTGAGGGAGTGGCTTTTAGGGAAGACAGTGCCAGGTAT
TATGAACAAGTTAAAGTTCGACTAGACCTCGTCCTGACTTTCACTGAACAAGATGCCTGCGAGCAAACTTTCCCA
TTCATTGTGTTACAAGATCTCCTAGAGACGCAAACCATCAATTCGTGTTCGCATATCTTTTCCTGGATCGAGGCT
CGCTCCTCAAGGCTTACTGAAGGCATGGTGCCTCAGAAGGGAAAGGCTCTCATTCTCCTTCGTACGCTGAATGAT
TTGCTCCGTCGTCTATCAAAATCAGGATCTACCACCGTTTTCTGTGGTCGGATTTTAACATTCCTAAGTGGTGTT
TTCCCTCTGGGTGAGCGCAGCGGCGTCAACCTGCGGGGAGAATATGGTCCAACTTGGGAGGATGTATGGTATCCA
AAACACGATGAGGATACAAATACGGAGATGACGGACTTCCGGGGAGAGTCTTCGCGGTCGGACGAAGTCCCCGAG
GATAATGCAATGCAAGTTGACTCCAACAAAGAAACTAAAGCAACGCCGACGGGTCAGGCCAAAGGAGACAACAAA
GAAGATTTTTACAATACATTTTGGCACCTTCAGTACCCATTTTCGAAACCTTCGATCTTCGCCAACAAAGAGGCT
TTCCCTCAGTTCCAAGAAGCTATCGATAAGGTTTTGCCCGTCATCAAGGAAGCGACAGCAAAAGAAAGGGCTATG
ATGGGAAGTCGAGTTGCGGCTGGTGTCGTTCTGACCAAGAGGAAACGAGAACCTGAGGCCGAGGAGTCGAATGTT
AATGAGTATTTTTTCGCCAAATTTTTGACCTCTCCCGACCTTCTTGATCTCGAGATTGCCGACACGCATTTCCGT
CGTCAATTCCTCTTCCAGTTGATGATCTTACTGCAACATCTTCTCACCTTTACCAAAGGTGCAAAGGCTGCATGG
GCAACACAACGGAATAGGTCATTACAAATGGACTTCACCTTGGAGGCGGAAGATACACAATGGGTTCAGGATACG
CTAAGCAAGTCCATGGAGGAGCTCAAACAAACTACTCCAAATGGCCGCGCATTTGCTGAGACAACTCAAACAATC
TTAGAGCGCGAGAAGAATTGGGTTAAGTGGAAGAACGAGCTTTGTGCTCCTTTTGACAAGGAACCTTGGTCAACT
CGGGTGGACGATAGGAATGTAGGATTATTCGAGGCGACCAAAGAGCTACGCGAGAGAATGAGGACGACTCGTGAA
GACTGGCCATTCACGTTAGGATCAGCTCCGCTGACGGACATATGGCAAATGGGCTATTGTGACCTCCACGACTTG
GAAAATGCTTTCCAGCCTGGTGACGTGAAAGACTTCGTCAAGAAAATTAAACTAGAGGACAATCGTATCGAGCTA
CGCAGGAAGACCCTTGCCCAGAAGGAAGCTCCAGCTCAGGCCCAGGATGCCGGGAAAGAGGCAGCCGGTGATGAT
GCAGTAATGAGCGTCGATGCTCCAGCAACACCCGCACCTACACCCGCACCCACACCTGCAACACTCGCATCCGCC
CCCTCAAGCCAGGCATCTAGTGTTGCGATGGCATCTCCACTTCATCCATCTCTTCCACCGCGGCCCAATGCTCAG
ACGCAACCCTTATCGAACACACCTGCACCAGCGCCAGCATCCAGCCCTGCACCTCCGGCGCCTGCTCTACCATCG
CCCGTAAAGAAACTAGAAGCTTTAGATTCACAGATTGCCAAATTTGACGAAAATAAACAACGATGGGCTTGGCTA
GCCCTCCGGACAGCCCGCGATCAGCATCTGCAGCACTTTGGAAAAATTGGCACGGGTGACGTAGGGCTTCTCGTG
CAGGAAATTGAGAAAGAAAGGCAAGAGAGAGAGAAAGTTCAAAAGGCGGAGGAAACGGGCAGCACGATCGATGAA
GGAAACCCTAAAACTCCGGCGTCTGAGCCGCTCATGCGAACAGACTCTCAGTCATCTGTAGTAACAGCTGGTGTA
CCAAAGTCGGACCCAGATGTAAGGGCGGAGATGCAGTCTTGA
Gene >Agabi119p4|005660
ATGCTCCCTCTTCAACCGTTTCTCGACACCCTTCTCTCATCTCTCCCACCGCTTCCTATATCTCAAGCTCAGTAT
AACTCCCTCGTAAAAAACACCCTTGACGACTCTCGCGGAAAATCCTCTCCTGACAATAGGAAGAATCAATGGGAA
TATCTATTGAAAAATGAAGTGTTCAAGTTAGCGGTGCGTGATATTCTGACACTGCGAGTTTTTAATCTAACTTCT
CATAAGATGACTGAGGGAGTGGCTTTTAGGGAAGACAGTGCCAGGTATTATGAACAAGTTAAAGTTCGACTAGAC
CTCGTCCTGACTTTCACTGAACAAGGTGAACTGCTTTCGCCACATACCACCGCGGTCCACCTAATCCTGAATACA
GATGCCTGCGAGCAAACTTTCCCATTCATTGTGTTACAAGATCTCCTAGAGACGCAAACCATCAATTCGTGTTCG
CATATCTTTTCCTGGATCGAGGCTCGCTCCTCAAGGCTTACTGAAGGCATGGTGCCTCAGAAGGGAAAGGCTCTC
ATTCTCCTTCGTACGCTGAATGATTTGCTCCGTCGTCTATCAAAATCAGGATCTACCACCGTTTTCTGTGGTCGG
ATTTTAACATTCCTAAGTGGTGTTTTCCCTCTGGGTGAGCGCAGCGGCGTCAACCTGCGGGGAGAATATGGTCCA
ACTTGGGAGGATGTATGGTATCCAAAACACGATGAGGATACAAATACGGAGATGACGGACTTCCGGGGAGAGTCT
TCGCGGTCGGACGAAGTCCCCGAGGATAATGCAATGCAAGTTGACTCCAACAAAGAAACTAAAGCAACGCCGACG
GGTCAGGCCAAAGGAGACAACAAAGAAGGCCCGTTGTCCTCTATTTGATCTTTCGAATAACTAAATCGACTCCCT
CCAGATTTTTACAATACATTTTGGCACCTTCAGTACCCATTTTCGAAACCTTCGATCTTCGCCAACAAAGAGGCT
TTCCCTCAGTTCCAAGAAGCTATCGATAAGGTTTTGCCCGTCATCAAGGAAGCGACAGCAAAAGAAAGGGCTATG
ATGGGAAGTCGAGTTGCGGCTGGTGTCGTTCTGACCAAGAGGAAACGAGAACCTGAGGCCGAGGAGTCGAATGTT
AATGAGTATTTTTTCGCCAAATTTTTGACCTCTCCCGACCTTCTTGATCTCGAGGTACTCGTGCTTTCTTTTCCA
TATTTCCTCTTTGACTCAATAGCATTTCATCAGATTGCCGACACGCATTTCCGTCGTCAATTCCTCTTCCAGTTG
ATGATCTTACTGCAACATCTTCTCACCTTTACCAAAGGTGCAAAGGCTGCATGGGCAACACAACGGAATAGGTCA
TTACAAATGGACTTCACCTTGGAGGCGGAAGATACACAATGGGTTCAGGATACGCTAAGCAAGTCCATGGAGGAG
CTCAAACAAACTACTCCAAATGGCCGCGCATTTGCTGAGACAACTCAAACAATCTTAGAGCGCGAGAAGAATTGG
GTTAAGTGGAAGAACGAGCTTTGTGCTCCTTTTGACAAGGAACCTTGGTCAACTCGGGTGGACGATAGGAATGTA
GGATTATTCGAGGCGACCAAAGAGCTACGCGAGAGAATGAGGACGACTCGTGAAGACTGGCCATTCACGTTAGGA
TCAGCTCCGCTGACGGACATATGGCAAATGGGCTATTGTGACCTCCACGACTTGGAAAATGCTTTCCAGTTGCGT
GTCATATTTTTCAATCTGATATCCTCTTACTCTCTAACTCTAGGCCTGGTGACGTGAAAGACTTCGTCAAGAAAA
TTAAACTAGAGGACAATCGTATCGAGCTACGCAGGAAGACCCTTGCCCAGAAGGAAGCTCCAGCTCAGGCCCAGG
ATGCCGGGAAAGAGGCAGCCGGTGATGATGCAGTAATGAGCGTCGATGCTCCAGCAACACCCGCACCTACACCCG
CACCCACACCTGCAACACTCGCATCCGCCCCCTCAAGCCAGGCATCTAGTGTTGCGATGGCATCTCCACTTCATC
CATCTCTTCCACCGCGGCCCAATGCTCAGACGCAACCCTTATCGAACACACCTGCACCAGCGCCAGCATCCAGCC
CTGCACCTCCGGCGCCTGCTCTACCATCGCCCGTAAAGAAACTAGAAGCTTTAGATTCACAGATTGCCAAATTTG
ACGAAGTGAGTTTTTTTTCCGATGGTTAGGCCTTATCTTGATTACAGTCTAGAATAAACAACGATGGGCTTGGCT
AGCCCTCCGGACAGCCCGCGATCAGCATCTGCAGCACTTTGGAAAAATTGGCACGGGTGACGTAGGGCTTCTCGT
GCAGGAAATTGAGAAAGAAAGGCAAGAGAGAGAGAAAGTTCAAAAGGCGGAGGAAACGGGCAGCACGATCGATGA
AGGAAACCCTAAAACTCCGGCGTCTGAGCCGCTCATGCGAACAGACTCTCAGTCATCTGTAGTAACAGCTGGTGT
ACCAAAGTCGGACCCAGATGTAAGGGCGGAGATGCAGTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail