Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|005450
Gene name
Locationscaffold_01a:1339902..1341170
Strand-
Gene length (bp)1268
Transcript length (bp)1047
Coding sequence length (bp)1047
Protein length (aa) 349

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14521 Aspzincin_M35 Lysine-specific metallo-endopeptidase 2.4E-44 214 342

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P81054|PLMP_GRIFR Peptidyl-Lys metalloendopeptidase OS=Grifola frondosa GN=MEP PE=1 SV=2 8 348 6.0E-106
sp|Q9Y7F7|PLMP_ARMME Peptidyl-Lys metalloendopeptidase OS=Armillaria mellea GN=MEP PE=1 SV=1 4 348 2.0E-88
sp|P81055|PLMP_PLEOS Peptidyl-Lys metalloendopeptidase OS=Pleurotus ostreatus GN=MEP PE=1 SV=1 181 348 2.0E-64
sp|O05485|EPRA1_AERHY Extracellular protease OS=Aeromonas hydrophila GN=eprA1 PE=3 SV=1 2 346 4.0E-41
sp|C5JHY1|NPIIB_AJEDS Neutral protease 2 homolog BDBG_02110 OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_02110 PE=3 SV=1 8 341 3.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P81054|PLMP_GRIFR Peptidyl-Lys metalloendopeptidase OS=Grifola frondosa GN=MEP PE=1 SV=2 8 348 6.0E-106
sp|Q9Y7F7|PLMP_ARMME Peptidyl-Lys metalloendopeptidase OS=Armillaria mellea GN=MEP PE=1 SV=1 4 348 2.0E-88
sp|P81055|PLMP_PLEOS Peptidyl-Lys metalloendopeptidase OS=Pleurotus ostreatus GN=MEP PE=1 SV=1 181 348 2.0E-64
sp|O05485|EPRA1_AERHY Extracellular protease OS=Aeromonas hydrophila GN=eprA1 PE=3 SV=1 2 346 4.0E-41
sp|C5JHY1|NPIIB_AJEDS Neutral protease 2 homolog BDBG_02110 OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_02110 PE=3 SV=1 8 341 3.0E-11
sp|C5FR79|NPIIA_ARTOC Probable neutral protease 2 homolog MCYG_05201 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_05201 PE=3 SV=1 42 345 3.0E-09
sp|Q2KH28|NPIIA_MAGO7 Neutral protease 2 homolog MGG_10927 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGCH7_ch7g157 PE=3 SV=1 8 342 5.0E-09
sp|E4UYQ9|NPIIF_ARTGP Neutral protease 2 homolog MGYG_06241 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_06241 PE=3 SV=1 14 342 4.0E-07
sp|E4UR63|NPIIC_ARTGP Neutral protease 2 homolog MGYG_02351 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_02351 PE=3 SV=1 42 341 4.0E-07
sp|E3QWD3|NPIIA_COLGM Neutral protease 2 homolog MGG_10927 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_10315 PE=3 SV=1 42 343 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004222 metalloendopeptidase activity Yes
GO:0016787 hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0008233 peptidase activity No
GO:0003824 catalytic activity No
GO:0008237 metallopeptidase activity No
GO:0004175 endopeptidase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|005450
MPLAHFYLITLLSSAISAIASPSLTLEVTGPSRIYDVDSLQVTAILTNSGNETVRILKDPRGILSEHPANKFSIF
NTEGSQPSFDGIEVKYVPEVAAKAGYHVALSPGQFVKVTHNLTDVYNFSTSGSGSYKLKARDIFYVVDKNDAVVT
LHATENFHHEIHISGKLESNRPGWPDASRLSTFVNCTSLQQSSVRSAAAAAKTYAANAHSYFGNNNTGTPRYTTW
FGPLVASRRKVVSSHFSAINSNDFGGFTYDCSCTDPEMFAYVYPSNFGYIHLCGAFWNAPTTGTDSTAGTIIHES
SHFLRNGGTGDIVYGQSSAKSLAITDPASAITNADSHEYFAENNPALS*
Coding >Agabi119p4|005450
ATGCCCTTGGCTCACTTCTATCTCATTACGCTACTGTCTTCAGCTATATCTGCTATCGCTTCACCATCTCTCACT
TTAGAAGTAACTGGCCCGTCGCGCATTTACGACGTTGACAGTCTACAAGTCACCGCAATTCTCACTAACTCTGGT
AATGAGACGGTCAGGATTCTAAAAGATCCGCGTGGCATTTTGTCAGAGCATCCTGCGAATAAATTCTCCATTTTC
AATACGGAAGGATCACAGCCTTCTTTTGATGGTATCGAGGTCAAGTACGTTCCCGAAGTTGCTGCCAAGGCCGGG
TACCATGTTGCCCTCTCTCCTGGCCAGTTTGTAAAGGTCACTCATAACTTGACCGATGTTTACAATTTCAGTACC
TCTGGTAGCGGCAGCTACAAATTGAAGGCTCGCGATATTTTCTATGTTGTCGACAAAAACGACGCGGTGGTCACT
CTACATGCTACTGAGAACTTTCACCATGAGATCCATATCTCGGGGAAACTGGAAAGCAATCGGCCCGGCTGGCCT
GATGCATCTAGACTTTCTACCTTTGTGAACTGTACATCTCTTCAACAAAGCTCCGTAAGATCGGCCGCTGCTGCT
GCGAAGACATATGCAGCTAATGCTCATTCTTACTTCGGGAATAACAATACTGGAACCCCTCGCTATACGACTTGG
TTTGGCCCTCTCGTTGCATCTCGTCGCAAAGTTGTCTCGAGTCACTTCAGTGCGATCAACTCCAACGATTTTGGC
GGCTTCACATACGACTGCTCTTGCACTGATCCCGAAATGTTTGCTTATGTTTATCCATCCAATTTTGGTTATATC
CATTTATGTGGCGCTTTCTGGAATGCTCCCACAACAGGTACCGATTCCACGGCTGGGACCATCATACATGAGTCT
TCCCATTTCCTCCGTAATGGTGGCACCGGTGATATCGTGTATGGACAGAGTTCGGCAAAGAGCCTGGCTATTACC
GACCCTGCCAGTGCCATTACGAATGCCGATTCACATGAATACTTCGCCGAAAACAACCCCGCTCTTTCCTAG
Transcript >Agabi119p4|005450
ATGCCCTTGGCTCACTTCTATCTCATTACGCTACTGTCTTCAGCTATATCTGCTATCGCTTCACCATCTCTCACT
TTAGAAGTAACTGGCCCGTCGCGCATTTACGACGTTGACAGTCTACAAGTCACCGCAATTCTCACTAACTCTGGT
AATGAGACGGTCAGGATTCTAAAAGATCCGCGTGGCATTTTGTCAGAGCATCCTGCGAATAAATTCTCCATTTTC
AATACGGAAGGATCACAGCCTTCTTTTGATGGTATCGAGGTCAAGTACGTTCCCGAAGTTGCTGCCAAGGCCGGG
TACCATGTTGCCCTCTCTCCTGGCCAGTTTGTAAAGGTCACTCATAACTTGACCGATGTTTACAATTTCAGTACC
TCTGGTAGCGGCAGCTACAAATTGAAGGCTCGCGATATTTTCTATGTTGTCGACAAAAACGACGCGGTGGTCACT
CTACATGCTACTGAGAACTTTCACCATGAGATCCATATCTCGGGGAAACTGGAAAGCAATCGGCCCGGCTGGCCT
GATGCATCTAGACTTTCTACCTTTGTGAACTGTACATCTCTTCAACAAAGCTCCGTAAGATCGGCCGCTGCTGCT
GCGAAGACATATGCAGCTAATGCTCATTCTTACTTCGGGAATAACAATACTGGAACCCCTCGCTATACGACTTGG
TTTGGCCCTCTCGTTGCATCTCGTCGCAAAGTTGTCTCGAGTCACTTCAGTGCGATCAACTCCAACGATTTTGGC
GGCTTCACATACGACTGCTCTTGCACTGATCCCGAAATGTTTGCTTATGTTTATCCATCCAATTTTGGTTATATC
CATTTATGTGGCGCTTTCTGGAATGCTCCCACAACAGGTACCGATTCCACGGCTGGGACCATCATACATGAGTCT
TCCCATTTCCTCCGTAATGGTGGCACCGGTGATATCGTGTATGGACAGAGTTCGGCAAAGAGCCTGGCTATTACC
GACCCTGCCAGTGCCATTACGAATGCCGATTCACATGAATACTTCGCCGAAAACAACCCCGCTCTTTCCTAG
Gene >Agabi119p4|005450
ATGCCCTTGGCTCACTTCTATCTCATTACGCTACTGTCTTCAGCTATATCTGCTATCGCTTCACCATCTCTCACT
TTAGAAGTAACTGGTGCGCCACCTCTCCTGTTCGGCTGAGAGCGAGTCTGGCGGCTCAGAATGATTTCTTAGGCC
CGTCGCGCATTTACGACGTTGACAGTCTACAAGTCACCGCAATTCTCACTAACTCTGGTAATGAGACGGTCAGGA
TTCTAAAAGATCCGCGTGGCATTTTGTCAGAGCATCCTGCGAATAAATTCTCCATTTTCAATACGGAAGGATCAC
AGCCTTCTTTTGATGGTATCGAGGTCAAGTACGTTCCCGAAGTTGCTGCCAAGGCCGGGTACCATGTTGCCCTCT
CTCCTGGCCAGTTTGTAAAGGTCACTCATAACTGTGAGCAAACCATGCGAACTCTTGGAGTCATTCTAATTGCTG
CAGTGACCGATGTTTACAATTTCAGTACCTCTGGTAGCGGCAGCTACAAATTGAAGGCTCGCGATATTTTCTATG
TTGTCGACAAAAACGACGCGGTGGTCACTCTACATGCTACTGAGAACTTTCACCATGAGATCCATATCTCGGGGA
AACTGGAAAGCAATCGGCCCGGCTGGCCTGATGCATCTAGACTTTCTACCTTTGTGAACTGTACATCTCTTCAAC
AAAGCTCCGTAAGATCGGCCGCTGCTGCTGCGAAGACATATGCAGCTAATGCTCATTCTTACTTCGGGAATAACA
ATACTGGAACCCCTCGCTATACGACTTGGTTTGGCCCTCTCGTTGCATCTCGTCGCAAAGTTGTCTCGAGTCACT
TCAGTGCGATCAACTCCAACGATTTTGGCGGCTTCACATACGACTGCTCTTGCACTGATCCCGAAATGTTTGCTT
ATGTTTATCCATCCAAGTATGTCACTGCAAGCTATCGTATTTTGGACTGCATCACGCTAATTCATCGCTTGTATT
CACCGTAGTTTTGGTTATATCCATTTATGTGGCGCTTTCTGGAATGCTCCCACAACAGGTACCGATTCCACGGTT
GGTATTCTATTTCATGATATTCCATCCGAAATTGACAGTGGTTACAGGCTGGGACCATCATACATGAGTCTTCCC
ATTTCCTCCGTAATGGTGGCACCGGTGATATCGTGTATGGACAGAGTTCGGCAAAGAGCCTGGCTATTACCGACC
CTGCCAGTGCCATTACGAATGCCGATTCACATGAATACTTCGCCGAAAACAACCCCGCTCTTTCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail