Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|005180
Gene name
Locationscaffold_01a:1282334..1284211
Strand+
Gene length (bp)1877
Transcript length (bp)1509
Coding sequence length (bp)1509
Protein length (aa) 503

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00443 UCH Ubiquitin carboxyl-terminal hydrolase 9.5E-26 177 486
PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein 2.2E-10 72 133

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USR2|UBP10_SCHPO Probable mRNA-splicing protein ubp10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp10 PE=3 SV=1 45 500 7.0E-148
sp|Q3TIX9|SNUT2_MOUSE U4/U6.U5 tri-snRNP-associated protein 2 OS=Mus musculus GN=Usp39 PE=1 SV=2 28 502 4.0E-131
sp|Q53GS9|SNUT2_HUMAN U4/U6.U5 tri-snRNP-associated protein 2 OS=Homo sapiens GN=USP39 PE=1 SV=2 6 502 7.0E-131
sp|Q5R761|SNUT2_PONAB U4/U6.U5 tri-snRNP-associated protein 2 OS=Pongo abelii GN=USP39 PE=2 SV=1 6 502 2.0E-129
sp|P43589|SAD1_YEAST Pre-mRNA-splicing factor SAD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAD1 PE=1 SV=1 35 501 1.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USR2|UBP10_SCHPO Probable mRNA-splicing protein ubp10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp10 PE=3 SV=1 45 500 7.0E-148
sp|Q3TIX9|SNUT2_MOUSE U4/U6.U5 tri-snRNP-associated protein 2 OS=Mus musculus GN=Usp39 PE=1 SV=2 28 502 4.0E-131
sp|Q53GS9|SNUT2_HUMAN U4/U6.U5 tri-snRNP-associated protein 2 OS=Homo sapiens GN=USP39 PE=1 SV=2 6 502 7.0E-131
sp|Q5R761|SNUT2_PONAB U4/U6.U5 tri-snRNP-associated protein 2 OS=Pongo abelii GN=USP39 PE=2 SV=1 6 502 2.0E-129
sp|P43589|SAD1_YEAST Pre-mRNA-splicing factor SAD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAD1 PE=1 SV=1 35 501 1.0E-64
sp|Q91W36|UBP3_MOUSE Ubiquitin carboxyl-terminal hydrolase 3 OS=Mus musculus GN=Usp3 PE=2 SV=1 71 488 5.0E-15
sp|Q6P8X6|UBP50_MOUSE Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Mus musculus GN=Usp50 PE=2 SV=1 169 441 3.0E-14
sp|Q9Y6I4|UBP3_HUMAN Ubiquitin carboxyl-terminal hydrolase 3 OS=Homo sapiens GN=USP3 PE=1 SV=2 71 488 4.0E-14
sp|Q5U349|UBP2_RAT Ubiquitin carboxyl-terminal hydrolase 2 OS=Rattus norvegicus GN=Usp2 PE=1 SV=1 140 499 3.0E-11
sp|O88623|UBP2_MOUSE Ubiquitin carboxyl-terminal hydrolase 2 OS=Mus musculus GN=Usp2 PE=1 SV=2 174 499 9.0E-11
sp|Q9R085|UBP15_RAT Ubiquitin carboxyl-terminal hydrolase 15 OS=Rattus norvegicus GN=Usp15 PE=1 SV=1 135 356 7.0E-10
sp|Q9Y4E8|UBP15_HUMAN Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens GN=USP15 PE=1 SV=3 151 356 1.0E-09
sp|F6Z5C0|UBP15_XENTR Ubiquitin carboxyl-terminal hydrolase 15 OS=Xenopus tropicalis GN=usp15 PE=2 SV=2 174 356 1.0E-09
sp|A6QR55|UBP4_BOVIN Ubiquitin carboxyl-terminal hydrolase 4 OS=Bos taurus GN=USP4 PE=2 SV=1 163 338 1.0E-09
sp|Q8R5H1|UBP15_MOUSE Ubiquitin carboxyl-terminal hydrolase 15 OS=Mus musculus GN=Usp15 PE=1 SV=1 151 356 1.0E-09
sp|Q99K46|UBP11_MOUSE Ubiquitin carboxyl-terminal hydrolase 11 OS=Mus musculus GN=Usp11 PE=1 SV=4 165 338 1.0E-09
sp|Q5RCD3|UBP4_PONAB Ubiquitin carboxyl-terminal hydrolase 4 OS=Pongo abelii GN=USP4 PE=2 SV=1 163 338 3.0E-09
sp|Q13107|UBP4_HUMAN Ubiquitin carboxyl-terminal hydrolase 4 OS=Homo sapiens GN=USP4 PE=1 SV=3 163 338 3.0E-09
sp|Q2HJE4|UBP15_BOVIN Ubiquitin carboxyl-terminal hydrolase 15 OS=Bos taurus GN=USP15 PE=2 SV=1 135 356 3.0E-09
sp|Q9MAQ3|UBP11_ARATH Putative ubiquitin carboxyl-terminal hydrolase 11 OS=Arabidopsis thaliana GN=UBP11 PE=3 SV=2 174 338 4.0E-09
sp|P51784|UBP11_HUMAN Ubiquitin carboxyl-terminal hydrolase 11 OS=Homo sapiens GN=USP11 PE=1 SV=3 165 338 5.0E-09
sp|Q9ZSB5|UBP10_ARATH Ubiquitin carboxyl-terminal hydrolase 10 OS=Arabidopsis thaliana GN=UBP10 PE=2 SV=2 174 338 1.0E-08
sp|P35123|UBP4_MOUSE Ubiquitin carboxyl-terminal hydrolase 4 OS=Mus musculus GN=Usp4 PE=1 SV=3 128 338 1.0E-08
sp|Q93Y01|UBP9_ARATH Ubiquitin carboxyl-terminal hydrolase 9 OS=Arabidopsis thaliana GN=UBP9 PE=2 SV=1 174 338 1.0E-08
sp|Q8BUM9|UBP43_MOUSE Ubiquitin carboxyl-terminal hydrolase 43 OS=Mus musculus GN=Usp43 PE=1 SV=2 138 280 2.0E-08
sp|Q70EL4|UBP43_HUMAN Ubiquitin carboxyl-terminal hydrolase 43 OS=Homo sapiens GN=USP43 PE=1 SV=2 174 282 2.0E-08
sp|B2GUZ1|UBP4_RAT Ubiquitin carboxyl-terminal hydrolase 4 OS=Rattus norvegicus GN=Usp4 PE=1 SV=1 141 338 2.0E-08
sp|A5PMR2|UBP33_DANRE Ubiquitin carboxyl-terminal hydrolase 33 OS=Danio rerio GN=usp33 PE=2 SV=1 80 277 4.0E-08
sp|B2GUX4|UBP21_RAT Ubiquitin carboxyl-terminal hydrolase 21 OS=Rattus norvegicus GN=Usp21 PE=2 SV=1 173 290 2.0E-07
sp|A6QR55|UBP4_BOVIN Ubiquitin carboxyl-terminal hydrolase 4 OS=Bos taurus GN=USP4 PE=2 SV=1 355 502 2.0E-07
sp|Q9R085|UBP15_RAT Ubiquitin carboxyl-terminal hydrolase 15 OS=Rattus norvegicus GN=Usp15 PE=1 SV=1 367 502 3.0E-07
sp|A7Z056|UBP20_BOVIN Ubiquitin carboxyl-terminal hydrolase 20 OS=Bos taurus GN=USP20 PE=2 SV=1 73 277 3.0E-07
sp|Q9QZL6|UBP21_MOUSE Ubiquitin carboxyl-terminal hydrolase 21 OS=Mus musculus GN=Usp21 PE=1 SV=1 173 290 3.0E-07
sp|Q2HJE4|UBP15_BOVIN Ubiquitin carboxyl-terminal hydrolase 15 OS=Bos taurus GN=USP15 PE=2 SV=1 367 502 4.0E-07
sp|Q2KJ72|UBP21_BOVIN Ubiquitin carboxyl-terminal hydrolase 21 OS=Bos taurus GN=USP21 PE=2 SV=1 173 291 4.0E-07
sp|F6Z5C0|UBP15_XENTR Ubiquitin carboxyl-terminal hydrolase 15 OS=Xenopus tropicalis GN=usp15 PE=2 SV=2 365 502 4.0E-07
sp|Q9Y4E8|UBP15_HUMAN Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens GN=USP15 PE=1 SV=3 367 502 4.0E-07
sp|Q8R5H1|UBP15_MOUSE Ubiquitin carboxyl-terminal hydrolase 15 OS=Mus musculus GN=Usp15 PE=1 SV=1 367 502 4.0E-07
sp|Q9UK80|UBP21_HUMAN Ubiquitin carboxyl-terminal hydrolase 21 OS=Homo sapiens GN=USP21 PE=1 SV=1 173 288 5.0E-07
sp|Q8R5K2|UBP33_MOUSE Ubiquitin carboxyl-terminal hydrolase 33 OS=Mus musculus GN=Usp33 PE=1 SV=2 80 320 8.0E-07
sp|Q13107|UBP4_HUMAN Ubiquitin carboxyl-terminal hydrolase 4 OS=Homo sapiens GN=USP4 PE=1 SV=3 355 502 1.0E-06
sp|A6QNM7|UBP33_BOVIN Ubiquitin carboxyl-terminal hydrolase 33 OS=Bos taurus GN=USP33 PE=2 SV=1 80 277 2.0E-06
sp|Q5RCD3|UBP4_PONAB Ubiquitin carboxyl-terminal hydrolase 4 OS=Pongo abelii GN=USP4 PE=2 SV=1 384 502 3.0E-06
sp|O60079|UBP12_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp12 PE=1 SV=1 174 353 3.0E-06
sp|Q5RBQ4|UBP46_PONAB Ubiquitin carboxyl-terminal hydrolase 46 OS=Pongo abelii GN=USP46 PE=2 SV=1 175 493 3.0E-06
sp|P62069|UBP46_MOUSE Ubiquitin carboxyl-terminal hydrolase 46 OS=Mus musculus GN=Usp46 PE=1 SV=1 175 493 3.0E-06
sp|P62068|UBP46_HUMAN Ubiquitin carboxyl-terminal hydrolase 46 OS=Homo sapiens GN=USP46 PE=1 SV=1 175 493 3.0E-06
sp|Q5REG5|UBP33_PONAB Ubiquitin carboxyl-terminal hydrolase 33 OS=Pongo abelii GN=USP33 PE=2 SV=1 80 277 4.0E-06
sp|P35123|UBP4_MOUSE Ubiquitin carboxyl-terminal hydrolase 4 OS=Mus musculus GN=Usp4 PE=1 SV=3 368 502 5.0E-06
sp|P39538|UBP12_YEAST Ubiquitin carboxyl-terminal hydrolase 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP12 PE=1 SV=1 173 278 5.0E-06
sp|O75604|UBP2_HUMAN Ubiquitin carboxyl-terminal hydrolase 2 OS=Homo sapiens GN=USP2 PE=1 SV=2 174 277 6.0E-06
sp|Q2KHV7|UBP2_BOVIN Ubiquitin carboxyl-terminal hydrolase 2 OS=Bos taurus GN=USP2 PE=2 SV=1 174 277 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016579 protein deubiquitination Yes
GO:0004843 cysteine-type deubiquitinase activity Yes
GO:0008270 zinc ion binding Yes
GO:0140096 catalytic activity, acting on a protein No
GO:1901564 organonitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0070646 protein modification by small protein removal No
GO:0006807 nitrogen compound metabolic process No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:0101005 deubiquitinase activity No
GO:0044238 primary metabolic process No
GO:0046872 metal ion binding No
GO:0019538 protein metabolic process No
GO:0070647 protein modification by small protein conjugation or removal No
GO:0008233 peptidase activity No
GO:0043169 cation binding No
GO:0008234 cysteine-type peptidase activity No
GO:0043412 macromolecule modification No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0006508 proteolysis No
GO:0043167 ion binding No
GO:0043170 macromolecule metabolic process No
GO:0036211 protein modification process No
GO:0046914 transition metal ion binding No
GO:0008150 biological_process No
GO:0019783 ubiquitin-like protein peptidase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|005180
MTEQTRKLDSTHSNDDPLHSERPLKKPRIREDDEQDDDDEEPVRQTQGIKASDLYLDTINRAVLDFDFEKVCSVS
LSNINIYGCLVCGKYFQGRGKKSYAYAHSIHEDHHVFINLHTTKVYVLPDGYPVADPSLEDIAFVLAPNFTPNSI
SNLSSPMHLEKLSYDLQHQPYLSGYIGLNNIKRNDHMNVVIHALLHVPPLRDYLLLSDFRNKETELIKRFAALAK
KIWNPRLFKSQVSPHEFLQEVNRASGGKFRLEQQGDPVEFLGWLLNRLHKDLGGSKKRNSSIIFSTFQGELRVET
QQVLVRPDSGENEKPRFDIDRDIKSTSSPFLFLAVDLPPPPLFQDSHEKNIIPQVGIHSVLSKYDGKTTQESTGQ
LRRYKCHKLPPYIILHFKRFTKNIFVEEKNPTIVNFPLRGLDFGEYVDIPPDGGSTLYDLIANVTHESVAGTTRD
KENTIWKVHLRAARGGGDNEKWFLIQDLIVEETRKEMIFLGETVLQIWERRN*
Coding >Agabi119p4|005180
ATGACAGAACAAACGCGAAAACTCGACTCTACTCATTCAAATGATGACCCACTCCATTCAGAGCGTCCGCTGAAG
AAGCCCAGAATTCGTGAAGATGATGAGCAAGATGACGACGATGAAGAACCCGTCAGGCAAACCCAAGGAATCAAA
GCCTCTGACTTATACCTCGACACGATTAACAGAGCTGTTCTTGATTTTGACTTCGAGAAAGTCTGCTCCGTTTCT
CTTTCAAACATTAATATCTACGGCTGCCTCGTTTGTGGAAAATACTTTCAAGGAAGAGGCAAAAAATCCTACGCT
TACGCACACTCAATACATGAGGACCATCATGTCTTTATTAACCTACATACCACAAAAGTTTATGTCCTTCCAGAC
GGCTATCCTGTCGCAGACCCATCTTTAGAAGATATAGCTTTTGTGCTTGCTCCCAACTTCACCCCAAACTCGATA
TCCAATCTATCATCCCCCATGCATCTAGAGAAACTTTCTTACGATCTTCAACATCAGCCCTACCTCTCCGGGTAT
ATTGGCCTCAATAACATTAAGAGAAATGACCATATGAATGTGGTCATCCATGCCCTTCTGCATGTGCCTCCGTTG
CGTGACTATCTCCTACTCTCAGACTTCCGGAACAAAGAGACGGAACTTATTAAGCGTTTTGCCGCATTGGCTAAG
AAGATTTGGAATCCTCGTCTGTTCAAAAGCCAAGTCAGTCCGCACGAGTTTCTGCAAGAAGTCAACCGTGCCAGT
GGTGGTAAATTCCGATTAGAGCAACAAGGAGACCCCGTCGAGTTCCTTGGTTGGCTGCTAAACCGACTTCACAAA
GATCTTGGAGGTTCCAAGAAGCGCAATTCGAGCATCATTTTCTCTACTTTCCAGGGTGAACTAAGGGTCGAGACA
CAACAAGTCCTTGTCCGTCCCGACTCGGGAGAAAACGAAAAACCACGCTTTGACATAGATCGAGACATCAAATCA
ACTTCATCGCCATTTTTGTTTCTTGCAGTCGATCTACCTCCCCCTCCTTTGTTTCAAGACAGCCACGAGAAAAAT
ATCATCCCCCAGGTCGGGATACATTCCGTTTTGTCAAAATATGATGGAAAAACCACTCAGGAATCAACTGGCCAA
CTCAGGCGCTATAAATGCCACAAACTACCGCCGTATATCATCCTGCACTTCAAGCGTTTTACCAAAAATATATTC
GTTGAAGAAAAGAATCCCACCATTGTCAATTTCCCCTTACGAGGTCTAGATTTCGGAGAGTATGTGGATATTCCT
CCGGATGGTGGCTCTACACTTTACGATCTGATCGCGAATGTGACTCATGAATCAGTCGCTGGCACCACAAGAGAT
AAAGAGAACACGATTTGGAAGGTTCACTTAAGAGCGGCCCGTGGTGGCGGCGACAACGAAAAATGGTTTCTGATA
CAGGACTTGATTGTGGAGGAGACGCGGAAGGAGATGATTTTCCTTGGTGAAACGGTCCTCCAGATTTGGGAGCGC
CGAAATTAG
Transcript >Agabi119p4|005180
ATGACAGAACAAACGCGAAAACTCGACTCTACTCATTCAAATGATGACCCACTCCATTCAGAGCGTCCGCTGAAG
AAGCCCAGAATTCGTGAAGATGATGAGCAAGATGACGACGATGAAGAACCCGTCAGGCAAACCCAAGGAATCAAA
GCCTCTGACTTATACCTCGACACGATTAACAGAGCTGTTCTTGATTTTGACTTCGAGAAAGTCTGCTCCGTTTCT
CTTTCAAACATTAATATCTACGGCTGCCTCGTTTGTGGAAAATACTTTCAAGGAAGAGGCAAAAAATCCTACGCT
TACGCACACTCAATACATGAGGACCATCATGTCTTTATTAACCTACATACCACAAAAGTTTATGTCCTTCCAGAC
GGCTATCCTGTCGCAGACCCATCTTTAGAAGATATAGCTTTTGTGCTTGCTCCCAACTTCACCCCAAACTCGATA
TCCAATCTATCATCCCCCATGCATCTAGAGAAACTTTCTTACGATCTTCAACATCAGCCCTACCTCTCCGGGTAT
ATTGGCCTCAATAACATTAAGAGAAATGACCATATGAATGTGGTCATCCATGCCCTTCTGCATGTGCCTCCGTTG
CGTGACTATCTCCTACTCTCAGACTTCCGGAACAAAGAGACGGAACTTATTAAGCGTTTTGCCGCATTGGCTAAG
AAGATTTGGAATCCTCGTCTGTTCAAAAGCCAAGTCAGTCCGCACGAGTTTCTGCAAGAAGTCAACCGTGCCAGT
GGTGGTAAATTCCGATTAGAGCAACAAGGAGACCCCGTCGAGTTCCTTGGTTGGCTGCTAAACCGACTTCACAAA
GATCTTGGAGGTTCCAAGAAGCGCAATTCGAGCATCATTTTCTCTACTTTCCAGGGTGAACTAAGGGTCGAGACA
CAACAAGTCCTTGTCCGTCCCGACTCGGGAGAAAACGAAAAACCACGCTTTGACATAGATCGAGACATCAAATCA
ACTTCATCGCCATTTTTGTTTCTTGCAGTCGATCTACCTCCCCCTCCTTTGTTTCAAGACAGCCACGAGAAAAAT
ATCATCCCCCAGGTCGGGATACATTCCGTTTTGTCAAAATATGATGGAAAAACCACTCAGGAATCAACTGGCCAA
CTCAGGCGCTATAAATGCCACAAACTACCGCCGTATATCATCCTGCACTTCAAGCGTTTTACCAAAAATATATTC
GTTGAAGAAAAGAATCCCACCATTGTCAATTTCCCCTTACGAGGTCTAGATTTCGGAGAGTATGTGGATATTCCT
CCGGATGGTGGCTCTACACTTTACGATCTGATCGCGAATGTGACTCATGAATCAGTCGCTGGCACCACAAGAGAT
AAAGAGAACACGATTTGGAAGGTTCACTTAAGAGCGGCCCGTGGTGGCGGCGACAACGAAAAATGGTTTCTGATA
CAGGACTTGATTGTGGAGGAGACGCGGAAGGAGATGATTTTCCTTGGTGAAACGGTCCTCCAGATTTGGGAGCGC
CGAAATTAG
Gene >Agabi119p4|005180
ATGACAGAACAAACGCGAAAACTCGACTCTACTCATTCAAATGATGACCCACTCCATTCAGAGCGTCCGCTGAAG
AAGCCCAGAATTCGTGAAGATGATGAGCAAGATGACGACGATGAAGAACCCGTCAGGCAAACCCAAGGAATCAAA
GCCTCTGACTTATACCTCGACACGGTAAGCATAATCATTCCTAGAAGCAGCAGCTAGCATGGTTACGTGGCTCTA
GATTAACAGAGCTGTTCTTGATTTTGACTTCGAGAAAGTCTGCTCCGTTTCTCTTTCAAACATTAATATCTACGG
CTGCCTCGTTTGTGGAAAATACTTTCAAGGAAGAGGCAAAAAATCCTACGCTTACGCACACTCAATACATGAGGA
CCATCATGTCTTTATTAACCTACATACCACAAAAGTCGATCCGTTGCTCTCTGTATATGCTGCTACTTACATCAT
TTTCAGGTTTATGTCCTTCCAGACGGCTATCCTGTCGCAGACCCATCTTTAGAAGATATAGCTTTTGTGCTTGCT
CCCAACTTCACCCCAAACTCGATATCCAATCTATCATCCCCCATGCATCTAGAGAAACTTTCTTACGATCTTCAA
CATCAGCCCTACCTCTCCGGGTATATTGGCCTCAATAACATTAAGAGAAATGACCATATGAATGTGGTCATCCAT
GCCCTTCTGCATGTGCCTCCGTTGCGTGACTATCTCCTACTCTCAGACTTCCGGAACAAAGAGACGGAACTTATT
AAGCGTTTTGCCGCATTGGCTAAGAAGATTTGGAATCCTCGTCTGTTCAAAAGCCAAGTCAGTCCGCACGAGTTT
CTGCAAGAAGTCAACCGTGCCAGTGGTGGTAAATTCCGATTAGAGCAACAAGGAGACCCCGTCGAGTTCCTTGGT
TGGCTGCTAAACCGACTTCACAAAGATCTTGGAGGTTCCAAGAAGCGCAATTCGAGTGAGAAACCAAGCTCAGCT
TCGTATCTGTACCCATTTGCATGGTTGCTGAGTATCATATGACAGGCATCATTTTCTCTACTTTCCAGGGTGAAC
TAAGGGTCGAGACACAACAAGTCCTTGTCCGTCCCGACTCGGGAGAAAACGAAAAACCACGCTTTGACATAGATC
GAGGTGCGTACCTGAGGACGAAATAGGGTAAATTGCTCCAACAACCTTTAACAGACATCAAATCAACTTCATCGC
CATTTTTGTTTCTTGCAGTCGATCTACCTCCCCCTCCTTTGTTTCAAGACAGCCACGAGAAAAATATCATCCCCC
AGGTCGGGATACATTCCGTTTTGTCAAAATATGATGGAAAAACCACTCAGGTAACTCCTCTGTATAGCAGTTTAT
GACTTCTACCGACTAGTTCTTTAGGAATCAACTGGCCAACTCAGGCGCTATAAATGCCACAAACTACCGCCGTAT
ATCATCCTGCACTTCAAGCGTTTTACCAAAAATATATTCGTTGAAGAAAAGAATCCCACCATTGTCAATTTCCCC
TTACGAGGTCTAGATTTCGGAGAGTGTACGCTCATATATTATCTCCGATAGACTTTCTCGAATTCTGATGAGACT
TTCAGATGTGGATATTCCTCCGGATGGTGGCTCTACACTTTACGATCTGATCGCGAATGTGACTCATGAATCAGT
CGCTGGCACCACAAGAGATAAAGAGAACACGATTTGGAAGGTTCACTTAAGAGCGGCCCGTGGTGGCGGCGACAA
CGAAAAATGGTTTCTGATACAGGACTTGATTGTGGAGGAGACGCGGAAGGAGATGATTTTCCTTGGTGAAACGGT
CCTCCAGGTGAAGTTGCCAGGGAACCGATCCGATTGGAGGCTGATTCGATTGACAGATTTGGGAGCGCCGAAATT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail