Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|005160
Gene name
Locationscaffold_01a:1278846..1279980
Strand+
Gene length (bp)1134
Transcript length (bp)870
Coding sequence length (bp)870
Protein length (aa) 290

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family 1.0E-21 101 282

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8DSY0|RL1_STRMU 50S ribosomal protein L1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rplA PE=3 SV=1 65 287 3.0E-29
sp|A6LKQ6|RL1_THEM4 50S ribosomal protein L1 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rplA PE=3 SV=1 72 287 3.0E-28
sp|B0VLZ9|RL1_ACIBS 50S ribosomal protein L1 OS=Acinetobacter baumannii (strain SDF) GN=rplA PE=3 SV=1 54 287 3.0E-27
sp|B0VDG5|RL1_ACIBY 50S ribosomal protein L1 OS=Acinetobacter baumannii (strain AYE) GN=rplA PE=3 SV=1 54 287 3.0E-27
sp|A3M1G0|RL1_ACIBT 50S ribosomal protein L1 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rplA PE=3 SV=3 54 287 3.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8DSY0|RL1_STRMU 50S ribosomal protein L1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rplA PE=3 SV=1 65 287 3.0E-29
sp|A6LKQ6|RL1_THEM4 50S ribosomal protein L1 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rplA PE=3 SV=1 72 287 3.0E-28
sp|B0VLZ9|RL1_ACIBS 50S ribosomal protein L1 OS=Acinetobacter baumannii (strain SDF) GN=rplA PE=3 SV=1 54 287 3.0E-27
sp|B0VDG5|RL1_ACIBY 50S ribosomal protein L1 OS=Acinetobacter baumannii (strain AYE) GN=rplA PE=3 SV=1 54 287 3.0E-27
sp|A3M1G0|RL1_ACIBT 50S ribosomal protein L1 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rplA PE=3 SV=3 54 287 3.0E-27
sp|B7H1K1|RL1_ACIB3 50S ribosomal protein L1 OS=Acinetobacter baumannii (strain AB307-0294) GN=rplA PE=3 SV=1 54 287 3.0E-27
sp|B7I357|RL1_ACIB5 50S ribosomal protein L1 OS=Acinetobacter baumannii (strain AB0057) GN=rplA PE=3 SV=1 54 287 1.0E-26
sp|C1CD03|RL1_STRZJ 50S ribosomal protein L1 OS=Streptococcus pneumoniae (strain JJA) GN=rplA PE=3 SV=1 65 287 2.0E-26
sp|B8D0B3|RL1_HALOH 50S ribosomal protein L1 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=rplA PE=3 SV=1 73 287 2.0E-26
sp|A7HLB6|RL1_FERNB 50S ribosomal protein L1 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=rplA PE=3 SV=1 71 287 3.0E-26
sp|B1I1L3|RL1_DESAP 50S ribosomal protein L1 OS=Desulforudis audaxviator (strain MP104C) GN=rplA PE=3 SV=1 124 287 1.0E-25
sp|B8DVU7|RL1_BIFA0 50S ribosomal protein L1 OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=rplA PE=3 SV=1 71 287 3.0E-25
sp|Q02WD3|RL1_LACLS 50S ribosomal protein L1 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rplA PE=3 SV=1 68 286 4.0E-25
sp|A2RNF3|RL1_LACLM 50S ribosomal protein L1 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rplA PE=3 SV=1 68 286 4.0E-25
sp|Q74L13|RL1_LACJO 50S ribosomal protein L1 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rplA PE=3 SV=1 68 287 5.0E-25
sp|P51338|RK1_PORPU 50S ribosomal protein L1, chloroplastic OS=Porphyra purpurea GN=rpl1 PE=3 SV=1 53 286 7.0E-25
sp|P29393|RL1_THEMA 50S ribosomal protein L1 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rplA PE=3 SV=1 72 287 1.0E-24
sp|B9DKX1|RL1_STACT 50S ribosomal protein L1 OS=Staphylococcus carnosus (strain TM300) GN=rplA PE=3 SV=1 51 287 1.0E-24
sp|Q47LI2|RL1_THEFY 50S ribosomal protein L1 OS=Thermobifida fusca (strain YX) GN=rplA PE=3 SV=1 67 287 1.0E-24
sp|Q9CE47|RL1_LACLA 50S ribosomal protein L1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rplA PE=3 SV=1 54 286 2.0E-24
sp|B1L938|RL1_THESQ 50S ribosomal protein L1 OS=Thermotoga sp. (strain RQ2) GN=rplA PE=3 SV=1 72 287 2.0E-24
sp|C0ZIG6|RL1_BREBN 50S ribosomal protein L1 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rplA PE=3 SV=1 122 287 2.0E-24
sp|Q1IHH1|RL1_KORVE 50S ribosomal protein L1 OS=Koribacter versatilis (strain Ellin345) GN=rplA PE=3 SV=1 56 287 2.0E-24
sp|B9KBJ8|RL1_THENN 50S ribosomal protein L1 OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=rplA PE=3 SV=1 72 287 3.0E-24
sp|C5CGE2|RL1_KOSOT 50S ribosomal protein L1 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=rplA PE=3 SV=1 71 287 3.0E-24
sp|Q045W0|RL1_LACGA 50S ribosomal protein L1 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rplA PE=3 SV=1 67 287 3.0E-24
sp|P27150|RL1_THETH 50S ribosomal protein L1 OS=Thermus thermophilus GN=rplA PE=1 SV=3 107 287 6.0E-24
sp|Q72GV9|RL1_THET2 50S ribosomal protein L1 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rplA PE=1 SV=3 107 287 6.0E-24
sp|B9E8Q9|RL1_MACCJ 50S ribosomal protein L1 OS=Macrococcus caseolyticus (strain JCSC5402) GN=rplA PE=3 SV=1 67 287 6.0E-24
sp|Q5SLP7|RL1_THET8 50S ribosomal protein L1 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rplA PE=1 SV=3 107 287 6.0E-24
sp|A9H3T0|RL1_GLUDA 50S ribosomal protein L1 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rplA PE=3 SV=1 72 287 7.0E-24
sp|C1F3Y0|RL1_ACIC5 50S ribosomal protein L1 OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=rplA PE=3 SV=1 71 284 1.0E-23
sp|B9JVM5|RL1_AGRVS 50S ribosomal protein L1 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rplA PE=3 SV=1 70 287 1.0E-23
sp|A4WVL9|RL1_RHOS5 50S ribosomal protein L1 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rplA PE=3 SV=1 107 287 1.0E-23
sp|B3CV58|RL1_ORITI 50S ribosomal protein L1 OS=Orientia tsutsugamushi (strain Ikeda) GN=rplA PE=3 SV=1 123 289 1.0E-23
sp|Q2W2H8|RL1_MAGSA 50S ribosomal protein L1 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rplA PE=3 SV=1 71 287 1.0E-23
sp|B2IK52|RL1_BEII9 50S ribosomal protein L1 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rplA PE=3 SV=1 107 287 2.0E-23
sp|Q17VN3|RL1_HELAH 50S ribosomal protein L1 OS=Helicobacter acinonychis (strain Sheeba) GN=rplA PE=3 SV=1 123 252 2.0E-23
sp|A5IJW6|RL1_THEP1 50S ribosomal protein L1 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rplA PE=3 SV=1 72 287 2.0E-23
sp|Q5LMQ0|RL1_RUEPO 50S ribosomal protein L1 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rplA PE=3 SV=1 68 287 2.0E-23
sp|A1QZI0|RL1_BORT9 50S ribosomal protein L1 OS=Borrelia turicatae (strain 91E135) GN=rplA PE=3 SV=1 51 289 2.0E-23
sp|Q1XDE9|RK1_PYRYE 50S ribosomal protein L1, chloroplastic OS=Pyropia yezoensis GN=rpl1 PE=3 SV=1 71 286 3.0E-23
sp|B2UUW3|RL1_HELPS 50S ribosomal protein L1 OS=Helicobacter pylori (strain Shi470) GN=rplA PE=3 SV=1 74 248 3.0E-23
sp|P56029|RL1_HELPY 50S ribosomal protein L1 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rplA PE=1 SV=1 74 248 4.0E-23
sp|Q1CS65|RL1_HELPH 50S ribosomal protein L1 OS=Helicobacter pylori (strain HPAG1) GN=rplA PE=3 SV=1 74 248 4.0E-23
sp|B6JN40|RL1_HELP2 50S ribosomal protein L1 OS=Helicobacter pylori (strain P12) GN=rplA PE=3 SV=1 74 248 4.0E-23
sp|Q8KG18|RL1_CHLTE 50S ribosomal protein L1 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=rplA PE=3 SV=1 60 286 4.0E-23
sp|C5C0K8|RL1_BEUC1 50S ribosomal protein L1 OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=rplA PE=3 SV=1 107 284 5.0E-23
sp|B5Z8J8|RL1_HELPG 50S ribosomal protein L1 OS=Helicobacter pylori (strain G27) GN=rplA PE=3 SV=1 74 248 5.0E-23
sp|B5RRK0|RL1_BORRA 50S ribosomal protein L1 OS=Borrelia recurrentis (strain A1) GN=rplA PE=3 SV=1 51 289 6.0E-23
sp|A1B012|RL1_PARDP 50S ribosomal protein L1 OS=Paracoccus denitrificans (strain Pd 1222) GN=rplA PE=3 SV=1 51 287 7.0E-23
sp|Q6A6K3|RL1_PROAC 50S ribosomal protein L1 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=rplA PE=3 SV=1 54 287 7.0E-23
sp|B8FEU4|RL1_DESAA 50S ribosomal protein L1 OS=Desulfatibacillum alkenivorans (strain AK-01) GN=rplA PE=3 SV=1 123 287 7.0E-23
sp|A5CC96|RL1_ORITB 50S ribosomal protein L1 OS=Orientia tsutsugamushi (strain Boryong) GN=rplA PE=3 SV=1 123 289 8.0E-23
sp|B5RLV2|RL1_BORDL 50S ribosomal protein L1 OS=Borrelia duttonii (strain Ly) GN=rplA PE=3 SV=1 51 289 9.0E-23
sp|Q9ZK21|RL1_HELPJ 50S ribosomal protein L1 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rplA PE=3 SV=1 123 248 1.0E-22
sp|A1SEI7|RL1_NOCSJ 50S ribosomal protein L1 OS=Nocardioides sp. (strain BAA-499 / JS614) GN=rplA PE=3 SV=2 65 287 1.0E-22
sp|Q6MDM4|RL1_PARUW 50S ribosomal protein L1 OS=Protochlamydia amoebophila (strain UWE25) GN=rplA PE=3 SV=1 67 287 1.0E-22
sp|Q1RHC7|RL1_RICBR 50S ribosomal protein L1 OS=Rickettsia bellii (strain RML369-C) GN=rplA PE=3 SV=1 47 287 1.0E-22
sp|A8GV21|RL1_RICB8 50S ribosomal protein L1 OS=Rickettsia bellii (strain OSU 85-389) GN=rplA PE=3 SV=1 47 287 1.0E-22
sp|Q5FM22|RL1_LACAC 50S ribosomal protein L1 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rplA PE=3 SV=1 98 287 1.0E-22
sp|A6U848|RL1_SINMW 50S ribosomal protein L1 OS=Sinorhizobium medicae (strain WSM419) GN=rplA PE=3 SV=1 107 287 1.0E-22
sp|Q6NJG9|RL1_CORDI 50S ribosomal protein L1 OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=rplA PE=3 SV=1 54 287 1.0E-22
sp|Q28UY1|RL1_JANSC 50S ribosomal protein L1 OS=Jannaschia sp. (strain CCS1) GN=rplA PE=3 SV=1 53 287 1.0E-22
sp|Q38V06|RL1_LACSS 50S ribosomal protein L1 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rplA PE=3 SV=1 54 287 1.0E-22
sp|B1HNL5|RL1_LYSSC 50S ribosomal protein L1 OS=Lysinibacillus sphaericus (strain C3-41) GN=rplA PE=3 SV=1 77 287 2.0E-22
sp|B3WA08|RL1_LACCB 50S ribosomal protein L1 OS=Lactobacillus casei (strain BL23) GN=rplA PE=3 SV=1 51 289 2.0E-22
sp|Q035U9|RL1_LACC3 50S ribosomal protein L1 OS=Lactobacillus casei (strain ATCC 334) GN=rplA PE=3 SV=1 51 289 2.0E-22
sp|Q03IP4|RL1_STRTD 50S ribosomal protein L1 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rplA PE=3 SV=1 65 287 2.0E-22
sp|Q5M2K0|RL1_STRT2 50S ribosomal protein L1 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rplA PE=3 SV=2 65 287 2.0E-22
sp|Q5LXZ6|RL1_STRT1 50S ribosomal protein L1 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rplA PE=3 SV=2 65 287 2.0E-22
sp|B3PW56|RL1_RHIE6 50S ribosomal protein L1 OS=Rhizobium etli (strain CIAT 652) GN=rplA PE=3 SV=1 72 286 2.0E-22
sp|A8YTE3|RL1_LACH4 50S ribosomal protein L1 OS=Lactobacillus helveticus (strain DPC 4571) GN=rplA PE=3 SV=1 67 287 2.0E-22
sp|Q8UE05|RL1_AGRFC 50S ribosomal protein L1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rplA PE=3 SV=2 71 286 2.0E-22
sp|Q1MIF3|RL1_RHIL3 50S ribosomal protein L1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rplA PE=3 SV=1 107 286 3.0E-22
sp|B9JDR8|RL1_AGRRK 50S ribosomal protein L1 OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=rplA PE=3 SV=1 107 286 3.0E-22
sp|Q89J70|RL1_BRADU 50S ribosomal protein L1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rplA PE=3 SV=1 123 286 3.0E-22
sp|Q84IF4|RL1_SELRU 50S ribosomal protein L1 OS=Selenomonas ruminantium GN=rplA PE=3 SV=1 71 287 3.0E-22
sp|A8EXK5|RL1_RICCK 50S ribosomal protein L1 OS=Rickettsia canadensis (strain McKiel) GN=rplA PE=3 SV=1 61 286 3.0E-22
sp|A8HTX8|RL1_AZOC5 50S ribosomal protein L1 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rplA PE=3 SV=1 72 287 3.0E-22
sp|A5D5H7|RL1_PELTS 50S ribosomal protein L1 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rplA PE=3 SV=1 124 287 3.0E-22
sp|Q2K9M7|RL1_RHIEC 50S ribosomal protein L1 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rplA PE=3 SV=1 107 286 3.0E-22
sp|B5ZYS4|RL1_RHILW 50S ribosomal protein L1 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rplA PE=3 SV=1 107 286 3.0E-22
sp|B6JER6|RL1_OLICO 50S ribosomal protein L1 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rplA PE=3 SV=1 56 286 4.0E-22
sp|A8LLK0|RL1_DINSH 50S ribosomal protein L1 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rplA PE=3 SV=1 61 287 4.0E-22
sp|Q11HB0|RL1_CHESB 50S ribosomal protein L1 OS=Chelativorans sp. (strain BNC1) GN=rplA PE=3 SV=1 107 287 5.0E-22
sp|B9KL80|RL1_RHOSK 50S ribosomal protein L1 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rplA PE=3 SV=1 107 287 6.0E-22
sp|Q3J5T3|RL1_RHOS4 50S ribosomal protein L1 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rplA PE=3 SV=1 107 287 6.0E-22
sp|A3PGI6|RL1_RHOS1 50S ribosomal protein L1 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rplA1 PE=3 SV=1 107 287 6.0E-22
sp|Q6N4R5|RL1_RHOPA 50S ribosomal protein L1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rplA PE=1 SV=3 123 286 6.0E-22
sp|Q4L3J7|RL1_STAHJ 50S ribosomal protein L1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rplA PE=3 SV=1 68 287 6.0E-22
sp|Q6G3X8|RL1_BARHE 50S ribosomal protein L1 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rplA PE=3 SV=1 68 287 6.0E-22
sp|A0ZZZ6|RL1_BIFAA 50S ribosomal protein L1 OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=rplA PE=3 SV=1 71 287 7.0E-22
sp|B8E0K2|RL1_DICTD 50S ribosomal protein L1 OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=rplA PE=3 SV=1 107 245 7.0E-22
sp|Q9LE95|RK1_SPIOL 50S ribosomal protein L1, chloroplastic OS=Spinacia oleracea GN=RPL1 PE=1 SV=1 70 287 7.0E-22
sp|B5YEX9|RL1_DICT6 50S ribosomal protein L1 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=rplA PE=3 SV=1 107 245 7.0E-22
sp|C6C176|RL1_DESAD 50S ribosomal protein L1 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=rplA PE=3 SV=1 107 287 8.0E-22
sp|Q2LQ90|RL1_SYNAS 50S ribosomal protein L1 OS=Syntrophus aciditrophicus (strain SB) GN=rplA PE=3 SV=1 69 287 8.0E-22
sp|B3QC04|RL1_RHOPT 50S ribosomal protein L1 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rplA PE=3 SV=1 123 286 8.0E-22
sp|Q92QI0|RL1_RHIME 50S ribosomal protein L1 OS=Rhizobium meliloti (strain 1021) GN=rplA PE=3 SV=1 107 287 9.0E-22
sp|A5V9F6|RL1_SPHWW 50S ribosomal protein L1 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rplA PE=3 SV=1 107 287 9.0E-22
sp|Q7MA59|RL1_WOLSU 50S ribosomal protein L1 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rplA PE=3 SV=1 123 248 9.0E-22
sp|Q01VA8|RL1_SOLUE 50S ribosomal protein L1 OS=Solibacter usitatus (strain Ellin6076) GN=rplA PE=3 SV=1 60 287 1.0E-21
sp|Q0AUG8|RL1_SYNWW 50S ribosomal protein L1 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rplA PE=3 SV=1 66 287 1.0E-21
sp|Q6AP81|RL1_DESPS 50S ribosomal protein L1 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=rplA PE=3 SV=1 66 287 1.0E-21
sp|B7KIR7|RL1_CYAP7 50S ribosomal protein L1 OS=Cyanothece sp. (strain PCC 7424) GN=rplA PE=3 SV=1 94 287 1.0E-21
sp|B2S095|RL1_BORHD 50S ribosomal protein L1 OS=Borrelia hermsii (strain HS1 / DAH) GN=rplA PE=3 SV=1 51 289 2.0E-21
sp|Q0VSM5|RL1_ALCBS 50S ribosomal protein L1 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rplA PE=3 SV=1 123 287 2.0E-21
sp|C4K1P2|RL1_RICPU 50S ribosomal protein L1 OS=Rickettsia peacockii (strain Rustic) GN=rplA PE=3 SV=1 61 286 2.0E-21
sp|Q92J89|RL1_RICCN 50S ribosomal protein L1 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rplA PE=3 SV=1 61 286 2.0E-21
sp|B6IRP3|RL1_RHOCS 50S ribosomal protein L1 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rplA PE=3 SV=1 107 287 2.0E-21
sp|A0LII1|RL1_SYNFM 50S ribosomal protein L1 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rplA PE=3 SV=1 107 287 2.0E-21
sp|Q8CTT4|RL1_STAES 50S ribosomal protein L1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rplA PE=3 SV=1 68 287 2.0E-21
sp|Q5HRL4|RL1_STAEQ 50S ribosomal protein L1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rplA PE=3 SV=1 68 287 2.0E-21
sp|Q134R4|RL1_RHOPS 50S ribosomal protein L1 OS=Rhodopseudomonas palustris (strain BisB5) GN=rplA PE=3 SV=1 123 286 2.0E-21
sp|A9KD42|RL1_COXBN 50S ribosomal protein L1 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rplA PE=3 SV=1 123 287 2.0E-21
sp|B6J274|RL1_COXB2 50S ribosomal protein L1 OS=Coxiella burnetii (strain CbuG_Q212) GN=rplA PE=3 SV=1 123 287 2.0E-21
sp|B6J5B9|RL1_COXB1 50S ribosomal protein L1 OS=Coxiella burnetii (strain CbuK_Q154) GN=rplA PE=3 SV=1 123 287 2.0E-21
sp|Q3A9Q3|RL1_CARHZ 50S ribosomal protein L1 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rplA PE=3 SV=1 52 287 2.0E-21
sp|A8F4F7|RL1_PSELT 50S ribosomal protein L1 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rplA PE=3 SV=1 71 287 2.0E-21
sp|Q83ET3|RL1_COXBU 50S ribosomal protein L1 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rplA PE=3 SV=1 123 287 2.0E-21
sp|A9NAL1|RL1_COXBR 50S ribosomal protein L1 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rplA PE=3 SV=1 123 287 2.0E-21
sp|A8GQW1|RL1_RICRS 50S ribosomal protein L1 OS=Rickettsia rickettsii (strain Sheila Smith) GN=rplA PE=3 SV=1 61 286 2.0E-21
sp|B0BWA6|RL1_RICRO 50S ribosomal protein L1 OS=Rickettsia rickettsii (strain Iowa) GN=rplA PE=3 SV=1 61 286 2.0E-21
sp|B8EMR8|RL1_METSB 50S ribosomal protein L1 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rplA PE=3 SV=1 107 287 3.0E-21
sp|Q9LAK5|RL1_CORGL 50S ribosomal protein L1 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=rplA PE=3 SV=1 67 287 3.0E-21
sp|A4QBF1|RL1_CORGB 50S ribosomal protein L1 OS=Corynebacterium glutamicum (strain R) GN=rplA PE=3 SV=1 67 287 3.0E-21
sp|C3PMH4|RL1_RICAE 50S ribosomal protein L1 OS=Rickettsia africae (strain ESF-5) GN=rplA PE=3 SV=1 61 286 3.0E-21
sp|Q2IXS7|RL1_RHOP2 50S ribosomal protein L1 OS=Rhodopseudomonas palustris (strain HaA2) GN=rplA PE=3 SV=1 123 286 3.0E-21
sp|Q6FZL6|RL1_BARQU 50S ribosomal protein L1 OS=Bartonella quintana (strain Toulouse) GN=rplA PE=3 SV=1 68 287 3.0E-21
sp|Q211C5|RL1_RHOPB 50S ribosomal protein L1 OS=Rhodopseudomonas palustris (strain BisB18) GN=rplA PE=3 SV=1 61 286 3.0E-21
sp|Q160X4|RL1_ROSDO 50S ribosomal protein L1 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rplA PE=3 SV=1 68 287 3.0E-21
sp|A7HWQ1|RL1_PARL1 50S ribosomal protein L1 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rplA PE=3 SV=1 123 286 4.0E-21
sp|Q30X09|RL1_DESAG 50S ribosomal protein L1 OS=Desulfovibrio alaskensis (strain G20) GN=rplA PE=3 SV=1 107 287 4.0E-21
sp|Q3A6Q7|RL1_PELCD 50S ribosomal protein L1 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rplA PE=3 SV=1 72 287 5.0E-21
sp|B9M6V5|RL1_GEODF 50S ribosomal protein L1 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=rplA PE=3 SV=1 107 287 5.0E-21
sp|A8EVZ7|RL1_ARCB4 50S ribosomal protein L1 OS=Arcobacter butzleri (strain RM4018) GN=rplA PE=3 SV=1 60 247 5.0E-21
sp|Q04599|RM01_YEAST 54S ribosomal protein L1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL1 PE=1 SV=1 54 289 5.0E-21
sp|Q88YW9|RL1_LACPL 50S ribosomal protein L1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rplA PE=3 SV=1 72 287 5.0E-21
sp|A7IKP7|RL1_XANP2 50S ribosomal protein L1 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rplA PE=3 SV=1 72 286 6.0E-21
sp|A6W3A2|RL1_MARMS 50S ribosomal protein L1 OS=Marinomonas sp. (strain MWYL1) GN=rplA PE=3 SV=1 67 287 6.0E-21
sp|A6Q1M0|RL1_NITSB 50S ribosomal protein L1 OS=Nitratiruptor sp. (strain SB155-2) GN=rplA PE=3 SV=1 68 248 7.0E-21
sp|A3DIZ1|RL1_CLOTH 50S ribosomal protein L1 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rplA PE=3 SV=1 123 287 7.0E-21
sp|Q5HVZ2|RL1_CAMJR 50S ribosomal protein L1 OS=Campylobacter jejuni (strain RM1221) GN=rplA PE=3 SV=1 72 247 8.0E-21
sp|A1VYJ1|RL1_CAMJJ 50S ribosomal protein L1 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=rplA PE=3 SV=1 72 247 8.0E-21
sp|Q9PI34|RL1_CAMJE 50S ribosomal protein L1 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=rplA PE=3 SV=1 72 247 8.0E-21
sp|A7H4Q8|RL1_CAMJD 50S ribosomal protein L1 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=rplA PE=3 SV=1 72 247 8.0E-21
sp|A8FKR0|RL1_CAMJ8 50S ribosomal protein L1 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=rplA PE=3 SV=1 72 247 8.0E-21
sp|C0Q9Y2|RL1_DESAH 50S ribosomal protein L1 OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=rplA PE=3 SV=1 107 287 9.0E-21
sp|A8GMA4|RL1_RICAH 50S ribosomal protein L1 OS=Rickettsia akari (strain Hartford) GN=rplA PE=3 SV=1 71 286 9.0E-21
sp|Q4UKD1|RL1_RICFE 50S ribosomal protein L1 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rplA PE=3 SV=1 61 286 9.0E-21
sp|B2G5T2|RL1_LACRJ 50S ribosomal protein L1 OS=Lactobacillus reuteri (strain JCM 1112) GN=rplA PE=3 SV=1 64 287 9.0E-21
sp|Q8G4T3|RL1_BIFLO 50S ribosomal protein L1 OS=Bifidobacterium longum (strain NCC 2705) GN=rplA PE=3 SV=1 71 287 1.0E-20
sp|B3DPT0|RL1_BIFLD 50S ribosomal protein L1 OS=Bifidobacterium longum (strain DJO10A) GN=rplA PE=3 SV=1 71 287 1.0E-20
sp|C3MAW8|RL1_RHISN 50S ribosomal protein L1 OS=Rhizobium sp. (strain NGR234) GN=rplA PE=3 SV=1 107 287 1.0E-20
sp|Q0SNB5|RL1_BORAP 50S ribosomal protein L1 OS=Borrelia afzelii (strain PKo) GN=rplA PE=3 SV=1 51 286 1.0E-20
sp|B7GNJ5|RL1_BIFLS 50S ribosomal protein L1 OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=rplA PE=3 SV=1 71 287 1.0E-20
sp|C5D3Q5|RL1_GEOSW 50S ribosomal protein L1 OS=Geobacillus sp. (strain WCH70) GN=rplA PE=3 SV=1 74 287 1.0E-20
sp|O78413|RK1_GUITH 50S ribosomal protein L1, chloroplastic OS=Guillardia theta GN=rpl1 PE=3 SV=1 68 247 1.0E-20
sp|B9DY98|RL1_CLOK1 50S ribosomal protein L1 OS=Clostridium kluyveri (strain NBRC 12016) GN=rplA PE=3 SV=1 79 287 2.0E-20
sp|B8IS73|RL1_METNO 50S ribosomal protein L1 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rplA PE=3 SV=1 71 287 2.0E-20
sp|Q2RFN6|RL1_MOOTA 50S ribosomal protein L1 OS=Moorella thermoacetica (strain ATCC 39073) GN=rplA PE=3 SV=1 74 287 2.0E-20
sp|Q68XN1|RL1_RICTY 50S ribosomal protein L1 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rplA PE=3 SV=1 61 286 2.0E-20
sp|A5N4N6|RL1_CLOK5 50S ribosomal protein L1 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rplA PE=3 SV=1 79 287 2.0E-20
sp|Q9ZE23|RL1_RICPR 50S ribosomal protein L1 OS=Rickettsia prowazekii (strain Madrid E) GN=rplA PE=3 SV=1 61 286 2.0E-20
sp|C4XIP2|RL1_DESMR 50S ribosomal protein L1 OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=rplA PE=3 SV=1 107 287 2.0E-20
sp|Q0BYA1|RL1_HYPNA 50S ribosomal protein L1 OS=Hyphomonas neptunium (strain ATCC 15444) GN=rplA PE=3 SV=1 74 287 2.0E-20
sp|A5GAX8|RL1_GEOUR 50S ribosomal protein L1 OS=Geobacter uraniireducens (strain Rf4) GN=rplA PE=3 SV=1 107 287 2.0E-20
sp|P66092|RL1_STAAW 50S ribosomal protein L1 OS=Staphylococcus aureus (strain MW2) GN=rplA PE=3 SV=1 68 287 3.0E-20
sp|A8YZN6|RL1_STAAT 50S ribosomal protein L1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rplA PE=3 SV=1 68 287 3.0E-20
sp|Q6GBU9|RL1_STAAS 50S ribosomal protein L1 OS=Staphylococcus aureus (strain MSSA476) GN=rplA PE=3 SV=1 68 287 3.0E-20
sp|P66091|RL1_STAAM 50S ribosomal protein L1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rplA PE=3 SV=1 68 287 3.0E-20
sp|A6QEJ0|RL1_STAAE 50S ribosomal protein L1 OS=Staphylococcus aureus (strain Newman) GN=rplA PE=3 SV=1 68 287 3.0E-20
sp|Q5HID7|RL1_STAAC 50S ribosomal protein L1 OS=Staphylococcus aureus (strain COL) GN=rplA PE=3 SV=1 68 287 3.0E-20
sp|Q2YSC3|RL1_STAAB 50S ribosomal protein L1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rplA PE=3 SV=1 68 287 3.0E-20
sp|A5IQ92|RL1_STAA9 50S ribosomal protein L1 OS=Staphylococcus aureus (strain JH9) GN=rplA PE=3 SV=1 68 287 3.0E-20
sp|Q2G0P0|RL1_STAA8 50S ribosomal protein L1 OS=Staphylococcus aureus (strain NCTC 8325) GN=rplA PE=3 SV=1 68 287 3.0E-20
sp|Q2FJA2|RL1_STAA3 50S ribosomal protein L1 OS=Staphylococcus aureus (strain USA300) GN=rplA PE=3 SV=1 68 287 3.0E-20
sp|A6TZ15|RL1_STAA2 50S ribosomal protein L1 OS=Staphylococcus aureus (strain JH1) GN=rplA PE=3 SV=1 68 287 3.0E-20
sp|A7WYW1|RL1_STAA1 50S ribosomal protein L1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rplA PE=3 SV=1 68 287 3.0E-20
sp|B8I5M9|RL1_CLOCE 50S ribosomal protein L1 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=rplA PE=3 SV=1 73 287 3.0E-20
sp|P04447|RL1_GEOSE 50S ribosomal protein L1 OS=Geobacillus stearothermophilus GN=rplA PE=1 SV=2 72 287 3.0E-20
sp|A1TYI7|RL1_MARHV 50S ribosomal protein L1 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rplA PE=3 SV=1 68 287 3.0E-20
sp|B0BBU9|RL1_CHLTB 50S ribosomal protein L1 OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=rplA PE=3 SV=1 68 287 3.0E-20
sp|Q748Y3|RL1_GEOSL 50S ribosomal protein L1 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=rplA PE=3 SV=1 123 287 3.0E-20
sp|Q6GJD0|RL1_STAAR 50S ribosomal protein L1 OS=Staphylococcus aureus (strain MRSA252) GN=rplA PE=3 SV=1 68 287 3.0E-20
sp|B0B7N4|RL1_CHLT2 50S ribosomal protein L1 OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=rplA PE=3 SV=1 68 287 3.0E-20
sp|Q1GK53|RL1_RUEST 50S ribosomal protein L1 OS=Ruegeria sp. (strain TM1040) GN=rplA PE=3 SV=1 61 287 3.0E-20
sp|B9KFG4|RL1_CAMLR 50S ribosomal protein L1 OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=rplA PE=3 SV=1 72 247 3.0E-20
sp|Q6B906|RK1_GRATL 50S ribosomal protein L1, chloroplastic OS=Gracilaria tenuistipitata var. liui GN=rpl1 PE=3 SV=1 68 284 3.0E-20
sp|Q7VJ79|RL1_HELHP 50S ribosomal protein L1 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=rplA PE=3 SV=1 123 248 4.0E-20
sp|B2IMU8|RL1_STRPS 50S ribosomal protein L1 OS=Streptococcus pneumoniae (strain CGSP14) GN=rplA PE=3 SV=1 65 287 4.0E-20
sp|B8ZML9|RL1_STRPJ 50S ribosomal protein L1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rplA PE=3 SV=1 65 287 4.0E-20
sp|Q4FLK9|RL1_PELUB 50S ribosomal protein L1 OS=Pelagibacter ubique (strain HTCC1062) GN=rplA PE=3 SV=1 110 251 4.0E-20
sp|B9MJX0|RL1_CALBD 50S ribosomal protein L1 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rplA PE=3 SV=1 107 287 4.0E-20
sp|A5GWK1|RL1_SYNR3 50S ribosomal protein L1 OS=Synechococcus sp. (strain RCC307) GN=rplA PE=3 SV=1 94 289 4.0E-20
sp|Q2NDY5|RL1_ERYLH 50S ribosomal protein L1 OS=Erythrobacter litoralis (strain HTCC2594) GN=rplA PE=3 SV=1 107 287 4.0E-20
sp|A6W5S7|RL1_KINRD 50S ribosomal protein L1 OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=rplA PE=3 SV=1 65 287 4.0E-20
sp|A7I3U2|RL1_CAMHC 50S ribosomal protein L1 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=rplA PE=3 SV=1 54 247 5.0E-20
sp|Q9PK77|RL1_CHLMU 50S ribosomal protein L1 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rplA PE=3 SV=1 68 287 5.0E-20
sp|B0UHY1|RL1_METS4 50S ribosomal protein L1 OS=Methylobacterium sp. (strain 4-46) GN=rplA PE=3 SV=1 71 287 5.0E-20
sp|P66099|RL1_TROWT 50S ribosomal protein L1 OS=Tropheryma whipplei (strain Twist) GN=rplA PE=3 SV=1 51 287 5.0E-20
sp|P66100|RL1_TROW8 50S ribosomal protein L1 OS=Tropheryma whipplei (strain TW08/27) GN=rplA PE=3 SV=1 51 287 5.0E-20
sp|Q39Y16|RL1_GEOMG 50S ribosomal protein L1 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rplA PE=3 SV=1 72 287 6.0E-20
sp|Q73JJ4|RL1_TREDE 50S ribosomal protein L1 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rplA PE=3 SV=1 60 287 6.0E-20
sp|C1CJA6|RL1_STRZP 50S ribosomal protein L1 OS=Streptococcus pneumoniae (strain P1031) GN=rplA PE=3 SV=1 65 287 6.0E-20
sp|P66096|RL1_STRR6 50S ribosomal protein L1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rplA PE=3 SV=1 65 287 6.0E-20
sp|P66095|RL1_STRPN 50S ribosomal protein L1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rplA PE=3 SV=1 65 287 6.0E-20
sp|B1IAH4|RL1_STRPI 50S ribosomal protein L1 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rplA PE=3 SV=1 65 287 6.0E-20
sp|C1C5Z9|RL1_STRP7 50S ribosomal protein L1 OS=Streptococcus pneumoniae (strain 70585) GN=rplA PE=3 SV=1 65 287 6.0E-20
sp|B5E2M6|RL1_STRP4 50S ribosomal protein L1 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rplA PE=3 SV=1 65 287 6.0E-20
sp|Q04LP6|RL1_STRP2 50S ribosomal protein L1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rplA PE=3 SV=1 65 287 6.0E-20
sp|Q3ATP8|RL1_CHLCH 50S ribosomal protein L1 OS=Chlorobium chlorochromatii (strain CaD3) GN=rplA PE=3 SV=1 72 286 7.0E-20
sp|Q250P7|RL1_DESHY 50S ribosomal protein L1 OS=Desulfitobacterium hafniense (strain Y51) GN=rplA PE=3 SV=1 48 287 7.0E-20
sp|B8G1V1|RL1_DESHD 50S ribosomal protein L1 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=rplA PE=3 SV=1 48 287 7.0E-20
sp|Q8DM27|RL1_THEEB 50S ribosomal protein L1 OS=Thermosynechococcus elongatus (strain BP-1) GN=rplA PE=3 SV=1 94 287 7.0E-20
sp|C1CQB6|RL1_STRZT 50S ribosomal protein L1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rplA PE=3 SV=1 65 287 7.0E-20
sp|P36248|RL1_LIBAS 50S ribosomal protein L1 OS=Liberibacter asiaticus GN=rplA PE=3 SV=1 123 286 8.0E-20
sp|Q3MA18|RL1_ANAVT 50S ribosomal protein L1 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rplA PE=3 SV=1 94 287 8.0E-20
sp|Q0BJ57|RL1_BURCM 50S ribosomal protein L1 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rplA PE=3 SV=1 83 286 8.0E-20
sp|B1YRB9|RL1_BURA4 50S ribosomal protein L1 OS=Burkholderia ambifaria (strain MC40-6) GN=rplA PE=3 SV=1 83 286 8.0E-20
sp|A4IJH7|RL1_GEOTN 50S ribosomal protein L1 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rplA PE=3 SV=1 74 287 8.0E-20
sp|Q8YLJ7|RL1_NOSS1 50S ribosomal protein L1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rplA PE=3 SV=1 94 287 9.0E-20
sp|O67759|RL1_AQUAE 50S ribosomal protein L1 OS=Aquifex aeolicus (strain VF5) GN=rplA PE=1 SV=1 68 245 9.0E-20
sp|Q99W68|RL1_STAAN 50S ribosomal protein L1 OS=Staphylococcus aureus (strain N315) GN=rplA PE=1 SV=1 68 287 1.0E-19
sp|Q3J8Q4|RL1_NITOC 50S ribosomal protein L1 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rplA PE=3 SV=1 123 287 1.0E-19
sp|Q5L420|RL1_GEOKA 50S ribosomal protein L1 OS=Geobacillus kaustophilus (strain HTA426) GN=rplA PE=3 SV=1 72 287 1.0E-19
sp|A9BF36|RL1_PETMO 50S ribosomal protein L1 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=rplA PE=3 SV=1 66 287 1.0E-19
sp|A7HCI0|RL1_ANADF 50S ribosomal protein L1 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rplA PE=3 SV=1 123 287 1.0E-19
sp|B7GJ55|RL1_ANOFW 50S ribosomal protein L1 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rplA PE=3 SV=1 73 287 1.0E-19
sp|Q81J52|RL1_BACCR 50S ribosomal protein L1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rplA PE=3 SV=1 73 287 1.0E-19
sp|Q661M6|RL1_BORBP 50S ribosomal protein L1 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=rplA PE=3 SV=1 51 289 1.0E-19
sp|A4JAM9|RL1_BURVG 50S ribosomal protein L1 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rplA PE=3 SV=1 105 286 2.0E-19
sp|B7HJ36|RL1_BACC4 50S ribosomal protein L1 OS=Bacillus cereus (strain B4264) GN=rplA PE=3 SV=1 73 287 2.0E-19
sp|A3CPA5|RL1_STRSV 50S ribosomal protein L1 OS=Streptococcus sanguinis (strain SK36) GN=rplA PE=3 SV=1 65 287 2.0E-19
sp|Q5GRY6|RL1_WOLTR 50S ribosomal protein L1 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=rplA PE=3 SV=1 107 246 2.0E-19
sp|B7IG99|RL1_THEAB 50S ribosomal protein L1 OS=Thermosipho africanus (strain TCF52B) GN=rplA PE=3 SV=1 72 287 2.0E-19
sp|B3E7S5|RL1_GEOLS 50S ribosomal protein L1 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rplA PE=3 SV=1 123 287 2.0E-19
sp|Q04E43|RL1_OENOB 50S ribosomal protein L1 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rplA PE=3 SV=1 52 287 3.0E-19
sp|Q9LY66|RK1_ARATH 50S ribosomal protein L1, chloroplastic OS=Arabidopsis thaliana GN=RPL1 PE=1 SV=1 124 287 3.0E-19
sp|Q6HPS0|RL1_BACHK 50S ribosomal protein L1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rplA PE=3 SV=1 73 287 3.0E-19
sp|Q63HA2|RL1_BACCZ 50S ribosomal protein L1 OS=Bacillus cereus (strain ZK / E33L) GN=rplA PE=3 SV=1 73 287 3.0E-19
sp|B9IZI2|RL1_BACCQ 50S ribosomal protein L1 OS=Bacillus cereus (strain Q1) GN=rplA PE=3 SV=1 73 287 3.0E-19
sp|B7HQT2|RL1_BACC7 50S ribosomal protein L1 OS=Bacillus cereus (strain AH187) GN=rplA PE=3 SV=1 73 287 3.0E-19
sp|C1ET27|RL1_BACC3 50S ribosomal protein L1 OS=Bacillus cereus (strain 03BB102) GN=rplA PE=3 SV=1 73 287 3.0E-19
sp|Q73FA8|RL1_BACC1 50S ribosomal protein L1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rplA PE=3 SV=1 73 287 3.0E-19
sp|B7JKA6|RL1_BACC0 50S ribosomal protein L1 OS=Bacillus cereus (strain AH820) GN=rplA PE=3 SV=1 73 287 3.0E-19
sp|Q81VU2|RL1_BACAN 50S ribosomal protein L1 OS=Bacillus anthracis GN=rplA PE=3 SV=1 73 287 3.0E-19
sp|A0R8G8|RL1_BACAH 50S ribosomal protein L1 OS=Bacillus thuringiensis (strain Al Hakam) GN=rplA PE=3 SV=2 73 287 3.0E-19
sp|C3LJ70|RL1_BACAC 50S ribosomal protein L1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rplA PE=3 SV=1 73 287 3.0E-19
sp|C3P9P3|RL1_BACAA 50S ribosomal protein L1 OS=Bacillus anthracis (strain A0248) GN=rplA PE=3 SV=1 73 287 3.0E-19
sp|O51353|RL1_BORBU 50S ribosomal protein L1 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rplA PE=3 SV=1 51 287 3.0E-19
sp|B4E5A9|RL1_BURCJ 50S ribosomal protein L1 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rplA PE=3 SV=1 46 286 3.0E-19
sp|A0K3L4|RL1_BURCH 50S ribosomal protein L1 OS=Burkholderia cenocepacia (strain HI2424) GN=rplA PE=3 SV=1 46 286 3.0E-19
sp|B1JU11|RL1_BURCC 50S ribosomal protein L1 OS=Burkholderia cenocepacia (strain MC0-3) GN=rplA PE=3 SV=1 46 286 3.0E-19
sp|Q1BRT7|RL1_BURCA 50S ribosomal protein L1 OS=Burkholderia cenocepacia (strain AU 1054) GN=rplA PE=3 SV=1 46 286 3.0E-19
sp|A4XLK1|RL1_CALS8 50S ribosomal protein L1 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rplA PE=3 SV=1 123 287 3.0E-19
sp|Q2II81|RL1_ANADE 50S ribosomal protein L1 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rplA PE=3 SV=1 66 287 3.0E-19
sp|Q0ANP0|RL1_MARMM 50S ribosomal protein L1 OS=Maricaulis maris (strain MCS10) GN=rplA PE=3 SV=1 107 287 3.0E-19
sp|C0QQL3|RL1_PERMH 50S ribosomal protein L1 OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=rplA PE=3 SV=1 54 248 3.0E-19
sp|Q2ST52|RL1_MYCCT 50S ribosomal protein L1 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=rplA PE=3 SV=1 107 287 3.0E-19
sp|B2GAC3|RL1_LACF3 50S ribosomal protein L1 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=rplA PE=3 SV=1 64 287 3.0E-19
sp|Q5L5I0|RL1_CHLAB 50S ribosomal protein L1 OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=rplA PE=3 SV=1 72 287 4.0E-19
sp|Q39KH8|RL1_BURL3 50S ribosomal protein L1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rplA PE=3 SV=1 53 286 4.0E-19
sp|P48950|RL1_STRCO 50S ribosomal protein L1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=rplA PE=3 SV=2 62 284 4.0E-19
sp|Q255E9|RL1_CHLFF 50S ribosomal protein L1 OS=Chlamydophila felis (strain Fe/C-56) GN=rplA PE=3 SV=1 72 287 4.0E-19
sp|A0L5W3|RL1_MAGMM 50S ribosomal protein L1 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rplA PE=3 SV=1 51 287 4.0E-19
sp|Q8FSA5|RL1_COREF 50S ribosomal protein L1 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=rplA PE=3 SV=1 67 287 4.0E-19
sp|A8ZUU6|RL1_DESOH 50S ribosomal protein L1 OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=rplA PE=3 SV=1 107 242 4.0E-19
sp|B8J1A5|RL1_DESDA 50S ribosomal protein L1 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=rplA PE=3 SV=1 107 287 4.0E-19
sp|Q7VDY6|RL1_PROMA 50S ribosomal protein L1 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rplA PE=3 SV=1 94 287 5.0E-19
sp|B2UF70|RL1_RALPJ 50S ribosomal protein L1 OS=Ralstonia pickettii (strain 12J) GN=rplA PE=3 SV=1 60 286 5.0E-19
sp|Q9Z9A3|RL1_CHLPN 50S ribosomal protein L1 OS=Chlamydia pneumoniae GN=rplA PE=3 SV=1 72 287 5.0E-19
sp|B0CAD0|RL1_ACAM1 50S ribosomal protein L1 OS=Acaryochloris marina (strain MBIC 11017) GN=rplA PE=3 SV=1 94 247 5.0E-19
sp|B9L7J3|RL1_NAUPA 50S ribosomal protein L1 OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=rplA PE=3 SV=1 123 248 6.0E-19
sp|C1A6N4|RL1_GEMAT 50S ribosomal protein L1 OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=rplA PE=3 SV=1 74 287 6.0E-19
sp|A4G9U8|RL1_HERAR 50S ribosomal protein L1 OS=Herminiimonas arsenicoxydans GN=rplA PE=3 SV=1 105 286 6.0E-19
sp|A9ADI2|RL1_BURM1 50S ribosomal protein L1 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rplA PE=3 SV=1 105 286 6.0E-19
sp|Q1GT68|RL1_SPHAL 50S ribosomal protein L1 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rplA PE=3 SV=1 107 287 6.0E-19
sp|A8MLC9|RL1_ALKOO 50S ribosomal protein L1 OS=Alkaliphilus oremlandii (strain OhILAs) GN=rplA PE=3 SV=1 123 287 6.0E-19
sp|B7JWT7|RL1_CYAP8 50S ribosomal protein L1 OS=Cyanothece sp. (strain PCC 8801) GN=rplA PE=3 SV=1 94 247 6.0E-19
sp|B7IT07|RL1_BACC2 50S ribosomal protein L1 OS=Bacillus cereus (strain G9842) GN=rplA PE=3 SV=1 73 287 7.0E-19
sp|Q7MGR5|RL1_VIBVY 50S ribosomal protein L1 OS=Vibrio vulnificus (strain YJ016) GN=rplA PE=3 SV=1 123 287 7.0E-19
sp|Q8DD23|RL1_VIBVU 50S ribosomal protein L1 OS=Vibrio vulnificus (strain CMCP6) GN=rplA PE=3 SV=1 123 287 7.0E-19
sp|B1VEQ9|RL1_CORU7 50S ribosomal protein L1 OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=rplA PE=3 SV=1 79 288 7.0E-19
sp|Q13TF9|RL1_BURXL 50S ribosomal protein L1 OS=Burkholderia xenovorans (strain LB400) GN=rplA PE=3 SV=1 83 286 7.0E-19
sp|B7J1W4|RL1_BORBZ 50S ribosomal protein L1 OS=Borrelia burgdorferi (strain ZS7) GN=rplA PE=3 SV=1 51 287 7.0E-19
sp|Q48UX8|RL1_STRPM 50S ribosomal protein L1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rplA PE=3 SV=1 65 287 7.0E-19
sp|Q3SLQ9|RL1_THIDA 50S ribosomal protein L1 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rplA PE=3 SV=1 68 287 7.0E-19
sp|B2T762|RL1_BURPP 50S ribosomal protein L1 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rplA PE=3 SV=1 83 286 7.0E-19
sp|B0JNQ5|RL1_MICAN 50S ribosomal protein L1 OS=Microcystis aeruginosa (strain NIES-843) GN=rplA PE=3 SV=1 74 287 8.0E-19
sp|B4UDT5|RL1_ANASK 50S ribosomal protein L1 OS=Anaeromyxobacter sp. (strain K) GN=rplA PE=3 SV=1 105 287 8.0E-19
sp|B8JB73|RL1_ANAD2 50S ribosomal protein L1 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=rplA PE=3 SV=1 105 287 8.0E-19
sp|Q6FF93|RL1_ACIAD 50S ribosomal protein L1 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rplA PE=3 SV=1 54 287 8.0E-19
sp|Q822I8|RL1_CHLCV 50S ribosomal protein L1 OS=Chlamydophila caviae (strain GPIC) GN=rplA PE=3 SV=1 72 287 9.0E-19
sp|P36256|RL1_STRGR 50S ribosomal protein L1 OS=Streptomyces griseus GN=rplA PE=3 SV=1 62 284 9.0E-19
sp|B1W446|RL1_STRGG 50S ribosomal protein L1 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=rplA PE=3 SV=1 62 284 9.0E-19
sp|Q2SU16|RL1_BURTA 50S ribosomal protein L1 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rplA PE=3 SV=1 83 287 1.0E-18
sp|Q63Q00|RL1_BURPS 50S ribosomal protein L1 OS=Burkholderia pseudomallei (strain K96243) GN=rplA PE=3 SV=1 83 287 1.0E-18
sp|A3NEJ0|RL1_BURP6 50S ribosomal protein L1 OS=Burkholderia pseudomallei (strain 668) GN=rplA PE=3 SV=1 83 287 1.0E-18
sp|Q3JMQ0|RL1_BURP1 50S ribosomal protein L1 OS=Burkholderia pseudomallei (strain 1710b) GN=rplA PE=3 SV=1 83 287 1.0E-18
sp|A3P0C8|RL1_BURP0 50S ribosomal protein L1 OS=Burkholderia pseudomallei (strain 1106a) GN=rplA PE=3 SV=1 83 287 1.0E-18
sp|A1V8B5|RL1_BURMS 50S ribosomal protein L1 OS=Burkholderia mallei (strain SAVP1) GN=rplA PE=3 SV=1 83 287 1.0E-18
sp|Q62GJ4|RL1_BURMA 50S ribosomal protein L1 OS=Burkholderia mallei (strain ATCC 23344) GN=rplA PE=3 SV=1 83 287 1.0E-18
sp|A2S7G3|RL1_BURM9 50S ribosomal protein L1 OS=Burkholderia mallei (strain NCTC 10229) GN=rplA PE=3 SV=1 83 287 1.0E-18
sp|A3MRU2|RL1_BURM7 50S ribosomal protein L1 OS=Burkholderia mallei (strain NCTC 10247) GN=rplA PE=3 SV=1 83 287 1.0E-18
sp|B2JIH7|RL1_BURP8 50S ribosomal protein L1 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rplA PE=3 SV=1 83 286 1.0E-18
sp|B4U475|RL1_STREM 50S ribosomal protein L1 OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=rplA PE=3 SV=1 65 287 1.0E-18
sp|B1VAM9|RL1_PHYAS 50S ribosomal protein L1 OS=Phytoplasma australiense GN=rplA PE=3 SV=1 123 287 1.0E-18
sp|C0MHG4|RL1_STRS7 50S ribosomal protein L1 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rplA PE=3 SV=1 65 287 1.0E-18
sp|C0MBT9|RL1_STRE4 50S ribosomal protein L1 OS=Streptococcus equi subsp. equi (strain 4047) GN=rplA PE=3 SV=1 65 287 1.0E-18
sp|B5XK62|RL1_STRPZ 50S ribosomal protein L1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=rplA PE=3 SV=1 65 287 1.0E-18
sp|A2RG32|RL1_STRPG 50S ribosomal protein L1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rplA PE=3 SV=1 65 287 1.0E-18
sp|Q1J834|RL1_STRPF 50S ribosomal protein L1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rplA PE=3 SV=1 65 287 1.0E-18
sp|Q1JI79|RL1_STRPD 50S ribosomal protein L1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rplA PE=3 SV=1 65 287 1.0E-18
sp|Q1JN33|RL1_STRPC 50S ribosomal protein L1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rplA PE=3 SV=1 65 287 1.0E-18
sp|Q1JD60|RL1_STRPB 50S ribosomal protein L1 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rplA PE=3 SV=1 65 287 1.0E-18
sp|P66098|RL1_STRP8 50S ribosomal protein L1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rplA PE=3 SV=1 65 287 1.0E-18
sp|Q5XDH6|RL1_STRP6 50S ribosomal protein L1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rplA PE=3 SV=1 65 287 1.0E-18
sp|P66097|RL1_STRP1 50S ribosomal protein L1 OS=Streptococcus pyogenes serotype M1 GN=rplA PE=3 SV=1 65 287 1.0E-18
sp|Q6MRY7|RL1_MYCMS 50S ribosomal protein L1 OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=rplA PE=3 SV=1 107 287 1.0E-18
sp|Q4JT18|RL1_CORJK 50S ribosomal protein L1 OS=Corynebacterium jeikeium (strain K411) GN=rplA PE=3 SV=1 56 288 1.0E-18
sp|Q30TQ0|RL1_SULDN 50S ribosomal protein L1 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=rplA PE=3 SV=1 68 247 1.0E-18
sp|P0DE17|RL1_STRPQ 50S ribosomal protein L1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rplA PE=3 SV=1 65 287 1.0E-18
sp|P0DE16|RL1_STRP3 50S ribosomal protein L1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rplA PE=3 SV=1 65 287 1.0E-18
sp|Q9TM00|RK1_CYACA 50S ribosomal protein L1, chloroplastic OS=Cyanidium caldarium GN=rpl1 PE=3 SV=1 74 289 2.0E-18
sp|Q82T72|RL1_NITEU 50S ribosomal protein L1 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rplA PE=3 SV=2 66 287 2.0E-18
sp|A7GK09|RL1_BACCN 50S ribosomal protein L1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rplA PE=3 SV=1 73 287 2.0E-18
sp|Q1WST3|RL1_LACS1 50S ribosomal protein L1 OS=Lactobacillus salivarius (strain UCC118) GN=rplA PE=3 SV=1 51 287 2.0E-18
sp|Q07KJ8|RL1_RHOP5 50S ribosomal protein L1 OS=Rhodopseudomonas palustris (strain BisA53) GN=rplA PE=3 SV=1 123 286 2.0E-18
sp|Q8XUZ5|RL1_RALSO 50S ribosomal protein L1 OS=Ralstonia solanacearum (strain GMI1000) GN=rplA PE=3 SV=1 61 286 2.0E-18
sp|Q7U3T7|RL1_SYNPX 50S ribosomal protein L1 OS=Synechococcus sp. (strain WH8102) GN=rplA PE=3 SV=1 94 289 2.0E-18
sp|Q8F0R9|RL1_LEPIN 50S ribosomal protein L1 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=rplA PE=3 SV=1 65 287 2.0E-18
sp|Q72UB1|RL1_LEPIC 50S ribosomal protein L1 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=rplA PE=3 SV=1 65 287 2.0E-18
sp|Q46HH0|RL1_PROMT 50S ribosomal protein L1 OS=Prochlorococcus marinus (strain NATL2A) GN=rplA PE=3 SV=1 123 247 2.0E-18
sp|A2C033|RL1_PROM1 50S ribosomal protein L1 OS=Prochlorococcus marinus (strain NATL1A) GN=rplA PE=3 SV=1 123 247 2.0E-18
sp|Q6F0K8|RL1_MESFL 50S ribosomal protein L1 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rplA PE=3 SV=1 107 286 2.0E-18
sp|Q49V48|RL1_STAS1 50S ribosomal protein L1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rplA PE=3 SV=1 67 287 2.0E-18
sp|Q5WLS4|RL1_BACSK 50S ribosomal protein L1 OS=Bacillus clausii (strain KSM-K16) GN=rplA PE=3 SV=1 74 287 2.0E-18
sp|A7MXE3|RL1_VIBCB 50S ribosomal protein L1 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rplA PE=3 SV=1 121 287 2.0E-18
sp|Q07976|RL1_STRSF 50S ribosomal protein L1 OS=Streptomyces sp. (strain FRI-5) GN=rplA PE=3 SV=1 62 287 2.0E-18
sp|A1ALT1|RL1_PELPD 50S ribosomal protein L1 OS=Pelobacter propionicus (strain DSM 2379) GN=rplA PE=3 SV=1 72 287 2.0E-18
sp|A5FZX4|RL1_ACICJ 50S ribosomal protein L1 OS=Acidiphilium cryptum (strain JF-5) GN=rplA PE=3 SV=1 51 287 3.0E-18
sp|Q47UV6|RL1_COLP3 50S ribosomal protein L1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rplA PE=3 SV=1 121 287 3.0E-18
sp|Q15YB4|RL1_PSEA6 50S ribosomal protein L1 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rplA PE=3 SV=1 121 287 3.0E-18
sp|A9BDG6|RL1_PROM4 50S ribosomal protein L1 OS=Prochlorococcus marinus (strain MIT 9211) GN=rplA PE=3 SV=1 123 287 3.0E-18
sp|Q04QI6|RL1_LEPBJ 50S ribosomal protein L1 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=rplA PE=3 SV=1 68 239 3.0E-18
sp|Q2JTQ5|RL1_SYNJA 50S ribosomal protein L1 OS=Synechococcus sp. (strain JA-3-3Ab) GN=rplA PE=3 SV=1 73 247 3.0E-18
sp|Q87KQ1|RL1_VIBPA 50S ribosomal protein L1 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rplA PE=3 SV=1 123 287 3.0E-18
sp|A0LRL0|RL1_ACIC1 50S ribosomal protein L1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=rplA PE=3 SV=1 65 287 3.0E-18
sp|Q7NK78|RL1_GLOVI 50S ribosomal protein L1 OS=Gloeobacter violaceus (strain PCC 7421) GN=rplA PE=3 SV=1 74 239 4.0E-18
sp|B2TIG5|RL1_CLOBB 50S ribosomal protein L1 OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=rplA PE=3 SV=1 123 287 4.0E-18
sp|B2UYA0|RL1_CLOBA 50S ribosomal protein L1 OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=rplA PE=3 SV=1 123 287 4.0E-18
sp|A0QS46|RL1_MYCS2 50S ribosomal protein L1 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rplA PE=1 SV=1 67 287 4.0E-18
sp|Q65W45|RL1_MANSM 50S ribosomal protein L1 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rplA PE=3 SV=1 54 287 4.0E-18
sp|A6LPQ1|RL1_CLOB8 50S ribosomal protein L1 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rplA PE=3 SV=1 123 287 5.0E-18
sp|Q18CE9|RL1_PEPD6 50S ribosomal protein L1 OS=Peptoclostridium difficile (strain 630) GN=rplA PE=3 SV=1 73 287 5.0E-18
sp|B9DRE9|RL1_STRU0 50S ribosomal protein L1 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rplA PE=3 SV=1 65 287 5.0E-18
sp|B0SSI7|RL1_LEPBP 50S ribosomal protein L1 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=rplA PE=3 SV=1 71 247 5.0E-18
sp|B0SAG4|RL1_LEPBA 50S ribosomal protein L1 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=rplA PE=3 SV=1 71 247 5.0E-18
sp|A9VNB1|RL1_BACWK 50S ribosomal protein L1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=rplA PE=3 SV=1 73 287 5.0E-18
sp|A3PAS1|RL1_PROM0 50S ribosomal protein L1 OS=Prochlorococcus marinus (strain MIT 9301) GN=rplA PE=3 SV=1 123 247 5.0E-18
sp|A2BNZ8|RL1_PROMS 50S ribosomal protein L1 OS=Prochlorococcus marinus (strain AS9601) GN=rplA PE=3 SV=1 123 247 6.0E-18
sp|B1KSN6|RL1_CLOBM 50S ribosomal protein L1 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=rplA PE=3 SV=1 123 287 6.0E-18
sp|A1AX78|RL1_RUTMC 50S ribosomal protein L1 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=rplA PE=3 SV=1 54 287 6.0E-18
sp|A7GJ85|RL1_CLOBL 50S ribosomal protein L1 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rplA PE=3 SV=1 123 287 6.0E-18
sp|B1IGG5|RL1_CLOBK 50S ribosomal protein L1 OS=Clostridium botulinum (strain Okra / Type B1) GN=rplA PE=3 SV=1 123 287 6.0E-18
sp|C1FMW2|RL1_CLOBJ 50S ribosomal protein L1 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=rplA PE=3 SV=1 123 287 6.0E-18
sp|A5I7L7|RL1_CLOBH 50S ribosomal protein L1 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rplA PE=3 SV=1 123 287 6.0E-18
sp|A7FZ80|RL1_CLOB1 50S ribosomal protein L1 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rplA PE=3 SV=1 123 287 6.0E-18
sp|Q054E5|RL1_LEPBL 50S ribosomal protein L1 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=rplA PE=3 SV=1 68 239 6.0E-18
sp|Q06797|RL1_BACSU 50S ribosomal protein L1 OS=Bacillus subtilis (strain 168) GN=rplA PE=1 SV=4 73 287 6.0E-18
sp|Q31CX8|RL1_PROM9 50S ribosomal protein L1 OS=Prochlorococcus marinus (strain MIT 9312) GN=rplA PE=3 SV=1 123 247 7.0E-18
sp|Q048T9|RL1_LACDB 50S ribosomal protein L1 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rplA PE=3 SV=1 67 287 7.0E-18
sp|Q1G8Z9|RL1_LACDA 50S ribosomal protein L1 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rplA PE=3 SV=1 67 287 7.0E-18
sp|Q0BUR0|RL1_GRABC 50S ribosomal protein L1 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rplA PE=3 SV=1 107 287 8.0E-18
sp|P36236|RL1_SYNY3 50S ribosomal protein L1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rplA PE=3 SV=1 54 287 8.0E-18
sp|A9M3X7|RL1_NEIM0 50S ribosomal protein L1 OS=Neisseria meningitidis serogroup C (strain 053442) GN=rplA PE=3 SV=1 105 286 8.0E-18
sp|Q9X521|RL1_STRAU 50S ribosomal protein L1 OS=Streptomyces aureofaciens GN=rplA PE=3 SV=1 47 287 9.0E-18
sp|B1Y7H6|RL1_LEPCP 50S ribosomal protein L1 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rplA PE=3 SV=1 75 286 9.0E-18
sp|A8AY74|RL1_STRGC 50S ribosomal protein L1 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rplA PE=3 SV=1 65 287 9.0E-18
sp|Q3B1H4|RL1_CHLL7 50S ribosomal protein L1 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rplA PE=3 SV=1 143 286 1.0E-17
sp|Q1MPU1|RL1_LAWIP 50S ribosomal protein L1 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=rplA PE=3 SV=1 107 287 1.0E-17
sp|B6YQ00|RL1_AZOPC 50S ribosomal protein L1 OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=rplA PE=3 SV=1 107 287 1.0E-17
sp|P66094|RL1_STRA5 50S ribosomal protein L1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rplA PE=3 SV=1 65 287 1.0E-17
sp|P66093|RL1_STRA3 50S ribosomal protein L1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rplA PE=3 SV=1 65 287 1.0E-17
sp|Q3K004|RL1_STRA1 50S ribosomal protein L1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rplA PE=3 SV=1 65 287 1.0E-17
sp|A1T4H1|RL1_MYCVP 50S ribosomal protein L1 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=rplA PE=3 SV=1 67 287 1.0E-17
sp|A1KRG3|RL1_NEIMF 50S ribosomal protein L1 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rplA PE=3 SV=1 99 287 1.0E-17
sp|P66088|RL1_NEIMB 50S ribosomal protein L1 OS=Neisseria meningitidis serogroup B (strain MC58) GN=rplA PE=3 SV=1 99 287 1.0E-17
sp|P66087|RL1_NEIMA 50S ribosomal protein L1 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rplA PE=3 SV=1 99 287 1.0E-17
sp|P48951|RL1_STRVG 50S ribosomal protein L1 OS=Streptomyces virginiae GN=rplA PE=3 SV=1 62 287 1.0E-17
sp|B1XSE9|RL1_POLNS 50S ribosomal protein L1 OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=rplA PE=3 SV=1 105 287 1.0E-17
sp|Q2JM50|RL1_SYNJB 50S ribosomal protein L1 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=rplA PE=3 SV=1 75 247 1.0E-17
sp|A5WH38|RL1_PSYWF 50S ribosomal protein L1 OS=Psychrobacter sp. (strain PRwf-1) GN=rplA PE=3 SV=1 62 287 1.0E-17
sp|Q73IX2|RL1_WOLPM 50S ribosomal protein L1 OS=Wolbachia pipientis wMel GN=rplA PE=3 SV=1 123 286 1.0E-17
sp|Q2NJ12|RL1_AYWBP 50S ribosomal protein L1 OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=rplA PE=3 SV=2 72 287 2.0E-17
sp|A7Z0M5|RL1_BACMF 50S ribosomal protein L1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rplA PE=3 SV=1 73 287 2.0E-17
sp|Q67JS9|RL1_SYMTH 50S ribosomal protein L1 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rplA PE=3 SV=1 107 287 2.0E-17
sp|A0T0Q6|RK1_THAPS 50S ribosomal protein L1, chloroplastic OS=Thalassiosira pseudonana GN=rpl1 PE=3 SV=1 71 247 2.0E-17
sp|A8G2L0|RL1_PROM2 50S ribosomal protein L1 OS=Prochlorococcus marinus (strain MIT 9215) GN=rplA PE=3 SV=1 123 247 2.0E-17
sp|C4LL88|RL1_CORK4 50S ribosomal protein L1 OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=rplA PE=3 SV=1 107 288 2.0E-17
sp|Q98N69|RL1_RHILO 50S ribosomal protein L1 OS=Rhizobium loti (strain MAFF303099) GN=rplA PE=3 SV=1 107 287 2.0E-17
sp|Q1D7U6|RL1_MYXXD 50S ribosomal protein L1 OS=Myxococcus xanthus (strain DK 1622) GN=rplA PE=3 SV=1 47 287 2.0E-17
sp|Q8KA67|RL1_BUCAP 50S ribosomal protein L1 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rplA PE=3 SV=1 123 287 2.0E-17
sp|A8F971|RL1_BACP2 50S ribosomal protein L1 OS=Bacillus pumilus (strain SAFR-032) GN=rplA PE=3 SV=1 74 287 2.0E-17
sp|Q82DQ8|RL1_STRAW 50S ribosomal protein L1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=rplA PE=3 SV=1 54 287 2.0E-17
sp|Q0AF50|RL1_NITEC 50S ribosomal protein L1 OS=Nitrosomonas eutropha (strain C91) GN=rplA PE=3 SV=1 72 287 3.0E-17
sp|Q8EX24|RL1_MYCPE 50S ribosomal protein L1 OS=Mycoplasma penetrans (strain HF-2) GN=rplA PE=3 SV=1 107 286 3.0E-17
sp|Q5FTX4|RL1_GLUOX 50S ribosomal protein L1 OS=Gluconobacter oxydans (strain 621H) GN=rplA PE=3 SV=1 72 287 3.0E-17
sp|B4RQV9|RL1_NEIG2 50S ribosomal protein L1 OS=Neisseria gonorrhoeae (strain NCCP11945) GN=rplA PE=3 SV=1 105 286 3.0E-17
sp|Q5F5R2|RL1_NEIG1 50S ribosomal protein L1 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rplA PE=3 SV=1 105 286 3.0E-17
sp|A0AF48|RL1_LISW6 50S ribosomal protein L1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rplA PE=3 SV=1 107 287 3.0E-17
sp|B8DF06|RL1_LISMH 50S ribosomal protein L1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rplA PE=3 SV=1 107 287 3.0E-17
sp|Q724G3|RL1_LISMF 50S ribosomal protein L1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rplA PE=3 SV=1 107 287 3.0E-17
sp|C1KYI1|RL1_LISMC 50S ribosomal protein L1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rplA PE=3 SV=1 107 287 3.0E-17
sp|Q92F26|RL1_LISIN 50S ribosomal protein L1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rplA PE=3 SV=1 107 287 3.0E-17
sp|Q73SG1|RL1_MYCPA 50S ribosomal protein L1 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=rplA PE=3 SV=1 65 287 4.0E-17
sp|A0QL66|RL1_MYCA1 50S ribosomal protein L1 OS=Mycobacterium avium (strain 104) GN=rplA PE=3 SV=1 65 287 4.0E-17
sp|A0M3Z2|RL1_GRAFK 50S ribosomal protein L1 OS=Gramella forsetii (strain KT0803) GN=rplA PE=3 SV=1 51 287 4.0E-17
sp|A0T0C1|RK1_PHATC 50S ribosomal protein L1, chloroplastic OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=rpl1 PE=3 SV=1 124 286 5.0E-17
sp|Q0I6K8|RL1_SYNS3 50S ribosomal protein L1 OS=Synechococcus sp. (strain CC9311) GN=rplA PE=3 SV=1 94 287 5.0E-17
sp|Q1Q8P6|RL1_PSYCK 50S ribosomal protein L1 OS=Psychrobacter cryohalolentis (strain K5) GN=rplA PE=3 SV=1 68 287 5.0E-17
sp|B2V7M3|RL1_SULSY 50S ribosomal protein L1 OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=rplA PE=3 SV=1 66 287 5.0E-17
sp|B0RIR8|RL1_CLAMS 50S ribosomal protein L1 OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=rplA PE=3 SV=1 65 286 5.0E-17
sp|A4VW08|RL1_STRSY 50S ribosomal protein L1 OS=Streptococcus suis (strain 05ZYH33) GN=rplA PE=3 SV=1 65 287 5.0E-17
sp|Q8YAA4|RL1_LISMO 50S ribosomal protein L1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rplA PE=3 SV=1 107 287 5.0E-17
sp|C3KVR2|RL1_CLOB6 50S ribosomal protein L1 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=rplA PE=3 SV=1 123 287 5.0E-17
sp|B0UUZ5|RL1_HISS2 50S ribosomal protein L1 OS=Histophilus somni (strain 2336) GN=rplA PE=3 SV=1 123 286 6.0E-17
sp|A2BUI0|RL1_PROM5 50S ribosomal protein L1 OS=Prochlorococcus marinus (strain MIT 9515) GN=rplA PE=3 SV=1 123 247 6.0E-17
sp|Q830Q6|RL1_ENTFA 50S ribosomal protein L1 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rplA PE=3 SV=1 68 287 6.0E-17
sp|A6TWJ3|RL1_ALKMQ 50S ribosomal protein L1 OS=Alkaliphilus metalliredigens (strain QYMF) GN=rplA PE=3 SV=1 123 287 6.0E-17
sp|A4SUV1|RL1_POLSQ 50S ribosomal protein L1 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=rplA PE=3 SV=1 105 287 6.0E-17
sp|Q7V382|RL1_PROMP 50S ribosomal protein L1 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=rplA PE=3 SV=1 94 287 7.0E-17
sp|Q0I0V1|RL1_HAES1 50S ribosomal protein L1 OS=Haemophilus somnus (strain 129Pt) GN=rplA PE=3 SV=1 123 286 7.0E-17
sp|Q7MX30|RL1_PORGI 50S ribosomal protein L1 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=rplA PE=3 SV=1 107 287 7.0E-17
sp|B2RL48|RL1_PORG3 50S ribosomal protein L1 OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=rplA PE=3 SV=1 107 287 7.0E-17
sp|Q9KGE5|RL1_BACHD 50S ribosomal protein L1 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rplA PE=3 SV=1 72 287 8.0E-17
sp|A9NEL3|RL1_ACHLI 50S ribosomal protein L1 OS=Acholeplasma laidlawii (strain PG-8A) GN=rplA PE=3 SV=1 68 288 8.0E-17
sp|Q5E234|RL1_VIBF1 50S ribosomal protein L1 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rplA PE=3 SV=2 121 287 8.0E-17
sp|Q2GJ65|RL1_ANAPZ 50S ribosomal protein L1 OS=Anaplasma phagocytophilum (strain HZ) GN=rplA PE=3 SV=1 102 287 8.0E-17
sp|Q7V478|RL1_PROMM 50S ribosomal protein L1 OS=Prochlorococcus marinus (strain MIT 9313) GN=rplA PE=3 SV=1 94 287 1.0E-16
sp|Q4FQH0|RL1_PSYA2 50S ribosomal protein L1 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rplA PE=3 SV=1 68 287 1.0E-16
sp|Q5NID5|RL1_FRATT 50S ribosomal protein L1 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rplA PE=3 SV=1 123 289 1.0E-16
sp|A0Q870|RL1_FRATN 50S ribosomal protein L1 OS=Francisella tularensis subsp. novicida (strain U112) GN=rplA PE=3 SV=1 123 289 1.0E-16
sp|B2SFD3|RL1_FRATM 50S ribosomal protein L1 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rplA PE=3 SV=1 123 289 1.0E-16
sp|A7NEC3|RL1_FRATF 50S ribosomal protein L1 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rplA PE=3 SV=1 123 289 1.0E-16
sp|Q14JT8|RL1_FRAT1 50S ribosomal protein L1 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rplA PE=3 SV=1 123 289 1.0E-16
sp|A4W2B6|RL1_STRS2 50S ribosomal protein L1 OS=Streptococcus suis (strain 98HAH33) GN=rplA PE=3 SV=1 65 287 1.0E-16
sp|P57149|RL1_BUCAI 50S ribosomal protein L1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rplA PE=3 SV=1 123 287 1.0E-16
sp|B5FC91|RL1_VIBFM 50S ribosomal protein L1 OS=Vibrio fischeri (strain MJ11) GN=rplA PE=3 SV=1 123 287 1.0E-16
sp|Q6YQW6|RL1_ONYPE 50S ribosomal protein L1 OS=Onion yellows phytoplasma (strain OY-M) GN=rplA PE=3 SV=2 68 287 1.0E-16
sp|Q0BKC1|RL1_FRATO 50S ribosomal protein L1 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rplA PE=3 SV=1 123 289 1.0E-16
sp|P48125|RK1_CYAPA 50S ribosomal protein L1, cyanelle OS=Cyanophora paradoxa GN=rpl1 PE=3 SV=1 54 247 1.0E-16
sp|B8D6V3|RL1_BUCAT 50S ribosomal protein L1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=rplA PE=3 SV=1 123 287 1.0E-16
sp|B8D8J9|RL1_BUCA5 50S ribosomal protein L1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=rplA PE=3 SV=1 123 287 1.0E-16
sp|B0TX07|RL1_FRAP2 50S ribosomal protein L1 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=rplA PE=3 SV=1 123 289 1.0E-16
sp|Q2A1M4|RL1_FRATH 50S ribosomal protein L1 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rplA PE=3 SV=1 123 289 1.0E-16
sp|A5CUT3|RL1_CLAM3 50S ribosomal protein L1 OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=rplA PE=3 SV=1 65 286 2.0E-16
sp|B0TC44|RL1_HELMI 50S ribosomal protein L1 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rplA PE=3 SV=1 107 287 2.0E-16
sp|B1XJH1|RL1_SYNP2 50S ribosomal protein L1 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=rplA PE=3 SV=1 94 287 2.0E-16
sp|A2CDE8|RL1_PROM3 50S ribosomal protein L1 OS=Prochlorococcus marinus (strain MIT 9303) GN=rplA PE=3 SV=2 94 287 2.0E-16
sp|A4IW96|RL1_FRATW 50S ribosomal protein L1 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rplA PE=3 SV=1 123 289 2.0E-16
sp|A5CW28|RL1_VESOH 50S ribosomal protein L1 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=rplA PE=3 SV=1 71 286 2.0E-16
sp|Q65PB9|RL1_BACLD 50S ribosomal protein L1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rplA PE=3 SV=1 74 287 2.0E-16
sp|A1BD20|RL1_CHLPD 50S ribosomal protein L1 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=rplA PE=3 SV=1 143 286 2.0E-16
sp|A6X0A6|RL1_OCHA4 50S ribosomal protein L1 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rplA PE=3 SV=1 72 287 2.0E-16
sp|Q6LLV9|RL1_PHOPR 50S ribosomal protein L1 OS=Photobacterium profundum GN=rplA PE=3 SV=1 123 287 2.0E-16
sp|Q31QK4|RL1_SYNE7 50S ribosomal protein L1 OS=Synechococcus elongatus (strain PCC 7942) GN=rplA PE=3 SV=1 94 287 2.0E-16
sp|O84320|RL1_CHLTR 50S ribosomal protein L1 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rplA PE=3 SV=1 68 287 3.0E-16
sp|Q3KM44|RL1_CHLTA 50S ribosomal protein L1 OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=rplA PE=3 SV=1 68 287 3.0E-16
sp|Q8YHQ0|RL1_BRUME 50S ribosomal protein L1 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rplA PE=3 SV=1 72 287 3.0E-16
sp|B5ELW9|RL1_ACIF5 50S ribosomal protein L1 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rplA PE=3 SV=1 105 287 3.0E-16
sp|B7J456|RL1_ACIF2 50S ribosomal protein L1 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rplA PE=3 SV=1 105 287 3.0E-16
sp|B9KHV8|RL1_ANAMF 50S ribosomal protein L1 OS=Anaplasma marginale (strain Florida) GN=rplA PE=3 SV=1 61 287 3.0E-16
sp|B0CH44|RL1_BRUSI 50S ribosomal protein L1 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rplA PE=3 SV=1 72 287 3.0E-16
sp|Q5N3N8|RL1_SYNP6 50S ribosomal protein L1 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rplA PE=3 SV=1 94 287 3.0E-16
sp|Q8G066|RL1_BRUSU 50S ribosomal protein L1 OS=Brucella suis biovar 1 (strain 1330) GN=rplA PE=3 SV=1 72 287 3.0E-16
sp|A5VR18|RL1_BRUO2 50S ribosomal protein L1 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rplA PE=3 SV=1 72 287 3.0E-16
sp|C0RJL4|RL1_BRUMB 50S ribosomal protein L1 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rplA PE=3 SV=1 72 287 3.0E-16
sp|A9M5R3|RL1_BRUC2 50S ribosomal protein L1 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rplA PE=3 SV=1 72 287 3.0E-16
sp|Q57CP5|RL1_BRUAB 50S ribosomal protein L1 OS=Brucella abortus biovar 1 (strain 9-941) GN=rplA PE=3 SV=1 72 287 3.0E-16
sp|Q2YM12|RL1_BRUA2 50S ribosomal protein L1 OS=Brucella abortus (strain 2308) GN=rplA PE=3 SV=1 72 287 3.0E-16
sp|B2S690|RL1_BRUA1 50S ribosomal protein L1 OS=Brucella abortus (strain S19) GN=rplA PE=3 SV=1 72 287 3.0E-16
sp|B0K5G5|RL1_THEPX 50S ribosomal protein L1 OS=Thermoanaerobacter sp. (strain X514) GN=rplA PE=3 SV=1 107 287 3.0E-16
sp|Q2S1Q2|RL1_SALRD 50S ribosomal protein L1 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=rplA PE=3 SV=1 107 287 3.0E-16
sp|P49544|RK1_ODOSI 50S ribosomal protein L1, chloroplastic OS=Odontella sinensis GN=rpl1 PE=3 SV=1 72 247 3.0E-16
sp|Q8RHI3|RL1_FUSNN 50S ribosomal protein L1 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=rplA PE=3 SV=1 123 287 3.0E-16
sp|A8M542|RL1_SALAI 50S ribosomal protein L1 OS=Salinispora arenicola (strain CNS-205) GN=rplA PE=3 SV=1 107 287 3.0E-16
sp|B0KCI9|RL1_THEP3 50S ribosomal protein L1 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rplA PE=3 SV=1 107 287 3.0E-16
sp|Q5PBG7|RL1_ANAMM 50S ribosomal protein L1 OS=Anaplasma marginale (strain St. Maries) GN=rplA PE=3 SV=1 61 287 3.0E-16
sp|A5FIJ0|RL1_FLAJ1 50S ribosomal protein L1 OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=rplA PE=3 SV=1 51 287 4.0E-16
sp|Q7UI03|RL1_RHOBA 50S ribosomal protein L1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=rplA PE=3 SV=1 60 287 4.0E-16
sp|Q03ST8|RL1_LACBA 50S ribosomal protein L1 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rplA PE=3 SV=1 51 287 4.0E-16
sp|Q2S902|RL1_HAHCH 50S ribosomal protein L1 OS=Hahella chejuensis (strain KCTC 2396) GN=rplA PE=3 SV=1 68 287 4.0E-16
sp|A5EX73|RL1_DICNV 50S ribosomal protein L1 OS=Dichelobacter nodosus (strain VCS1703A) GN=rplA PE=3 SV=1 123 287 4.0E-16
sp|P44342|RL1_HAEIN 50S ribosomal protein L1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rplA PE=3 SV=2 121 287 4.0E-16
sp|A5UH21|RL1_HAEIG 50S ribosomal protein L1 OS=Haemophilus influenzae (strain PittGG) GN=rplA PE=3 SV=1 121 287 4.0E-16
sp|Q4QN32|RL1_HAEI8 50S ribosomal protein L1 OS=Haemophilus influenzae (strain 86-028NP) GN=rplA PE=3 SV=1 121 287 4.0E-16
sp|A5ELP1|RL1_BRASB 50S ribosomal protein L1 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rplA PE=3 SV=1 72 286 4.0E-16
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|005160
MLSLLSRSCHCRTRTRDTLLHIRSFSFTYPTWGKHDKKSTIRIPSKKAAAAKARRKAVIAAAEDAKAEKMTLAKA
ISVLQAVEVASPKNTYELFIKTEIKSGIAVPKGRVNLPREAKPSSEEKILVFAEGRQAEEARKAGAHIIGGTELV
DGIVNGRVQATTILCTPALIKAITPKLGRILGPLGLMPSERRGTVTDDIAGYLQRIQGTSEWRADKAGNIRTPIA
LLHFPVEDVVQNIRHFLASVKKVTGNTRDAEARRMKGSGPRPVTTISKVMLSSTQGPGIRISDF*
Coding >Agabi119p4|005160
ATGCTGAGTCTTCTGTCGCGCTCTTGCCATTGTCGGACTCGCACAAGGGATACTCTTTTGCATATTCGCTCTTTC
TCCTTCACTTACCCGACTTGGGGCAAGCATGACAAGAAGTCTACCATCCGTATCCCCTCGAAGAAAGCCGCAGCA
GCAAAAGCCAGACGAAAAGCGGTTATTGCCGCTGCAGAAGATGCCAAGGCAGAGAAAATGACGCTCGCGAAAGCA
ATTTCTGTATTACAGGCAGTCGAGGTAGCCTCACCGAAGAATACTTACGAATTATTCATCAAAACAGAAATCAAG
TCCGGTATCGCTGTGCCCAAAGGACGAGTCAACCTGCCTCGCGAAGCGAAACCTTCATCCGAGGAAAAGATACTC
GTTTTTGCTGAAGGGAGACAAGCTGAGGAAGCCAGGAAGGCAGGTGCACACATCATCGGTGGAACGGAATTGGTC
GACGGAATTGTCAATGGCCGCGTTCAGGCAACAACAATTCTGTGTACACCTGCCCTCATTAAAGCCATCACACCA
AAATTAGGACGTATATTAGGTCCTCTCGGTCTCATGCCATCCGAGAGGAGAGGTACAGTCACAGATGATATAGCC
GGTTATTTACAACGTATCCAGGGGACTAGTGAATGGAGAGCGGATAAGGCTGGCAATATCCGAACTCCCATTGCT
CTGCTACATTTCCCTGTTGAAGATGTTGTGCAAAATATTCGCCATTTTCTTGCGTCTGTTAAGAAGGTTACCGGG
AATACAAGAGACGCCGAGGCTAGAAGAATGAAAGGTTCCGGACCTCGACCTGTGACAACTATCAGCAAGGTTATG
CTGAGCTCAACTCAAGGTCCTGGAATTCGTATATCAGATTTCTAG
Transcript >Agabi119p4|005160
ATGCTGAGTCTTCTGTCGCGCTCTTGCCATTGTCGGACTCGCACAAGGGATACTCTTTTGCATATTCGCTCTTTC
TCCTTCACTTACCCGACTTGGGGCAAGCATGACAAGAAGTCTACCATCCGTATCCCCTCGAAGAAAGCCGCAGCA
GCAAAAGCCAGACGAAAAGCGGTTATTGCCGCTGCAGAAGATGCCAAGGCAGAGAAAATGACGCTCGCGAAAGCA
ATTTCTGTATTACAGGCAGTCGAGGTAGCCTCACCGAAGAATACTTACGAATTATTCATCAAAACAGAAATCAAG
TCCGGTATCGCTGTGCCCAAAGGACGAGTCAACCTGCCTCGCGAAGCGAAACCTTCATCCGAGGAAAAGATACTC
GTTTTTGCTGAAGGGAGACAAGCTGAGGAAGCCAGGAAGGCAGGTGCACACATCATCGGTGGAACGGAATTGGTC
GACGGAATTGTCAATGGCCGCGTTCAGGCAACAACAATTCTGTGTACACCTGCCCTCATTAAAGCCATCACACCA
AAATTAGGACGTATATTAGGTCCTCTCGGTCTCATGCCATCCGAGAGGAGAGGTACAGTCACAGATGATATAGCC
GGTTATTTACAACGTATCCAGGGGACTAGTGAATGGAGAGCGGATAAGGCTGGCAATATCCGAACTCCCATTGCT
CTGCTACATTTCCCTGTTGAAGATGTTGTGCAAAATATTCGCCATTTTCTTGCGTCTGTTAAGAAGGTTACCGGG
AATACAAGAGACGCCGAGGCTAGAAGAATGAAAGGTTCCGGACCTCGACCTGTGACAACTATCAGCAAGGTTATG
CTGAGCTCAACTCAAGGTCCTGGAATTCGTATATCAGATTTCTAG
Gene >Agabi119p4|005160
ATGCTGAGTCTTCTGTCGCGCTCTTGCCATTGTCGGACTCGCACAAGGGTGAGTTATTAATATTCTTACAATCGC
TCTGGCAGAACAGTCGCATAGGATACTCTTTTGCATATTCGCTCTTTCTCCTTCACTTACCCGACTTGGGGCAAG
CATGACAAGAAGTCTACCATCCGTATCCCCTCGAAGAAAGCCGCAGCAGCAAAAGCCAGACGAAAAGCGGTTATT
GCCGCTGCAGAAGATGCCAAGGCAGAGAAAATGACGCTCGCGAAAGCAATTTCTGTATTACAGGTATGAATTCCC
CCTCCTCATCCAGAAGCCGAGTTGACGAGTTGATGCAGGCAGTCGAGGTAGCCTCACCGAAGAATACTTACGAAT
TATTCATCAAAACAGAAATCAAGTCCGGTATCGCTGTGCCCAAAGGACGAGTCAACCTGCCTCGCGAAGCGAAAC
CTTCATCCGAGGAAAAGATACTCGTTTTTGCTGAAGGGAGACAAGCTGAGGAAGCCAGGAAGGCAGGTGCACACA
TCATCGGTGGAACGGAATTGGTCGACGGAGTGAGTGGTGGTTTATCATGTCAAAGGTTCTCGTGGACTTATTGCC
TCATTGTAGATTGTCAATGGCCGCGTTCAGGCAACAACAATTCTGTGTACACCTGCCCTCATTAAAGCCATCACA
CCAAAATTAGGACGTATATTAGGTCCTCTCGGTCTCATGCCATCCGAGAGGAGAGGTACAGTCACAGATGATATA
GCCGGTTATTTACAACGTATCCAGGGGACTAGTGAATGGAGAGCGGATAAGGCTGGCAATATCCGAACTCCCATT
GCTCTGGTACGCTTGCACCCAATACGAACATCGGTTATCACATTTCTCAGTTTTACTTTATAAAGCTACATTTCC
CTGTTGAAGATGTTGTGCAAAATATTCGCCATTTTCTTGCGTCTGTTAAGAAGGTTACCGGGAATACAAGAGACG
CCGAGGCTAGAAGAATGAAAGGTTCCGGACCTCGACCTGGTATTTATCCACTAGAATAATCAATGAAAGGAATTT
CTGACAAACTTTTCAGTGACAACTATCAGCAAGGTTATGCTGAGCTCAACTCAAGGTCCTGGAATTCGTATATCA
GATTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail