Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|004290
Gene name
Locationscaffold_01a:1094362..1096023
Strand-
Gene length (bp)1661
Transcript length (bp)1260
Coding sequence length (bp)1260
Protein length (aa) 420

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 1.6E-10 235 283
PF12678 zf-rbx1 RING-H2 zinc finger domain 8.6E-10 235 283
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 2.2E-08 236 282
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 3.5E-07 236 282
PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger 3.4E-05 236 286

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9D0C1|RN115_MOUSE E3 ubiquitin-protein ligase RNF115 OS=Mus musculus GN=Rnf115 PE=1 SV=1 8 307 1.0E-20
sp|Q9BV68|RN126_HUMAN E3 ubiquitin-protein ligase RNF126 OS=Homo sapiens GN=RNF126 PE=1 SV=1 8 298 3.0E-20
sp|Q6DIP3|RN126_XENTR E3 ubiquitin-protein ligase RNF126 OS=Xenopus tropicalis GN=rnf126 PE=2 SV=1 8 298 1.0E-19
sp|Q7T0Q3|R126A_XENLA E3 ubiquitin-protein ligase RNF126-A OS=Xenopus laevis GN=rnf126-a PE=2 SV=1 4 298 1.0E-18
sp|Q9Y4L5|RN115_HUMAN E3 ubiquitin-protein ligase RNF115 OS=Homo sapiens GN=RNF115 PE=1 SV=2 8 307 3.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9D0C1|RN115_MOUSE E3 ubiquitin-protein ligase RNF115 OS=Mus musculus GN=Rnf115 PE=1 SV=1 8 307 1.0E-20
sp|Q9BV68|RN126_HUMAN E3 ubiquitin-protein ligase RNF126 OS=Homo sapiens GN=RNF126 PE=1 SV=1 8 298 3.0E-20
sp|Q6DIP3|RN126_XENTR E3 ubiquitin-protein ligase RNF126 OS=Xenopus tropicalis GN=rnf126 PE=2 SV=1 8 298 1.0E-19
sp|Q7T0Q3|R126A_XENLA E3 ubiquitin-protein ligase RNF126-A OS=Xenopus laevis GN=rnf126-a PE=2 SV=1 4 298 1.0E-18
sp|Q9Y4L5|RN115_HUMAN E3 ubiquitin-protein ligase RNF115 OS=Homo sapiens GN=RNF115 PE=1 SV=2 8 307 3.0E-18
sp|Q6IRP0|R126B_XENLA E3 ubiquitin-protein ligase RNF126-B OS=Xenopus laevis GN=rnf126-b PE=2 SV=1 8 298 4.0E-18
sp|Q9C1X4|YKW3_SCHPO Uncharacterized RING finger protein P32A8.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP32A8.03c PE=3 SV=1 180 350 1.0E-17
sp|Q8LPN7|RNG1L_ARATH E3 ubiquitin-protein ligase RING1-like OS=Arabidopsis thaliana GN=At3g19950 PE=1 SV=1 7 286 4.0E-17
sp|Q91YL2|RN126_MOUSE E3 ubiquitin-protein ligase RNF126 OS=Mus musculus GN=Rnf126 PE=1 SV=1 185 298 2.0E-16
sp|Q0II22|RN126_BOVIN E3 ubiquitin-protein ligase RNF126 OS=Bos taurus GN=RNF126 PE=2 SV=1 185 298 2.0E-16
sp|P0CH30|RING1_GOSHI E3 ubiquitin-protein ligase RING1 OS=Gossypium hirsutum GN=RING1 PE=1 SV=1 182 286 9.0E-14
sp|Q8RXD3|AIP2_ARATH E3 ubiquitin-protein ligase AIP2 OS=Arabidopsis thaliana GN=AIP2 PE=1 SV=1 191 286 1.0E-12
sp|Q9CY62|RN181_MOUSE E3 ubiquitin-protein ligase RNF181 OS=Mus musculus GN=Rnf181 PE=1 SV=1 209 286 3.0E-10
sp|Q9VE61|RN181_DROME E3 ubiquitin-protein ligase RNF181 homolog OS=Drosophila melanogaster GN=CG7694 PE=2 SV=1 197 286 4.0E-10
sp|Q6GPV5|RN181_XENLA E3 ubiquitin-protein ligase RNF181 OS=Xenopus laevis GN=rnf181 PE=2 SV=1 209 286 6.0E-10
sp|Q5M974|RN181_XENTR E3 ubiquitin-protein ligase RNF181 OS=Xenopus tropicalis GN=rnf181 PE=2 SV=1 209 286 1.0E-09
sp|Q7ZW78|RN181_DANRE E3 ubiquitin-protein ligase RNF181 OS=Danio rerio GN=rnf181 PE=2 SV=2 188 286 1.0E-09
sp|Q80U04|PJA2_MOUSE E3 ubiquitin-protein ligase Praja-2 OS=Mus musculus GN=Pja2 PE=1 SV=2 211 311 2.0E-09
sp|Q5R4R1|PJA2_PONAB E3 ubiquitin-protein ligase Praja-2 OS=Pongo abelii GN=PJA2 PE=2 SV=1 211 311 3.0E-09
sp|Q9C7I1|ATL34_ARATH RING-H2 finger protein ATL34 OS=Arabidopsis thaliana GN=ATL34 PE=2 SV=1 235 411 3.0E-09
sp|O43164|PJA2_HUMAN E3 ubiquitin-protein ligase Praja-2 OS=Homo sapiens GN=PJA2 PE=1 SV=4 211 311 3.0E-09
sp|O55176|PJA1_MOUSE E3 ubiquitin-protein ligase Praja-1 OS=Mus musculus GN=Pja1 PE=1 SV=3 211 283 6.0E-09
sp|Q9M2S6|SDIR1_ARATH E3 ubiquitin-protein ligase SDIR1 OS=Arabidopsis thaliana GN=SDIR1 PE=1 SV=1 236 284 6.0E-09
sp|Q8NG27|PJA1_HUMAN E3 ubiquitin-protein ligase Praja-1 OS=Homo sapiens GN=PJA1 PE=1 SV=2 211 283 6.0E-09
sp|Q84W40|ATL11_ARATH RING-H2 finger protein ATL11 OS=Arabidopsis thaliana GN=ATL11 PE=2 SV=2 235 419 9.0E-09
sp|Q63364|PJA2_RAT E3 ubiquitin-protein ligase Praja-2 OS=Rattus norvegicus GN=Pja2 PE=2 SV=1 211 283 1.0E-08
sp|Q8NC42|RN149_HUMAN E3 ubiquitin-protein ligase RNF149 OS=Homo sapiens GN=RNF149 PE=2 SV=2 234 297 3.0E-08
sp|Q3U2C5|RN149_MOUSE E3 ubiquitin-protein ligase RNF149 OS=Mus musculus GN=Rnf149 PE=1 SV=3 213 301 3.0E-08
sp|Q5SSZ7|ZNRF3_MOUSE E3 ubiquitin-protein ligase ZNRF3 OS=Mus musculus GN=Znrf3 PE=1 SV=1 189 293 3.0E-08
sp|Q6AXU4|RN181_RAT E3 ubiquitin-protein ligase RNF181 OS=Rattus norvegicus GN=Rnf181 PE=1 SV=1 209 286 4.0E-08
sp|Q9P0P0|RN181_HUMAN E3 ubiquitin-protein ligase RNF181 OS=Homo sapiens GN=RNF181 PE=1 SV=1 209 286 5.0E-08
sp|Q07G42|RNF12_XENTR E3 ubiquitin-protein ligase RNF12 OS=Xenopus tropicalis GN=rnf12 PE=2 SV=1 61 287 7.0E-08
sp|Q570X5|ATL58_ARATH RING-H2 finger protein ATL58 OS=Arabidopsis thaliana GN=ATL58 PE=2 SV=1 213 327 8.0E-08
sp|Q6NRX0|RN149_XENLA E3 ubiquitin-protein ligase RNF149 OS=Xenopus laevis GN=rnf149 PE=2 SV=1 234 321 8.0E-08
sp|Q84TF5|RHA4A_ARATH RING-H2 zinc finger protein RHA4a OS=Arabidopsis thaliana GN=RHA4A PE=2 SV=1 223 309 8.0E-08
sp|Q4KLR8|ZNRF3_XENLA E3 ubiquitin-protein ligase ZNRF3 OS=Xenopus laevis GN=znrf3 PE=2 SV=1 189 289 9.0E-08
sp|Q9NVW2|RNF12_HUMAN E3 ubiquitin-protein ligase RLIM OS=Homo sapiens GN=RLIM PE=1 SV=3 200 287 1.0E-07
sp|Q9SK92|ATL15_ARATH E3 ubiquitin-protein ligase ATL15 OS=Arabidopsis thaliana GN=ATL15 PE=1 SV=1 235 324 1.0E-07
sp|Q9SN28|ATL7_ARATH RING-H2 finger protein ATL7 OS=Arabidopsis thaliana GN=ATL7 PE=2 SV=1 213 308 1.0E-07
sp|Q8GYT9|SIS3_ARATH E3 ubiquitin-protein ligase SIS3 OS=Arabidopsis thaliana GN=SIS3 PE=2 SV=2 175 325 1.0E-07
sp|Q9SPL2|CIP8_ARATH E3 ubiquitin-protein ligase CIP8 OS=Arabidopsis thaliana GN=CIP8 PE=1 SV=1 211 286 2.0E-07
sp|Q9WTV7|RNF12_MOUSE E3 ubiquitin-protein ligase RLIM OS=Mus musculus GN=Rlim PE=1 SV=2 200 287 2.0E-07
sp|Q7L0R7|RNF44_HUMAN RING finger protein 44 OS=Homo sapiens GN=RNF44 PE=2 SV=1 153 283 2.0E-07
sp|Q641J8|RF12A_XENLA E3 ubiquitin-protein ligase RNF12-A OS=Xenopus laevis GN=rnf12-a PE=1 SV=1 200 287 3.0E-07
sp|Q8GXF8|SHGR9_ARATH E3 ubiquitin-protein ligase SGR9, amyloplastic OS=Arabidopsis thaliana GN=SGR9 PE=1 SV=1 235 286 3.0E-07
sp|Q9M0R5|ATL36_ARATH Putative RING-H2 finger protein ATL36 OS=Arabidopsis thaliana GN=ATL36 PE=3 SV=1 235 337 4.0E-07
sp|Q3UHJ8|RNF44_MOUSE RING finger protein 44 OS=Mus musculus GN=Rnf44 PE=2 SV=1 153 283 5.0E-07
sp|Q5SPX3|RN215_MOUSE RING finger protein 215 OS=Mus musculus GN=Rnf215 PE=2 SV=1 233 287 5.0E-07
sp|Q9ULT6|ZNRF3_HUMAN E3 ubiquitin-protein ligase ZNRF3 OS=Homo sapiens GN=ZNRF3 PE=1 SV=3 236 295 5.0E-07
sp|Q6Y290|GOLI_RAT E3 ubiquitin-protein ligase RNF130 OS=Rattus norvegicus GN=Rnf130 PE=1 SV=1 236 291 6.0E-07
sp|Q8VEM1|GOLI_MOUSE E3 ubiquitin-protein ligase RNF130 OS=Mus musculus GN=Rnf130 PE=2 SV=1 236 291 6.0E-07
sp|P30631|YOUD_CAEEL Uncharacterized RING finger protein ZK637.14 OS=Caenorhabditis elegans GN=ZK637.14 PE=3 SV=2 236 283 7.0E-07
sp|Q8GUU2|RIE1_ARATH E3 ubiquitin protein ligase RIE1 OS=Arabidopsis thaliana GN=RIE1 PE=2 SV=1 235 288 7.0E-07
sp|Q0VD51|RNF13_BOVIN E3 ubiquitin-protein ligase RNF13 OS=Bos taurus GN=RNF13 PE=2 SV=1 236 291 7.0E-07
sp|Q6AY01|RN133_RAT E3 ubiquitin-protein ligase RNF133 OS=Rattus norvegicus GN=Rnf133 PE=2 SV=1 236 340 7.0E-07
sp|Q90972|RNF13_CHICK E3 ubiquitin-protein ligase RNF13 OS=Gallus gallus GN=RNF13 PE=1 SV=1 236 311 7.0E-07
sp|Q86XS8|GOLI_HUMAN E3 ubiquitin-protein ligase RNF130 OS=Homo sapiens GN=RNF130 PE=1 SV=1 236 291 8.0E-07
sp|Q5RCV8|RNF13_PONAB E3 ubiquitin-protein ligase RNF13 OS=Pongo abelii GN=RNF13 PE=2 SV=1 236 291 8.0E-07
sp|O43567|RNF13_HUMAN E3 ubiquitin-protein ligase RNF13 OS=Homo sapiens GN=RNF13 PE=1 SV=1 236 291 8.0E-07
sp|Q7T037|RF12B_XENLA E3 ubiquitin-protein ligase RNF12-B OS=Xenopus laevis GN=rnf12-b PE=2 SV=1 200 287 8.0E-07
sp|Q4V7B8|RNF44_RAT RING finger protein 44 OS=Rattus norvegicus GN=Rnf44 PE=2 SV=1 153 283 1.0E-06
sp|Q9LY41|ATL4_ARATH E3 ubiquitin-protein ligase ATL4 OS=Arabidopsis thaliana GN=ATL4 PE=1 SV=1 207 283 1.0E-06
sp|Q67YI6|ATL65_ARATH RING-H2 finger protein ATL65 OS=Arabidopsis thaliana GN=ATL65 PE=2 SV=2 234 294 1.0E-06
sp|Q3T0W3|RN181_BOVIN E3 ubiquitin-protein ligase RNF181 OS=Bos taurus GN=RNF181 PE=2 SV=1 209 286 1.0E-06
sp|Q9LX93|ATL55_ARATH E3 ubiquitin-protein ligase RING1 OS=Arabidopsis thaliana GN=ATL55 PE=1 SV=1 235 354 1.0E-06
sp|Q8L649|BB_ARATH E3 ubiquitin ligase BIG BROTHER OS=Arabidopsis thaliana GN=BB PE=1 SV=1 213 290 1.0E-06
sp|Q8LF65|ATL17_ARATH RING-H2 finger protein ATL17 OS=Arabidopsis thaliana GN=ATL17 PE=2 SV=2 216 332 1.0E-06
sp|Q8RXX9|ATL6_ARATH E3 ubiquitin-protein ligase ATL6 OS=Arabidopsis thaliana GN=ATL6 PE=1 SV=2 235 301 2.0E-06
sp|Q9FIR0|ATL30_ARATH RING-H2 finger protein ATL30 OS=Arabidopsis thaliana GN=ATL30 PE=2 SV=1 235 338 2.0E-06
sp|Q9Y6U7|RN215_HUMAN RING finger protein 215 OS=Homo sapiens GN=RNF215 PE=3 SV=2 236 284 2.0E-06
sp|Q5EAE9|ATL43_ARATH RING-H2 finger protein ATL43 OS=Arabidopsis thaliana GN=ATL43 PE=2 SV=2 235 289 2.0E-06
sp|O54965|RNF13_MOUSE E3 ubiquitin-protein ligase RNF13 OS=Mus musculus GN=Rnf13 PE=1 SV=2 236 291 3.0E-06
sp|Q66HG0|RNF13_RAT E3 ubiquitin-protein ligase RNF13 OS=Rattus norvegicus GN=Rnf13 PE=2 SV=1 236 291 3.0E-06
sp|Q08D68|ZNRF3_XENTR E3 ubiquitin-protein ligase ZNRF3 OS=Xenopus tropicalis GN=znrf3 PE=1 SV=1 189 289 4.0E-06
sp|Q9FGJ6|ATL79_ARATH RING-H2 finger protein ATL79 OS=Arabidopsis thaliana GN=ATL79 PE=2 SV=1 235 299 4.0E-06
sp|O64762|ATL38_ARATH RING-H2 finger protein ATL38 OS=Arabidopsis thaliana GN=ATL38 PE=2 SV=1 235 299 4.0E-06
sp|Q86Y13|DZIP3_HUMAN E3 ubiquitin-protein ligase DZIP3 OS=Homo sapiens GN=DZIP3 PE=1 SV=2 236 298 5.0E-06
sp|Q9H0F5|RNF38_HUMAN E3 ubiquitin-protein ligase RNF38 OS=Homo sapiens GN=RNF38 PE=1 SV=4 179 283 6.0E-06
sp|Q9SN27|ATL59_ARATH E3 ubiquitin-protein ligase ATL59 OS=Arabidopsis thaliana GN=ATL59 PE=1 SV=1 213 321 6.0E-06
sp|Q08CG8|RNF44_DANRE RING finger protein 44 OS=Danio rerio GN=rnf44 PE=2 SV=1 236 283 6.0E-06
sp|Q8LGA5|ATL31_ARATH E3 ubiquitin-protein ligase ATL31 OS=Arabidopsis thaliana GN=ATL31 PE=1 SV=2 235 308 6.0E-06
sp|F4HZZ4|RMR6_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 6 OS=Arabidopsis thaliana GN=RMR6 PE=3 SV=2 214 313 7.0E-06
sp|Q566M8|RN150_DANRE RING finger protein 150 OS=Danio rerio GN=rnf150 PE=2 SV=1 235 295 7.0E-06
sp|Q5DTZ6|RN150_MOUSE RING finger protein 150 OS=Mus musculus GN=Rnf150 PE=2 SV=2 235 293 7.0E-06
sp|Q9H6Y7|RN167_HUMAN E3 ubiquitin-protein ligase RNF167 OS=Homo sapiens GN=RNF167 PE=1 SV=1 236 348 8.0E-06
sp|Q9ULK6|RN150_HUMAN RING finger protein 150 OS=Homo sapiens GN=RNF150 PE=2 SV=2 235 293 8.0E-06
sp|Q95K04|RN133_MACFA E3 ubiquitin-protein ligase RNF133 OS=Macaca fascicularis GN=RNF133 PE=2 SV=1 236 291 8.0E-06
sp|Q9LF64|ATL52_ARATH RING-H2 finger protein ATL52 OS=Arabidopsis thaliana GN=ATL52 PE=2 SV=1 235 322 8.0E-06
sp|Q8BI21|RNF38_MOUSE E3 ubiquitin-protein ligase RNF38 OS=Mus musculus GN=Rnf38 PE=2 SV=1 236 283 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0061630 ubiquitin protein ligase activity Yes
GO:0046872 metal ion binding Yes
GO:0005680 anaphase-promoting complex Yes
GO:0097602 cullin family protein binding Yes
GO:0008270 zinc ion binding Yes
GO:0031145 anaphase-promoting complex-dependent catabolic process Yes
GO:0005488 binding No
GO:0005515 protein binding No
GO:0044265 cellular macromolecule catabolic process No
GO:0043169 cation binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0019538 protein metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0004842 ubiquitin-protein transferase activity No
GO:0044238 primary metabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:1990234 transferase complex No
GO:0009056 catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process No
GO:0032991 protein-containing complex No
GO:0061659 ubiquitin-like protein ligase activity No
GO:0008152 metabolic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0019941 modification-dependent protein catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0030163 protein catabolic process No
GO:0008150 biological_process No
GO:0046914 transition metal ion binding No
GO:1902494 catalytic complex No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006511 ubiquitin-dependent protein catabolic process No
GO:0043167 ion binding No
GO:0044237 cellular metabolic process No
GO:1901575 organic substance catabolic process No
GO:0000152 nuclear ubiquitin ligase complex No
GO:0006508 proteolysis No
GO:0009057 macromolecule catabolic process No
GO:0044248 cellular catabolic process No
GO:0071704 organic substance metabolic process No
GO:0000151 ubiquitin ligase complex No
GO:0140513 nuclear protein-containing complex No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0010498 proteasomal protein catabolic process No
GO:0019787 ubiquitin-like protein transferase activity No
GO:0031461 cullin-RING ubiquitin ligase complex No
GO:0140535 intracellular protein-containing complex No
GO:0009987 cellular process No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|004290
MSARSPMWFCHQCHAEMRPLMAPDPVCASCRSSFVEKIEDPQDDPRQFAAPAPAPPPGDHDAAGFDNFLIALQTL
LNRGMDPADHPPRQQPPSRMTFQFGNVAGHPRQTTVTFGTSPSPPGAVPSMSEFMRSAPSPFPPEDTHATPQING
HLFSQYLMSLLGQTNHPMMPLFMGGGMPESGRMGDYVFSQDALDQIITQIMDSTNTNRPVPATEEIVERLPQEVL
MADSPLLTKDCAVCKDQFELGTEDPEQQIVITLPCKHPFHKMCILPWLKSSGTCPVCRYALVPQPGQPTSPNPND
TPASSSSSPRPNTNDARPRSQSPPSSPRQSPRSTTSGSVPARSNFASLFGLGGSPRHFPRPSSSFPQTPTARPSS
PNSRPADRTSSSSRSGSRNDQPRNSGDRRPHFPGQWTDDMSDLD*
Coding >Agabi119p4|004290
ATGTCTGCCCGCTCGCCAATGTGGTTCTGCCACCAATGCCACGCTGAAATGCGCCCACTCATGGCCCCAGATCCC
GTCTGCGCTTCCTGTCGCAGCTCCTTTGTCGAAAAGATCGAAGATCCTCAAGACGATCCCCGCCAATTTGCTGCA
CCCGCACCCGCACCGCCTCCCGGTGATCACGATGCCGCTGGTTTCGACAACTTTCTAATTGCTCTGCAGACCCTT
CTCAATCGTGGAATGGACCCCGCTGATCACCCCCCTCGACAACAACCTCCTTCCCGTATGACATTCCAGTTTGGC
AATGTAGCCGGTCACCCTCGACAGACAACAGTCACGTTTGGCACCTCCCCGTCACCCCCAGGTGCCGTACCATCC
ATGTCAGAATTCATGCGTAGTGCTCCCAGCCCTTTCCCCCCAGAGGATACCCACGCCACTCCACAGATCAACGGT
CATCTCTTTTCTCAGTACCTCATGTCTCTCCTTGGACAAACGAATCATCCTATGATGCCTCTCTTCATGGGCGGC
GGTATGCCAGAGAGCGGTAGAATGGGTGACTATGTCTTTAGTCAAGATGCATTAGATCAAATAATCACGCAAATC
ATGGATTCCACTAATACCAACAGGCCCGTTCCCGCAACCGAAGAGATCGTTGAGCGCCTCCCTCAAGAAGTCCTC
ATGGCTGATAGCCCTCTCTTGACCAAGGATTGTGCGGTGTGTAAAGATCAGTTCGAGTTGGGGACAGAAGACCCA
GAGCAACAGATCGTGATTACTCTCCCATGCAAGCATCCGTTCCACAAGATGTGTATTCTTCCTTGGTTAAAGTCT
TCCGGCACGTGTCCTGTATGTCGATACGCGCTTGTCCCACAGCCTGGGCAGCCTACATCGCCAAACCCCAATGAC
ACTCCCGCTTCCTCGTCCTCCTCCCCAAGGCCCAACACCAATGACGCACGCCCAAGATCACAATCACCCCCCAGC
AGTCCACGCCAGTCGCCAAGGTCAACAACATCAGGTTCAGTCCCTGCTCGAAGCAATTTTGCTTCCTTGTTTGGT
TTGGGAGGCAGTCCCAGACACTTCCCTCGTCCCTCAAGTTCCTTTCCGCAAACACCCACAGCACGACCATCGTCA
CCCAACTCCCGACCGGCTGACCGGACGTCCTCGTCCTCTAGGTCTGGCTCGCGCAATGATCAACCACGGAATAGT
GGGGATAGGCGGCCACATTTTCCAGGCCAGTGGACCGATGACATGTCGGATTTAGATTGA
Transcript >Agabi119p4|004290
ATGTCTGCCCGCTCGCCAATGTGGTTCTGCCACCAATGCCACGCTGAAATGCGCCCACTCATGGCCCCAGATCCC
GTCTGCGCTTCCTGTCGCAGCTCCTTTGTCGAAAAGATCGAAGATCCTCAAGACGATCCCCGCCAATTTGCTGCA
CCCGCACCCGCACCGCCTCCCGGTGATCACGATGCCGCTGGTTTCGACAACTTTCTAATTGCTCTGCAGACCCTT
CTCAATCGTGGAATGGACCCCGCTGATCACCCCCCTCGACAACAACCTCCTTCCCGTATGACATTCCAGTTTGGC
AATGTAGCCGGTCACCCTCGACAGACAACAGTCACGTTTGGCACCTCCCCGTCACCCCCAGGTGCCGTACCATCC
ATGTCAGAATTCATGCGTAGTGCTCCCAGCCCTTTCCCCCCAGAGGATACCCACGCCACTCCACAGATCAACGGT
CATCTCTTTTCTCAGTACCTCATGTCTCTCCTTGGACAAACGAATCATCCTATGATGCCTCTCTTCATGGGCGGC
GGTATGCCAGAGAGCGGTAGAATGGGTGACTATGTCTTTAGTCAAGATGCATTAGATCAAATAATCACGCAAATC
ATGGATTCCACTAATACCAACAGGCCCGTTCCCGCAACCGAAGAGATCGTTGAGCGCCTCCCTCAAGAAGTCCTC
ATGGCTGATAGCCCTCTCTTGACCAAGGATTGTGCGGTGTGTAAAGATCAGTTCGAGTTGGGGACAGAAGACCCA
GAGCAACAGATCGTGATTACTCTCCCATGCAAGCATCCGTTCCACAAGATGTGTATTCTTCCTTGGTTAAAGTCT
TCCGGCACGTGTCCTGTATGTCGATACGCGCTTGTCCCACAGCCTGGGCAGCCTACATCGCCAAACCCCAATGAC
ACTCCCGCTTCCTCGTCCTCCTCCCCAAGGCCCAACACCAATGACGCACGCCCAAGATCACAATCACCCCCCAGC
AGTCCACGCCAGTCGCCAAGGTCAACAACATCAGGTTCAGTCCCTGCTCGAAGCAATTTTGCTTCCTTGTTTGGT
TTGGGAGGCAGTCCCAGACACTTCCCTCGTCCCTCAAGTTCCTTTCCGCAAACACCCACAGCACGACCATCGTCA
CCCAACTCCCGACCGGCTGACCGGACGTCCTCGTCCTCTAGGTCTGGCTCGCGCAATGATCAACCACGGAATAGT
GGGGATAGGCGGCCACATTTTCCAGGCCAGTGGACCGATGACATGTCGGATTTAGATTGA
Gene >Agabi119p4|004290
ATGTCTGCCCGCTCGCCAATGTGGTTCTGCCACCAAGTGCGTCGACTCTCTCGTCCCCGTGACTCCCCAGCTCAT
TGCCCCCCAGTGCCACGCTGAAATGCGCCCACTCATGGTCTCTCTCGCCCGCTGATCCTCCCCTGCACTGACTAA
TCAACCCTGCAGGCCCCAGATCCCGTCTGCGCTTCCTGTCGCAGCTCCTTTGTCGAAAAGGTGGCTGCTTTCCTG
CTCTCTCACTCTCGCTTGCCTCACCACCCCACCAGATCGAAGATCCTCAAGACGATCCCCGCCAATTTGCTGCAC
CCGCACCCGCACCGCCTCCCGGTGATCACGATGCCGCTGGTTTCGACAACTTTCTAAGTGTGTTCATTCCAAGCA
TTTCCTTTTTCTGCTACATCTCTCTTTTAGTTGCTCTGCAGACCCTTCTCAATCGTGGAATGGACCCCGCTGATC
ACCCCCCTCGACAACAAGTGAATCTCTGCTGTTCTATCTCGTTTCTCGGCACTCAGACCTTCCTTTCTAGCCTCC
TTCCCGTATGACATTCCAGTTTGGCAATGTAGCCGGTCACCCTCGACAGACAACAGTCACGTTTGGCACCTCCCC
GTCACCCCCAGGTGCCGTACCATCCATGTCAGAGTAGGTCTCGTTTCCCATATCATCCTCCAGCTCCACCGACCT
TGTGCCCCAGATTCATGCGTAGTGCTCCCAGCCCTTTCCCCCCAGAGGATACCCACGCCACTCCACAGATCAACG
GTCATCTCTTTTCTCAGTACCTCATGTCTCTCCTTGGACAAACGAATCATCCTATGATGCCTCTCTTCATGGGCG
GCGGTATGCCAGAGAGCGGTAGAATGGGTGACTATGTCTTTAGTCAAGATGGTATGTATGCCCTGCCTTGACTTT
TCCTTCCGTCCTCATGTCCTGCCCAGCATTAGATCAAATAATCACGCAAATCATGGATTCCACTAATACCAACAG
GCCCGTTCCCGCAACCGAAGAGATCGTTGAGCGCCTCCCTCAAGAAGTCCTCATGGCTGATAGTACGTTCATCTC
TGCTCTCTTTCTCACACACACCCTCATTCCTTCTAGGCCCTCTCTTGACCAAGGATTGTGCGGTGTGTAAAGATC
AGTTCGAGTTGGGGACAGAAGACCCAGAGCAACAGATCGTGATTACTCTCCCATGCAAGCATCCGTTCCACAAGA
TGTGTATTCTTCCTTGGTTAAAGTCTTCCGGCACGTGTCCTGTATGTCGATACGCGCTTGTCCCACAGCCTGGGC
AGCCTACATCGCCAAACCCCAATGACACTCCCGCTTCCTCGTCCTCCTCCCCAAGGCCCAACACCAATGACGCAC
GCCCAAGATCACAATCACCCCCCAGCAGTCCACGCCAGTCGCCAAGGTCAACAACATCAGGTTCAGTCCCTGCTC
GAAGCAATTTTGCTTCCTTGTTTGGTTTGGGAGGCAGTCCCAGACACTTCCCTCGTCCCTCAAGTTCCTTTCCGC
AAACACCCACAGCACGACCATCGTCACCCAACTCCCGACCGGCTGACCGGACGTCCTCGTCCTCTAGGTCTGGCT
CGCGCAATGATCAACCACGGAATAGTGGGGATAGGCGGCCACATTTTCCAGGCCAGTGGACCGATGACATGTCGG
ATTTAGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail