Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|004230
Gene name
Locationscaffold_01a:1078931..1080116
Strand+
Gene length (bp)1185
Transcript length (bp)1071
Coding sequence length (bp)1071
Protein length (aa) 357

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01026 TatD_DNase TatD related DNase 6.0E-26 14 294

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P41890|SCN1_SCHPO Cut9-interacting protein scn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=scn1 PE=4 SV=2 10 301 1.0E-36
sp|P38430|YM8C_YEAST Uncharacterized deoxyribonuclease YMR262W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR262W PE=1 SV=3 10 328 1.0E-17

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|004230
MADLPSDDVLRHVVDVHCHPTDAPQISPEAMDQLQITVCAMASRESDQPLVRNLATSNPSKVIPCFGYHPWFSHF
ITTDPTISKEEHYNRLFLDHAGEPTSEQRDALNVLLGLLPTPRLLVHIQDELRQNLAAFPHAMLGEVGLDRSFHV
PYNFDASPRRLTPFTVPLDHQLVILEAQLDIAIELGRNASIHSVKSQQATIDLLSRLHKKHGDSFYRISIDMHSC
GFSPETWKSIETKYTNVFLSLSMVINQRHSRFKALIDACADDRILVESDYNDINMSTSQTWKMLTIVAEVKKWSI
ETAWPSSLDDRKCGAVRHFERNWERFCRGDHTPSGSRRSAKRRRNDNPNSSASSPS*
Coding >Agabi119p4|004230
ATGGCTGACCTACCATCGGACGATGTACTAAGGCATGTCGTTGATGTCCATTGCCATCCAACCGACGCACCCCAG
ATCTCGCCCGAGGCGATGGATCAGCTGCAGATCACCGTCTGCGCTATGGCGAGCCGTGAATCAGACCAGCCTCTA
GTACGCAACTTGGCGACCAGTAATCCTTCAAAAGTAATACCCTGTTTCGGTTATCACCCATGGTTCTCTCATTTC
ATCACAACAGATCCTACAATATCAAAGGAAGAACATTATAATCGCCTGTTTCTAGACCATGCGGGCGAACCCACT
TCAGAGCAACGAGATGCTTTGAATGTTCTGCTAGGTCTGTTGCCGACTCCACGATTGCTAGTCCATATACAGGAC
GAGCTCCGCCAAAATCTCGCAGCGTTCCCACATGCTATGCTCGGAGAAGTCGGATTAGATCGCTCGTTCCACGTT
CCCTATAATTTCGATGCATCACCTCGCAGACTCACTCCTTTCACCGTTCCCCTTGACCACCAGTTGGTAATACTT
GAAGCACAACTGGACATCGCCATAGAACTCGGTCGCAATGCCAGCATCCACAGTGTCAAATCACAACAAGCTACC
ATTGATCTCTTGAGTCGACTGCACAAGAAGCACGGTGACTCGTTCTACCGCATTAGTATCGACATGCACAGTTGT
GGCTTTAGTCCAGAAACATGGAAATCTATCGAGACCAAATACACTAACGTCTTTCTCTCGCTCTCCATGGTCATT
AACCAGAGACATTCGAGGTTTAAAGCACTTATTGATGCCTGTGCAGACGACCGGATCTTGGTCGAGTCGGATTAT
AACGATATAAATATGAGCACGTCACAAACTTGGAAAATGTTGACAATCGTCGCTGAAGTCAAGAAATGGTCGATC
GAAACAGCCTGGCCTAGCTCTCTGGATGACAGAAAATGTGGTGCTGTGCGGCACTTCGAACGAAATTGGGAGAGG
TTTTGCCGTGGGGATCACACGCCTTCAGGTAGTCGGCGATCAGCTAAACGCAGACGAAATGACAACCCAAATTCA
AGTGCCTCCTCTCCGTCATGA
Transcript >Agabi119p4|004230
ATGGCTGACCTACCATCGGACGATGTACTAAGGCATGTCGTTGATGTCCATTGCCATCCAACCGACGCACCCCAG
ATCTCGCCCGAGGCGATGGATCAGCTGCAGATCACCGTCTGCGCTATGGCGAGCCGTGAATCAGACCAGCCTCTA
GTACGCAACTTGGCGACCAGTAATCCTTCAAAAGTAATACCCTGTTTCGGTTATCACCCATGGTTCTCTCATTTC
ATCACAACAGATCCTACAATATCAAAGGAAGAACATTATAATCGCCTGTTTCTAGACCATGCGGGCGAACCCACT
TCAGAGCAACGAGATGCTTTGAATGTTCTGCTAGGTCTGTTGCCGACTCCACGATTGCTAGTCCATATACAGGAC
GAGCTCCGCCAAAATCTCGCAGCGTTCCCACATGCTATGCTCGGAGAAGTCGGATTAGATCGCTCGTTCCACGTT
CCCTATAATTTCGATGCATCACCTCGCAGACTCACTCCTTTCACCGTTCCCCTTGACCACCAGTTGGTAATACTT
GAAGCACAACTGGACATCGCCATAGAACTCGGTCGCAATGCCAGCATCCACAGTGTCAAATCACAACAAGCTACC
ATTGATCTCTTGAGTCGACTGCACAAGAAGCACGGTGACTCGTTCTACCGCATTAGTATCGACATGCACAGTTGT
GGCTTTAGTCCAGAAACATGGAAATCTATCGAGACCAAATACACTAACGTCTTTCTCTCGCTCTCCATGGTCATT
AACCAGAGACATTCGAGGTTTAAAGCACTTATTGATGCCTGTGCAGACGACCGGATCTTGGTCGAGTCGGATTAT
AACGATATAAATATGAGCACGTCACAAACTTGGAAAATGTTGACAATCGTCGCTGAAGTCAAGAAATGGTCGATC
GAAACAGCCTGGCCTAGCTCTCTGGATGACAGAAAATGTGGTGCTGTGCGGCACTTCGAACGAAATTGGGAGAGG
TTTTGCCGTGGGGATCACACGCCTTCAGGTAGTCGGCGATCAGCTAAACGCAGACGAAATGACAACCCAAATTCA
AGTGCCTCCTCTCCGTCATGA
Gene >Agabi119p4|004230
ATGGCTGACCTACCATCGGACGATGTACTAAGGCATGTCGTTGATGTCCATTGCCATCCAACCGACGCACCCCAG
ATCTCGCCCGAGGCGATGGATCAGCTGCAGATCACCGTCTGCGCTATGGCGAGCCGTGAATCAGACCAGCCTCTA
GTACGCAACTTGGCGACCAGTAATCCTTCAAAAGTAATACCCTGTTTCGGTGTGTTCTGCTTCATCGTCCTGCTA
GCCTAGGAACCAATGACAGTGTCCGCGCCTATGTACCGCAGGTTATCACCCATGGTTCTCTCATTTCATCACAAC
AGATCCTACAATATCAAAGGAAGAACATTATAATCGCCTGTTTCTAGACCATGCGGGCGAACCCACTTCAGAGCA
ACGAGATGCTTTGAATGTTCTGCTAGGTCTGTTGCCGACTCCACGATTGCTAGTCCATATACAGGACGAGCTCCG
CCAAAATCTCGCAGCGTTCCCACATGCTATGCTCGGAGAAGTCGGATTAGATCGCTCGTTCCACGTTCCCTATAA
TTTCGATGCATCACCTCGCAGACTCACTCCTTTCACCGTTCCCCTTGACCACCAGTTGGTAATACTTGAAGCACA
ACTGGACATCGCCATAGAACTCGGTCGCAATGCCAGCATCCACAGTGTCAAATCACAACAAGCTACCATTGATCT
CTTGAGTCGACTGCACAAGAAGCACGGTGACTCGTTCTACCGCATTAGTATCGACATGCACAGTTGTGGCTTTAG
TCCAGAAACATGGAAATCTATCGAGGTAATATCGATCATAATTTTGATGCCAGGGGCTCATCGATCAGCTAGACC
AAATACACTAACGTCTTTCTCTCGCTCTCCATGGTCATTAACCAGAGACATTCGAGGTTTAAAGCACTTATTGAT
GCCTGTGCAGACGACCGGATCTTGGTCGAGTCGGATTATAACGATATAAATATGAGCACGTCACAAACTTGGAAA
ATGTTGACAATCGTCGCTGAAGTCAAGAAATGGTCGATCGAAACAGCCTGGCCTAGCTCTCTGGATGACAGAAAA
TGTGGTGCTGTGCGGCACTTCGAACGAAATTGGGAGAGGTTTTGCCGTGGGGATCACACGCCTTCAGGTAGTCGG
CGATCAGCTAAACGCAGACGAAATGACAACCCAAATTCAAGTGCCTCCTCTCCGTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail