Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|004220
Gene name
Locationscaffold_01a:1077023..1078786
Strand-
Gene length (bp)1763
Transcript length (bp)1356
Coding sequence length (bp)1356
Protein length (aa) 452

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02475 Met_10 Met-10+ like-protein 4.1E-67 135 389

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A8N339|TRM5_COPC7 tRNA (guanine(37)-N1)-methyltransferase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=TRM5 PE=3 SV=2 1 450 0.0E+00
sp|Q5KBP2|TRM5_CRYNJ tRNA (guanine(37)-N1)-methyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TRM5 PE=3 SV=1 11 449 5.0E-125
sp|Q8TFG7|TRM5_SCHPO tRNA (guanine(37)-N1)-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trm5 PE=3 SV=2 21 451 3.0E-110
sp|F4NUJ6|TRM5_BATDJ tRNA (guanine(37)-N1)-methyltransferase OS=Batrachochytrium dendrobatidis (strain JAM81 / FGSC 10211) GN=TRM5 PE=3 SV=1 10 450 2.0E-107
sp|P38793|TRM5_YEAST tRNA (guanine(37)-N1)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRM5 PE=1 SV=1 14 447 3.0E-103
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A8N339|TRM5_COPC7 tRNA (guanine(37)-N1)-methyltransferase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=TRM5 PE=3 SV=2 1 450 0.0E+00
sp|Q5KBP2|TRM5_CRYNJ tRNA (guanine(37)-N1)-methyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TRM5 PE=3 SV=1 11 449 5.0E-125
sp|Q8TFG7|TRM5_SCHPO tRNA (guanine(37)-N1)-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trm5 PE=3 SV=2 21 451 3.0E-110
sp|F4NUJ6|TRM5_BATDJ tRNA (guanine(37)-N1)-methyltransferase OS=Batrachochytrium dendrobatidis (strain JAM81 / FGSC 10211) GN=TRM5 PE=3 SV=1 10 450 2.0E-107
sp|P38793|TRM5_YEAST tRNA (guanine(37)-N1)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRM5 PE=1 SV=1 14 447 3.0E-103
sp|D0NLC2|TRM5_PHYIT tRNA (guanine(37)-N1)-methyltransferase OS=Phytophthora infestans (strain T30-4) GN=PITG_12867 PE=3 SV=1 21 450 2.0E-100
sp|Q3MHN8|TRM5_BOVIN tRNA (guanine(37)-N1)-methyltransferase OS=Bos taurus GN=TRMT5 PE=2 SV=1 10 447 1.0E-99
sp|F5HAU9|TRM5_NEUCR tRNA (guanine(37)-N1)-methyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=trm5 PE=3 SV=1 10 450 1.0E-99
sp|E3KWE1|TRM5_PUCGT tRNA (guanine(37)-N1)-methyltransferase OS=Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) GN=TRM5 PE=3 SV=2 23 444 4.0E-97
sp|C8VJ35|TRM5_EMENI tRNA (guanine(37)-N1)-methyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=trm5 PE=3 SV=1 11 449 3.0E-96
sp|B8A5G9|TRM5_DANRE tRNA (guanine(37)-N1)-methyltransferase OS=Danio rerio GN=trmt5 PE=3 SV=1 11 447 6.0E-94
sp|Q9D0C4|TRM5_MOUSE tRNA (guanine(37)-N1)-methyltransferase OS=Mus musculus GN=Trmt5 PE=1 SV=1 10 447 2.0E-93
sp|Q6CA67|TRM5_YARLI tRNA (guanine(37)-N1)-methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TRM5 PE=3 SV=1 21 450 2.0E-93
sp|Q4WX30|TRM5_ASPFU tRNA (guanine(37)-N1)-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=trm5 PE=3 SV=1 11 451 1.0E-92
sp|C4YH95|TRM5_CANAW tRNA (guanine(37)-N1)-methyltransferase OS=Candida albicans (strain WO-1) GN=TRM5 PE=3 SV=1 21 451 5.0E-92
sp|Q59TN1|TRM5_CANAL tRNA (guanine(37)-N1)-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRM5 PE=3 SV=1 21 451 2.0E-91
sp|Q32P41|TRM5_HUMAN tRNA (guanine(37)-N1)-methyltransferase OS=Homo sapiens GN=TRMT5 PE=1 SV=2 10 447 1.0E-90
sp|F7GSQ4|TRM5_MACMU tRNA (guanine(37)-N1)-methyltransferase OS=Macaca mulatta GN=TRMT5 PE=3 SV=1 10 447 2.0E-90
sp|Q95KJ2|TRM5_MACFA tRNA (guanine(37)-N1)-methyltransferase OS=Macaca fascicularis GN=TRMT5 PE=2 SV=1 10 447 3.0E-90
sp|C7YK87|TRM5_NECH7 tRNA (guanine(37)-N1)-methyltransferase OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=TRM5 PE=3 SV=1 21 450 3.0E-90
sp|F6VSS6|TRM5_XENTR tRNA (guanine(37)-N1)-methyltransferase OS=Xenopus tropicalis GN=trmt5 PE=3 SV=1 21 451 5.0E-88
sp|A9T6G5|TRM5_PHYPA tRNA (guanine(37)-N1)-methyltransferase OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_141055 PE=3 SV=1 21 434 8.0E-85
sp|Q8IRE4|TRM5_DROME tRNA (guanine(37)-N1)-methyltransferase OS=Drosophila melanogaster GN=CG32281 PE=2 SV=2 8 443 6.0E-81
sp|Q4PHW2|TRM5_USTMA tRNA (guanine(37)-N1)-methyltransferase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=TRM5 PE=3 SV=2 13 417 2.0E-78
sp|F7A355|TRM5_CIOIN tRNA (guanine(37)-N1)-methyltransferase OS=Ciona intestinalis PE=3 SV=1 11 445 2.0E-78
sp|B5DPF1|TRM5_DROPS tRNA (guanine(37)-N1)-methyltransferase OS=Drosophila pseudoobscura pseudoobscura GN=GA23546 PE=3 SV=1 11 445 3.0E-78
sp|Q93YU6|TRM51_ARATH tRNA (guanine(37)-N1)-methyltransferase 1 OS=Arabidopsis thaliana GN=At3g56120 PE=2 SV=1 21 446 3.0E-77
sp|Q7Q5Z3|TRM5_ANOGA tRNA (guanine(37)-N1)-methyltransferase OS=Anopheles gambiae GN=AGAP006124 PE=3 SV=4 8 451 1.0E-76
sp|Q54WD6|TRM5_DICDI tRNA (guanine(37)-N1)-methyltransferase OS=Dictyostelium discoideum GN=trmt5 PE=3 SV=1 21 444 2.0E-75
sp|Q16VC0|TRM5_AEDAE tRNA (guanine(37)-N1)-methyltransferase OS=Aedes aegypti GN=AAEL009603 PE=3 SV=1 11 447 2.0E-74
sp|C0NUP2|TRM5_AJECG tRNA (guanine(37)-N1)-methyltransferase OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=TRM5 PE=3 SV=1 14 451 3.0E-71
sp|E3WPP8|TRM5_ANODA tRNA (guanine(37)-N1)-methyltransferase OS=Anopheles darlingi GN=AND_03887 PE=3 SV=1 8 451 4.0E-70
sp|D5GN29|TRM5_TUBMM tRNA (guanine(37)-N1)-methyltransferase OS=Tuber melanosporum (strain Mel28) GN=TRM5 PE=3 SV=1 3 449 2.0E-69
sp|F6H2F8|TRM51_VITVI tRNA (guanine(37)-N1)-methyltransferase 1 OS=Vitis vinifera GN=VIT_19s0014g03930 PE=3 SV=1 73 447 7.0E-69
sp|C5XX79|TRM5_SORBI tRNA (guanine(37)-N1)-methyltransferase OS=Sorghum bicolor GN=Sb04g025390 PE=3 SV=1 19 444 1.0E-67
sp|E0VLV0|TRM5_PEDHC tRNA (guanine(37)-N1)-methyltransferase OS=Pediculus humanus subsp. corporis GN=PHUM294360 PE=3 SV=1 21 447 5.0E-66
sp|Q0UVC3|TRM5_PHANO tRNA (guanine(37)-N1)-methyltransferase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=TRM5 PE=3 SV=1 10 449 3.0E-65
sp|D3BT31|TRM5_POLPA tRNA (guanine(37)-N1)-methyltransferase OS=Polysphondylium pallidum GN=trmt5 PE=3 SV=1 21 444 2.0E-64
sp|Q6NQ64|TRM52_ARATH tRNA (guanine(37)-N1)-methyltransferase 2 OS=Arabidopsis thaliana GN=At4g27340 PE=2 SV=1 102 451 4.0E-63
sp|B8BQY5|TRM5_THAPS tRNA (guanine(37)-N1)-methyltransferase OS=Thalassiosira pseudonana GN=THAPSDRAFT_268027 PE=3 SV=1 130 448 3.0E-62
sp|F6HH45|TRM52_VITVI tRNA (guanine(37)-N1)-methyltransferase 2 OS=Vitis vinifera GN=VIT_11s0016g04350 PE=3 SV=1 21 319 3.0E-57
sp|B7FTW3|TRM51_PHATC tRNA (guanine(37)-N1)-methyltransferase 1 OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_44373 PE=3 SV=1 22 444 2.0E-56
sp|A2E5K9|TRM5_TRIVA tRNA (guanine(37)-N1)-methyltransferase OS=Trichomonas vaginalis GN=TVAG_038970 PE=3 SV=1 34 441 3.0E-54
sp|Q4DPN8|TRM52_TRYCC tRNA (guanine(37)-N1)-methyltransferase 2 OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053506743.170 PE=3 SV=1 11 451 6.0E-52
sp|Q4CNL4|TRM51_TRYCC tRNA (guanine(37)-N1)-methyltransferase 1 OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053503473.20 PE=3 SV=1 11 451 1.0E-51
sp|A0CC46|TRM5_PARTE tRNA (guanine(37)-N1)-methyltransferase OS=Paramecium tetraurelia GN=GSPATT00037147001 PE=3 SV=1 23 445 3.0E-51
sp|A4H8F7|TRM5_LEIBR tRNA (guanine(37)-N1)-methyltransferase OS=Leishmania braziliensis GN=LBRM_16_0320 PE=3 SV=1 93 446 8.0E-49
sp|A8WHT1|TRM5_CAEEL tRNA (guanine(37)-N1)-methyltransferase OS=Caenorhabditis elegans GN=C53A5.17 PE=3 SV=1 109 444 2.0E-48
sp|A4HWT0|TRM5_LEIIN tRNA (guanine(37)-N1)-methyltransferase OS=Leishmania infantum GN=LINJ_16_0320 PE=3 SV=1 93 446 6.0E-48
sp|Q4QEY9|TRM5_LEIMA tRNA (guanine(37)-N1)-methyltransferase OS=Leishmania major GN=LMJF_16_0310 PE=3 SV=1 93 446 8.0E-48
sp|C4M572|TRM5_ENTHI tRNA (guanine(37)-N1)-methyltransferase OS=Entamoeba histolytica GN=EHI_111740 PE=3 SV=1 21 441 2.0E-47
sp|B7G5J1|TRM52_PHATC tRNA (guanine(37)-N1)-methyltransferase 2 OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_47967 PE=3 SV=1 75 442 2.0E-44
sp|Q4MYY2|TRM5_THEPA tRNA (guanine(37)-N1)-methyltransferase OS=Theileria parva GN=TP03_0709 PE=3 SV=1 83 450 3.0E-40
sp|B3L2G0|TRM5_PLAKH tRNA (guanine(37)-N1)-methyltransferase OS=Plasmodium knowlesi (strain H) GN=PKH_071150 PE=3 SV=1 85 356 4.0E-39
sp|Q8SVV3|TRM5_ENCCU tRNA (guanine(37)-N1)-methyltransferase OS=Encephalitozoon cuniculi (strain GB-M1) GN=TRM5 PE=3 SV=1 103 448 5.0E-39
sp|Q4UB74|TRM5_THEAN tRNA (guanine(37)-N1)-methyltransferase OS=Theileria annulata GN=TA17855 PE=3 SV=1 131 451 5.0E-38
sp|C0H537|TRM5_PLAF7 tRNA (guanine(37)-N1)-methyltransferase OS=Plasmodium falciparum (isolate 3D7) GN=PFI0700c PE=3 SV=1 106 299 1.0E-35
sp|A5K6L0|TRM5_PLAVS tRNA (guanine(37)-N1)-methyltransferase OS=Plasmodium vivax (strain Salvador I) GN=PVX_099140 PE=3 SV=1 106 296 5.0E-34
sp|A8B4Q0|TRM5_GIAIC tRNA (guanine(37)-N1)-methyltransferase OS=Giardia intestinalis (strain ATCC 50803 / WB clone C6) GN=GL50803_4164 PE=3 SV=1 4 436 1.0E-33
sp|Q9V0Q0|TRM5B_PYRAB tRNA (guanine(37)-N1)-methyltransferase Trm5b OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=trm5b PE=1 SV=1 124 294 9.0E-22
sp|Q58293|TRM5B_METJA tRNA (guanine(37)-N1)-methyltransferase Trm5b OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=trm5b PE=1 SV=1 170 294 1.0E-14
sp|F6HH45|TRM52_VITVI tRNA (guanine(37)-N1)-methyltransferase 2 OS=Vitis vinifera GN=VIT_11s0016g04350 PE=3 SV=1 311 443 3.0E-14
sp|O58523|TYW2_PYRHO tRNA(Phe) (4-demethylwyosine(37)-C(7)) aminocarboxypropyltransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=taw2 PE=1 SV=1 118 295 8.0E-14
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 188 293 3.0E-09
sp|Q58952|TYW2_METJA tRNA(Phe) (4-demethylwyosine(37)-C(7)) aminocarboxypropyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=taw2 PE=1 SV=1 165 279 2.0E-08
sp|Q4V8B8|TYW2_RAT tRNA wybutosine-synthesizing protein 2 homolog OS=Rattus norvegicus GN=Trmt12 PE=2 SV=2 184 295 4.0E-07
sp|Q8BG71|TYW2_MOUSE tRNA wybutosine-synthesizing protein 2 homolog OS=Mus musculus GN=Trmt12 PE=2 SV=1 184 295 8.0E-07
sp|Q53H54|TYW2_HUMAN tRNA wybutosine-synthesizing protein 2 homolog OS=Homo sapiens GN=TRMT12 PE=1 SV=1 184 295 1.0E-06
sp|Q9V2G1|TRM5A_PYRAB tRNA (guanine(37)-N1)-methyltransferase Trm5a OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=trm5a PE=1 SV=1 138 279 2.0E-06
sp|Q58D65|TYW2_BOVIN tRNA wybutosine-synthesizing protein 2 homolog OS=Bos taurus GN=TRMT12 PE=2 SV=1 184 295 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|004220
MSSRVFLDASPPSYQGPKDRLDKSAFHKTLTVLSARVPPNKTGQLLKARELKGALMDLPKIRSVVSDPENPNGSR
LVLLRTVKYSELPPVAQEYLGKETQGLVNHEIKLDYDYWSTDDILQTILPGQLREGAPSGFAMTGHIAHVNLLEE
YLPYKYLIGQLILDKNKKVRTVVNKLDSIHAQFRVFEMELIAGDPDYIVEHHESDCRFTFDFSQVYWNSRLHTEH
ERLVRMFEPDDVVADVFAGVGPFAIPSARKGCAVLANDLNPASHKYLEKNVADNGVADRVRTFCEDGREFIQTIA
KQLHDDPLPPFNGPALSRTRREKERRRARLQHIADATPNPVAKSRKRICHFIMNLPDTAILFLNAFRGMLKADED
DNLLDTYEVMPMIHCHCFTREMDPEKAEVDIRKRVEEQLGAPLEEDVTFHLVRSVAPNKEMYCISFRLPRAVGIG
R*
Coding >Agabi119p4|004220
ATGTCTTCTCGCGTCTTTCTAGATGCATCACCTCCATCTTACCAAGGGCCTAAAGACAGACTGGACAAGTCTGCT
TTCCACAAAACGTTGACCGTCTTATCAGCGCGCGTGCCACCGAACAAAACCGGCCAGCTCCTAAAAGCGCGCGAG
CTCAAGGGAGCCCTTATGGACTTACCCAAGATACGGAGTGTCGTTTCCGATCCGGAGAACCCCAACGGGTCTCGC
TTGGTGCTACTACGGACGGTGAAATATTCTGAACTACCTCCTGTGGCACAAGAATATCTTGGGAAGGAAACTCAG
GGCCTCGTCAATCATGAGATCAAGTTGGACTATGACTACTGGTCCACTGATGATATTTTGCAAACTATCCTGCCC
GGCCAACTTCGAGAGGGTGCCCCCAGTGGTTTCGCCATGACTGGTCATATAGCGCACGTCAATCTCTTGGAGGAA
TATTTGCCATACAAGTATCTGATTGGCCAACTAATTCTTGATAAAAACAAAAAAGTCAGAACGGTTGTCAATAAA
TTGGATTCTATACACGCTCAATTTCGTGTATTCGAAATGGAACTTATTGCTGGGGATCCTGATTATATCGTGGAA
CATCACGAATCTGATTGTCGGTTCACATTCGATTTCTCTCAAGTATATTGGAATTCAAGGCTCCATACGGAGCAT
GAGCGACTGGTTCGAATGTTTGAACCTGATGATGTAGTAGCCGATGTATTTGCAGGCGTCGGTCCCTTTGCGATA
CCCTCTGCACGAAAAGGATGTGCTGTCCTTGCCAATGACCTGAATCCCGCAAGTCATAAATACCTTGAGAAAAAC
GTTGCTGATAACGGAGTAGCTGACAGAGTGCGCACTTTCTGTGAGGATGGGCGGGAATTCATACAAACCATCGCA
AAACAGCTTCATGATGACCCACTCCCTCCATTTAATGGACCAGCATTGAGTAGAACTCGACGAGAGAAAGAGAGA
CGTAGAGCTCGACTCCAGCACATAGCCGATGCAACACCTAATCCCGTTGCCAAGAGCCGCAAACGCATCTGCCAC
TTCATAATGAATTTACCAGATACCGCAATTTTATTCCTGAATGCATTTCGTGGCATGCTGAAAGCTGACGAGGAC
GACAACCTGCTGGATACCTACGAGGTTATGCCTATGATTCATTGCCACTGTTTTACCAGGGAAATGGATCCGGAG
AAGGCAGAGGTTGACATCCGGAAGCGAGTAGAAGAGCAATTGGGTGCTCCGCTGGAGGAGGATGTAACCTTTCAC
CTGGTACGCTCGGTGGCGCCGAATAAGGAGATGTATTGTATTAGCTTCCGACTACCGCGTGCAGTGGGGATTGGT
AGATAG
Transcript >Agabi119p4|004220
ATGTCTTCTCGCGTCTTTCTAGATGCATCACCTCCATCTTACCAAGGGCCTAAAGACAGACTGGACAAGTCTGCT
TTCCACAAAACGTTGACCGTCTTATCAGCGCGCGTGCCACCGAACAAAACCGGCCAGCTCCTAAAAGCGCGCGAG
CTCAAGGGAGCCCTTATGGACTTACCCAAGATACGGAGTGTCGTTTCCGATCCGGAGAACCCCAACGGGTCTCGC
TTGGTGCTACTACGGACGGTGAAATATTCTGAACTACCTCCTGTGGCACAAGAATATCTTGGGAAGGAAACTCAG
GGCCTCGTCAATCATGAGATCAAGTTGGACTATGACTACTGGTCCACTGATGATATTTTGCAAACTATCCTGCCC
GGCCAACTTCGAGAGGGTGCCCCCAGTGGTTTCGCCATGACTGGTCATATAGCGCACGTCAATCTCTTGGAGGAA
TATTTGCCATACAAGTATCTGATTGGCCAACTAATTCTTGATAAAAACAAAAAAGTCAGAACGGTTGTCAATAAA
TTGGATTCTATACACGCTCAATTTCGTGTATTCGAAATGGAACTTATTGCTGGGGATCCTGATTATATCGTGGAA
CATCACGAATCTGATTGTCGGTTCACATTCGATTTCTCTCAAGTATATTGGAATTCAAGGCTCCATACGGAGCAT
GAGCGACTGGTTCGAATGTTTGAACCTGATGATGTAGTAGCCGATGTATTTGCAGGCGTCGGTCCCTTTGCGATA
CCCTCTGCACGAAAAGGATGTGCTGTCCTTGCCAATGACCTGAATCCCGCAAGTCATAAATACCTTGAGAAAAAC
GTTGCTGATAACGGAGTAGCTGACAGAGTGCGCACTTTCTGTGAGGATGGGCGGGAATTCATACAAACCATCGCA
AAACAGCTTCATGATGACCCACTCCCTCCATTTAATGGACCAGCATTGAGTAGAACTCGACGAGAGAAAGAGAGA
CGTAGAGCTCGACTCCAGCACATAGCCGATGCAACACCTAATCCCGTTGCCAAGAGCCGCAAACGCATCTGCCAC
TTCATAATGAATTTACCAGATACCGCAATTTTATTCCTGAATGCATTTCGTGGCATGCTGAAAGCTGACGAGGAC
GACAACCTGCTGGATACCTACGAGGTTATGCCTATGATTCATTGCCACTGTTTTACCAGGGAAATGGATCCGGAG
AAGGCAGAGGTTGACATCCGGAAGCGAGTAGAAGAGCAATTGGGTGCTCCGCTGGAGGAGGATGTAACCTTTCAC
CTGGTACGCTCGGTGGCGCCGAATAAGGAGATGTATTGTATTAGCTTCCGACTACCGCGTGCAGTGGGGATTGGT
AGATAG
Gene >Agabi119p4|004220
ATGTCTTCTCGCGTCTTTCTAGATGCATCACCTCCATCTTACCAAGGGCCTAAAGACAGACTGGACAAGTCTGCT
TTCCACAAAACGTTGACCGTCTTATCAGCGCGCGTGCCACCGAACAAAACCGGCCAGCTCCTAAAAGCGCGCGAG
CTCAAGGGGTGTGTACTGAGCACAGGTATTATGTTGCACCTCCTCATTTATTTGCAGAGCCCTTATGGACTTACC
CAAGATACGGAGTGTCGTTTCCGATCCGGAGAACCCCAACGGGTCTCGCTTGGTGCTACTACGGACGGTGAAATA
TTGTGGGCCTCAAAATTCTAATGCAACCTACTTACAGTACTGATCCTTTGTAAGCAAGCTGAACTACCTCCTGTG
GCACAAGAATATCTTGGGAAGGAAACTCAGGGCCTCGTCAATCATGAGATCAAGTTGGACTATGACTACTGGTCC
ACTGGTTCGTCGATCAACATTTATTTTCAGCCAGATAATTAATGACTGATCTCAGATGATATTTTGCAAACTATC
CTGCCCGGCCAACTTCGAGAGGGTGCCCCCAGTGGTTTCGCCATGACTGGTCATATAGGTGAATTATGCCTCTTG
CCTGGCGAGCAGTCGTAACCAATGTCGTTAGCGCACGTCAATCTCTTGGAGGAATATTTGCCATACAAGTATCTG
ATTGGCCAACTAATTCTTGATGTATGTGTTATTTCTTTCTTTTGACTCCAAATTGAACTGGGCGATAGAAAAACA
AAAAAGTCAGAACGGTTGTCAATAAATTGGATTCTATACACGCTCAATTTCGTGTATTCGAAATGGAACTTATTG
CTGGGGATCCTGATTATATCGTGGAACATGTGAGTTATTACTCCTTCAATTGCTTGTGGCTCTCGCCGATGATCT
CCTAGCACGAATCTGATTGTCGGTTCACATTCGATTTCTCTCAAGTATATTGGAATTCAAGGCTCCATACGGAGC
ATGAGCGACTGGTTCGAATGTTTGAACCTGATGATGTAGTAGCCGATGTATTTGCAGGCGTCGGTCCCTTTGCGA
TACCCTCTGCACGAAAAGGATGTGCTGTCCTTGCCAATGACCTGAATCCCGCAAGTCATAAATACCTTGAGAAAA
ACGTTGCTGATAACGGAGTTTGTCCCCACTCTAGTTTCTTCATCATAATCTACCCCTAACTCCATTTGCAGGTAG
CTGACAGAGTGCGCACTTTCTGTGAGGATGGGCGGGAATTCATACAAACCATCGCAAAACAGCTTCATGATGACC
CACTCCCTCCATTTAATGGACCAGCATTGAGTAGAACTCGACGAGAGAAAGAGAGACGTAGAGCTCGACTCCAGC
ACATAGCCGATGCAACACCTAATCCCGTTGCCAAGAGCCGCAAACGCATCTGCCACTTCATAATGAATTTACCAG
ATACCGCAATTTTATTCCTGAATGCATTTCGTGGCATGCTGAAAGCTGACGAGGACGACAACCTGCTGGATACCT
ACGAGGTTATGCCTATGATTCATTGCCACTGTTTTACCAGGGAAATGGATCCGGAGAAGGCAGAGGTTGACATCC
GGAAGGTACGGCTGTCATTCGCTCCTTCTTTCAAAGTCTGACGGCATTGTCCACAGCGAGTAGAAGAGCAATTGG
GTGCTCCGCTGGAGGAGGATGTAACCTTTCACCTGGTACGCTCGGTGGCGCCGAATAAGGAGATGTATTGTATTA
GCTTCCGACTACCGCGTGCAGTGGGGATTGGTAGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail