Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|004180
Gene name
Locationscaffold_01a:1068191..1070257
Strand+
Gene length (bp)2066
Transcript length (bp)1749
Coding sequence length (bp)1749
Protein length (aa) 583

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01967 MoaC MoaC family 2.1E-48 412 573
PF06463 Mob_synth_C Molybdenum Cofactor Synthesis C 2.3E-38 222 348
PF04055 Radical_SAM Radical SAM superfamily 1.1E-26 53 216
PF13353 Fer4_12 4Fe-4S single cluster domain 1.5E-05 57 147

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5RKZ7|MOCS1_MOUSE Molybdenum cofactor biosynthesis protein 1 OS=Mus musculus GN=Mocs1 PE=1 SV=2 35 580 1.0E-155
sp|Q9NZB8|MOCS1_HUMAN Molybdenum cofactor biosynthesis protein 1 OS=Homo sapiens GN=MOCS1 PE=1 SV=3 35 580 1.0E-155
sp|Q8IQF1|MOCS1_DROME Molybdenum cofactor biosynthesis protein 1 OS=Drosophila melanogaster GN=Mocs1 PE=2 SV=1 28 580 2.0E-142
sp|Q20624|MOCS1_CAEEL Molybdenum cofactor biosynthesis protein 1 OS=Caenorhabditis elegans GN=F49E2.1 PE=3 SV=3 26 575 8.0E-142
sp|Q54NM6|MOCS1_DICDI Molybdenum cofactor biosynthesis protein 1 OS=Dictyostelium discoideum GN=mocs1 PE=3 SV=1 42 576 1.0E-138
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5RKZ7|MOCS1_MOUSE Molybdenum cofactor biosynthesis protein 1 OS=Mus musculus GN=Mocs1 PE=1 SV=2 35 580 1.0E-155
sp|Q9NZB8|MOCS1_HUMAN Molybdenum cofactor biosynthesis protein 1 OS=Homo sapiens GN=MOCS1 PE=1 SV=3 35 580 1.0E-155
sp|Q8IQF1|MOCS1_DROME Molybdenum cofactor biosynthesis protein 1 OS=Drosophila melanogaster GN=Mocs1 PE=2 SV=1 28 580 2.0E-142
sp|Q20624|MOCS1_CAEEL Molybdenum cofactor biosynthesis protein 1 OS=Caenorhabditis elegans GN=F49E2.1 PE=3 SV=3 26 575 8.0E-142
sp|Q54NM6|MOCS1_DICDI Molybdenum cofactor biosynthesis protein 1 OS=Dictyostelium discoideum GN=mocs1 PE=3 SV=1 42 576 1.0E-138
sp|Q39055|CNX2_ARATH Cyclic pyranopterin monophosphate synthase, mitochondrial OS=Arabidopsis thaliana GN=CNX2 PE=1 SV=1 35 365 5.0E-132
sp|Q1JQD7|MOCS1_BOVIN Molybdenum cofactor biosynthesis protein 1 OS=Bos taurus GN=MOCS1 PE=2 SV=2 27 580 4.0E-128
sp|Q0AVU6|MOAA_SYNWW Cyclic pyranopterin monophosphate synthase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=moaA PE=3 SV=1 41 365 8.0E-77
sp|Q7UT69|MOAA_RHOBA Cyclic pyranopterin monophosphate synthase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=moaA PE=3 SV=1 19 365 1.0E-76
sp|Q2RGL2|MOAA_MOOTA Cyclic pyranopterin monophosphate synthase OS=Moorella thermoacetica (strain ATCC 39073) GN=moaA PE=3 SV=1 42 347 2.0E-73
sp|B5YJ09|MOAA_THEYD Cyclic pyranopterin monophosphate synthase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=moaA PE=3 SV=1 42 365 9.0E-73
sp|A4J6S5|MOAA_DESRM Cyclic pyranopterin monophosphate synthase OS=Desulfotomaculum reducens (strain MI-1) GN=moaA PE=3 SV=1 41 347 2.0E-72
sp|A8MLW5|MOAA_ALKOO Cyclic pyranopterin monophosphate synthase OS=Alkaliphilus oremlandii (strain OhILAs) GN=moaA PE=3 SV=1 42 365 3.0E-71
sp|A5CYZ0|MOAA_PELTS Cyclic pyranopterin monophosphate synthase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=moaA PE=3 SV=1 42 347 2.0E-70
sp|A0AHG0|MOAA_LISW6 Cyclic pyranopterin monophosphate synthase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=moaA PE=3 SV=1 42 360 5.0E-70
sp|Q8Y870|MOAA_LISMO Cyclic pyranopterin monophosphate synthase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=moaA PE=3 SV=1 42 360 6.0E-70
sp|C1L1W8|MOAA_LISMC Cyclic pyranopterin monophosphate synthase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=moaA PE=3 SV=1 42 360 2.0E-69
sp|Q721B9|MOAA_LISMF Cyclic pyranopterin monophosphate synthase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=moaA PE=3 SV=1 42 360 2.0E-69
sp|Q92CY2|MOAA_LISIN Cyclic pyranopterin monophosphate synthase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=moaA PE=3 SV=1 42 360 8.0E-69
sp|Q93KD1|MOAA_EUBAC Cyclic pyranopterin monophosphate synthase OS=Eubacterium acidaminophilum GN=moaA PE=3 SV=2 40 348 1.0E-68
sp|Q3ADX8|MOAA_CARHZ Cyclic pyranopterin monophosphate synthase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=moaA PE=3 SV=1 41 351 2.0E-68
sp|Q9RJ47|MOAA_STRCO Cyclic pyranopterin monophosphate synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=moaA PE=3 SV=1 40 365 3.0E-68
sp|Q747W9|MOAA_GEOSL Cyclic pyranopterin monophosphate synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=moaA PE=3 SV=1 39 352 1.0E-67
sp|B0TI16|MOAA_HELMI Cyclic pyranopterin monophosphate synthase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=moaA PE=3 SV=1 40 352 2.0E-67
sp|A6TVF9|MOAA_ALKMQ Cyclic pyranopterin monophosphate synthase OS=Alkaliphilus metalliredigens (strain QYMF) GN=moaA PE=3 SV=1 42 347 8.0E-66
sp|Q8NR60|MOAA_CORGL Cyclic pyranopterin monophosphate synthase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=moaA PE=3 SV=1 40 365 2.0E-65
sp|Q9WX96|MOAA_CLOPE Cyclic pyranopterin monophosphate synthase OS=Clostridium perfringens (strain 13 / Type A) GN=moaA PE=3 SV=2 42 347 1.0E-64
sp|Q0SS32|MOAA_CLOPS Cyclic pyranopterin monophosphate synthase OS=Clostridium perfringens (strain SM101 / Type A) GN=moaA PE=3 SV=1 42 347 1.0E-64
sp|A4QDF8|MOAA_CORGB Cyclic pyranopterin monophosphate synthase OS=Corynebacterium glutamicum (strain R) GN=moaA PE=3 SV=1 40 365 2.0E-64
sp|Q0TPG6|MOAA_CLOP1 Cyclic pyranopterin monophosphate synthase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=moaA PE=3 SV=1 42 347 3.0E-64
sp|Q88WY1|MOAA_LACPL Cyclic pyranopterin monophosphate synthase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=moaA PE=3 SV=1 39 347 3.0E-64
sp|B2GCN4|MOAA_LACF3 Cyclic pyranopterin monophosphate synthase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=moaA PE=3 SV=1 39 319 2.0E-62
sp|B1KU20|MOAA_CLOBM Cyclic pyranopterin monophosphate synthase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=moaA PE=3 SV=1 40 365 3.0E-62
sp|Q1B3F3|MOAA_MYCSS Cyclic pyranopterin monophosphate synthase OS=Mycobacterium sp. (strain MCS) GN=moaA PE=3 SV=1 35 365 1.0E-61
sp|A1ULP7|MOAA_MYCSK Cyclic pyranopterin monophosphate synthase OS=Mycobacterium sp. (strain KMS) GN=moaA PE=3 SV=1 35 365 1.0E-61
sp|A3Q648|MOAA_MYCSJ Cyclic pyranopterin monophosphate synthase OS=Mycobacterium sp. (strain JLS) GN=moaA PE=3 SV=1 35 365 1.0E-61
sp|C1FPG7|MOAA_CLOBJ Cyclic pyranopterin monophosphate synthase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=moaA PE=3 SV=1 40 365 2.0E-61
sp|A5I365|MOAA_CLOBH Cyclic pyranopterin monophosphate synthase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=moaA PE=3 SV=1 40 365 2.0E-61
sp|A7FUZ6|MOAA_CLOB1 Cyclic pyranopterin monophosphate synthase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=moaA PE=3 SV=1 40 365 2.0E-61
sp|A9BF51|MOAA_PETMO Cyclic pyranopterin monophosphate synthase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=moaA PE=3 SV=1 41 321 3.0E-61
sp|B1IN35|MOAA_CLOBK Cyclic pyranopterin monophosphate synthase OS=Clostridium botulinum (strain Okra / Type B1) GN=moaA PE=3 SV=1 40 365 4.0E-61
sp|A7GEQ5|MOAA_CLOBL Cyclic pyranopterin monophosphate synthase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=moaA PE=3 SV=1 40 365 6.0E-61
sp|Q31JB9|MOAA_THICR Cyclic pyranopterin monophosphate synthase OS=Thiomicrospira crunogena (strain XCL-2) GN=moaA PE=3 SV=1 40 365 4.0E-60
sp|C3KXJ8|MOAA_CLOB6 Cyclic pyranopterin monophosphate synthase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=moaA PE=3 SV=1 40 365 7.0E-60
sp|A7GU01|MOAA_BACCN Cyclic pyranopterin monophosphate synthase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=moaA PE=3 SV=1 42 366 1.0E-59
sp|A4XW05|MOAA_PSEMY Cyclic pyranopterin monophosphate synthase OS=Pseudomonas mendocina (strain ymp) GN=moaA PE=3 SV=1 37 365 1.0E-59
sp|Q4L8D2|MOAA_STAHJ Cyclic pyranopterin monophosphate synthase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=moaA PE=3 SV=1 37 332 4.0E-59
sp|C6C060|MOAA_DESAD Cyclic pyranopterin monophosphate synthase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=moaA PE=3 SV=1 42 343 6.0E-59
sp|Q44118|MOAA_ARTNI Cyclic pyranopterin monophosphate synthase OS=Arthrobacter nicotinovorans GN=moaA PE=1 SV=2 40 365 1.0E-58
sp|B0CDZ6|MOAA_ACAM1 Cyclic pyranopterin monophosphate synthase OS=Acaryochloris marina (strain MBIC 11017) GN=moaA PE=3 SV=1 50 365 1.0E-58
sp|B2HFA4|MOAA_MYCMM Cyclic pyranopterin monophosphate synthase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=moaA PE=3 SV=1 21 365 2.0E-58
sp|A5VQC9|MOAA_BRUO2 Cyclic pyranopterin monophosphate synthase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=moaA PE=3 SV=1 37 362 2.0E-58
sp|P9WJS1|MOAA2_MYCTU Cyclic pyranopterin monophosphate synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=moaA2 PE=1 SV=1 15 365 2.0E-58
sp|P9WJS0|MOAA2_MYCTO Cyclic pyranopterin monophosphate synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=moaA2 PE=3 SV=1 15 365 2.0E-58
sp|P65385|MOAA2_MYCBO Cyclic pyranopterin monophosphate synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=moaA2 PE=3 SV=1 15 365 2.0E-58
sp|Q8G0X4|MOAA_BRUSU Cyclic pyranopterin monophosphate synthase OS=Brucella suis biovar 1 (strain 1330) GN=moaA PE=3 SV=1 37 362 3.0E-58
sp|B0CLT0|MOAA_BRUSI Cyclic pyranopterin monophosphate synthase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=moaA PE=3 SV=1 37 362 3.0E-58
sp|A9MAX5|MOAA_BRUC2 Cyclic pyranopterin monophosphate synthase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=moaA PE=3 SV=1 37 362 3.0E-58
sp|Q57DG3|MOAA_BRUAB Cyclic pyranopterin monophosphate synthase OS=Brucella abortus biovar 1 (strain 9-941) GN=moaA PE=3 SV=1 37 362 4.0E-58
sp|Q2YNT7|MOAA_BRUA2 Cyclic pyranopterin monophosphate synthase OS=Brucella abortus (strain 2308) GN=moaA PE=3 SV=1 37 362 4.0E-58
sp|B2S5I1|MOAA_BRUA1 Cyclic pyranopterin monophosphate synthase OS=Brucella abortus (strain S19) GN=moaA PE=3 SV=1 37 362 4.0E-58
sp|Q0S2N2|MOAA_RHOJR Cyclic pyranopterin monophosphate synthase OS=Rhodococcus jostii (strain RHA1) GN=moaA PE=3 SV=1 26 348 6.0E-58
sp|Q56211|MOAA_SYNE7 Cyclic pyranopterin monophosphate synthase OS=Synechococcus elongatus (strain PCC 7942) GN=moaA PE=3 SV=1 42 347 7.0E-58
sp|Q8YGY6|MOAA_BRUME Cyclic pyranopterin monophosphate synthase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=moaA PE=3 SV=1 37 362 7.0E-58
sp|C0RIT4|MOAA_BRUMB Cyclic pyranopterin monophosphate synthase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=moaA PE=3 SV=1 37 362 7.0E-58
sp|Q5N5F7|MOAA_SYNP6 Cyclic pyranopterin monophosphate synthase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=moaA PE=3 SV=1 42 347 1.0E-57
sp|Q9ZIM6|MOAA_STACT Cyclic pyranopterin monophosphate synthase OS=Staphylococcus carnosus (strain TM300) GN=moaA PE=3 SV=1 39 332 1.0E-57
sp|A0PKZ7|MOAA_MYCUA Cyclic pyranopterin monophosphate synthase OS=Mycobacterium ulcerans (strain Agy99) GN=moaA PE=3 SV=1 21 365 1.0E-57
sp|B8HWW4|MOAA_CYAP4 Cyclic pyranopterin monophosphate synthase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=moaA PE=3 SV=1 50 352 2.0E-57
sp|A1U578|MOAA_MARHV Cyclic pyranopterin monophosphate synthase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=moaA PE=3 SV=1 39 365 2.0E-57
sp|Q119N9|MOAA_TRIEI Cyclic pyranopterin monophosphate synthase OS=Trichodesmium erythraeum (strain IMS101) GN=moaA PE=3 SV=1 50 337 3.0E-57
sp|B1XLR4|MOAA_SYNP2 Cyclic pyranopterin monophosphate synthase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=moaA PE=3 SV=1 50 359 5.0E-57
sp|Q1I6J5|MOAA_PSEE4 Cyclic pyranopterin monophosphate synthase OS=Pseudomonas entomophila (strain L48) GN=moaA PE=3 SV=1 40 347 1.0E-56
sp|C1B1N5|MOAA_RHOOB Cyclic pyranopterin monophosphate synthase OS=Rhodococcus opacus (strain B4) GN=moaA PE=3 SV=1 34 348 1.0E-56
sp|Q65DY5|MOAA_BACLD Cyclic pyranopterin monophosphate synthase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=moaA PE=3 SV=1 39 336 2.0E-56
sp|B1JCW0|MOAA_PSEPW Cyclic pyranopterin monophosphate synthase OS=Pseudomonas putida (strain W619) GN=moaA PE=3 SV=1 40 365 4.0E-56
sp|Q2JI46|MOAA_SYNJB Cyclic pyranopterin monophosphate synthase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=moaA PE=3 SV=1 49 338 4.0E-56
sp|B4SL67|MOAA_STRM5 Cyclic pyranopterin monophosphate synthase OS=Stenotrophomonas maltophilia (strain R551-3) GN=moaA PE=3 SV=1 39 348 1.0E-55
sp|B0JNC2|MOAA_MICAN Cyclic pyranopterin monophosphate synthase OS=Microcystis aeruginosa (strain NIES-843) GN=moaA PE=3 SV=1 50 340 2.0E-55
sp|B3PQ08|MOAA_RHIE6 Cyclic pyranopterin monophosphate synthase OS=Rhizobium etli (strain CIAT 652) GN=moaA PE=3 SV=1 26 362 3.0E-55
sp|Q2K7L4|MOAA_RHIEC Cyclic pyranopterin monophosphate synthase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=moaA PE=3 SV=1 24 362 3.0E-55
sp|A0L7R4|MOAA_MAGMM Cyclic pyranopterin monophosphate synthase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=moaA PE=3 SV=1 40 347 3.0E-55
sp|B0KST1|MOAA_PSEPG Cyclic pyranopterin monophosphate synthase OS=Pseudomonas putida (strain GB-1) GN=moaA PE=3 SV=1 40 334 5.0E-55
sp|B9L851|MOAA_NAUPA Cyclic pyranopterin monophosphate synthase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=moaA PE=3 SV=1 41 352 6.0E-55
sp|B2FUM0|MOAA_STRMK Cyclic pyranopterin monophosphate synthase OS=Stenotrophomonas maltophilia (strain K279a) GN=moaA PE=3 SV=1 39 348 7.0E-55
sp|Q8CNE6|MOAA_STAES Cyclic pyranopterin monophosphate synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=moaA PE=3 SV=1 51 332 8.0E-55
sp|Q5HLY1|MOAA_STAEQ Cyclic pyranopterin monophosphate synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=moaA PE=3 SV=1 51 332 8.0E-55
sp|Q9AC48|MOAA_CAUCR Cyclic pyranopterin monophosphate synthase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=moaA PE=3 SV=1 32 347 9.0E-55
sp|Q1QN98|MOAA_NITHX Cyclic pyranopterin monophosphate synthase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=moaA PE=3 SV=1 39 362 1.0E-54
sp|Q3MC34|MOAA_ANAVT Cyclic pyranopterin monophosphate synthase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=moaA PE=3 SV=1 50 352 1.0E-54
sp|Q6GEG6|MOAA_STAAR Cyclic pyranopterin monophosphate synthase OS=Staphylococcus aureus (strain MRSA252) GN=moaA PE=3 SV=1 39 332 1.0E-54
sp|Q48HV8|MOAA_PSE14 Cyclic pyranopterin monophosphate synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=moaA PE=3 SV=1 40 334 2.0E-54
sp|Q931G4|MOAA_STAAM Cyclic pyranopterin monophosphate synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=moaA PE=3 SV=1 39 332 2.0E-54
sp|A7X5J1|MOAA_STAA1 Cyclic pyranopterin monophosphate synthase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=moaA PE=3 SV=1 39 332 2.0E-54
sp|Q8UER0|MOAA_AGRFC Cyclic pyranopterin monophosphate synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=moaA PE=3 SV=1 40 362 3.0E-54
sp|P65389|MOAA_STAAW Cyclic pyranopterin monophosphate synthase OS=Staphylococcus aureus (strain MW2) GN=moaA PE=3 SV=1 39 332 3.0E-54
sp|A8Z366|MOAA_STAAT Cyclic pyranopterin monophosphate synthase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=moaA PE=3 SV=1 39 332 3.0E-54
sp|Q6G754|MOAA_STAAS Cyclic pyranopterin monophosphate synthase OS=Staphylococcus aureus (strain MSSA476) GN=moaA PE=3 SV=1 39 332 3.0E-54
sp|P65388|MOAA_STAAN Cyclic pyranopterin monophosphate synthase OS=Staphylococcus aureus (strain N315) GN=moaA PE=3 SV=1 39 332 3.0E-54
sp|A6QJA8|MOAA_STAAE Cyclic pyranopterin monophosphate synthase OS=Staphylococcus aureus (strain Newman) GN=moaA PE=3 SV=1 39 332 3.0E-54
sp|Q5HDT9|MOAA_STAAC Cyclic pyranopterin monophosphate synthase OS=Staphylococcus aureus (strain COL) GN=moaA PE=3 SV=1 39 332 3.0E-54
sp|A5IV50|MOAA_STAA9 Cyclic pyranopterin monophosphate synthase OS=Staphylococcus aureus (strain JH9) GN=moaA PE=3 SV=1 39 332 3.0E-54
sp|P69848|MOAA_STAA8 Cyclic pyranopterin monophosphate synthase OS=Staphylococcus aureus (strain NCTC 8325) GN=moaA PE=1 SV=1 39 332 3.0E-54
sp|Q2FEM4|MOAA_STAA3 Cyclic pyranopterin monophosphate synthase OS=Staphylococcus aureus (strain USA300) GN=moaA PE=3 SV=1 39 332 3.0E-54
sp|A6U3Z2|MOAA_STAA2 Cyclic pyranopterin monophosphate synthase OS=Staphylococcus aureus (strain JH1) GN=moaA PE=3 SV=1 39 332 3.0E-54
sp|Q3STB0|MOAA_NITWN Cyclic pyranopterin monophosphate synthase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=moaA PE=3 SV=1 39 362 3.0E-54
sp|Q4ZU05|MOAA_PSEU2 Cyclic pyranopterin monophosphate synthase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=moaA PE=3 SV=1 40 334 5.0E-54
sp|Q8ZGW5|MOAA_YERPE Cyclic pyranopterin monophosphate synthase OS=Yersinia pestis GN=moaA PE=3 SV=1 39 347 5.0E-54
sp|Q8YQG6|MOAA_NOSS1 Cyclic pyranopterin monophosphate synthase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=moaA PE=3 SV=1 50 352 6.0E-54
sp|Q9HXD6|MOAA1_PSEAE Cyclic pyranopterin monophosphate synthase 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=moaA1 PE=3 SV=1 40 365 7.0E-54
sp|B7JWW6|MOAA_CYAP8 Cyclic pyranopterin monophosphate synthase OS=Cyanothece sp. (strain PCC 8801) GN=moaA PE=3 SV=1 50 343 8.0E-54
sp|A0R443|MOAA_MYCS2 Cyclic pyranopterin monophosphate synthase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=moaA PE=3 SV=1 32 365 8.0E-54
sp|B2J1M7|MOAA_NOSP7 Cyclic pyranopterin monophosphate synthase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=moaA PE=3 SV=1 50 365 9.0E-54
sp|A6U9U3|MOAA_SINMW Cyclic pyranopterin monophosphate synthase OS=Sinorhizobium medicae (strain WSM419) GN=moaA PE=3 SV=1 30 362 1.0E-53
sp|P59038|MOAA_CHLTE Cyclic pyranopterin monophosphate synthase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=moaA PE=3 SV=1 42 365 1.0E-53
sp|Q65TT2|MOAA_MANSM Cyclic pyranopterin monophosphate synthase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=moaA PE=3 SV=1 37 347 2.0E-53
sp|Q3KAS8|MOAA_PSEPF Cyclic pyranopterin monophosphate synthase OS=Pseudomonas fluorescens (strain Pf0-1) GN=moaA PE=3 SV=1 40 365 3.0E-53
sp|P45311|MOAA_HAEIN Cyclic pyranopterin monophosphate synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=moaA PE=3 SV=1 39 347 4.0E-53
sp|Q88E69|MOAA_PSEPK Cyclic pyranopterin monophosphate synthase OS=Pseudomonas putida (strain KT2440) GN=moaA PE=3 SV=1 40 365 5.0E-53
sp|A5VZZ2|MOAA_PSEP1 Cyclic pyranopterin monophosphate synthase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=moaA PE=3 SV=1 40 365 6.0E-53
sp|Q882V6|MOAA_PSESM Cyclic pyranopterin monophosphate synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=moaA PE=3 SV=1 40 334 6.0E-53
sp|Q2YYS8|MOAA_STAAB Cyclic pyranopterin monophosphate synthase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=moaA PE=3 SV=1 39 332 1.0E-52
sp|Q4QJR9|MOAA_HAEI8 Cyclic pyranopterin monophosphate synthase OS=Haemophilus influenzae (strain 86-028NP) GN=moaA PE=3 SV=1 39 347 2.0E-52
sp|B5ZRM8|MOAA_RHILW Cyclic pyranopterin monophosphate synthase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=moaA PE=3 SV=1 40 362 2.0E-52
sp|Q8Y0K4|MOAA_RALSO Cyclic pyranopterin monophosphate synthase OS=Ralstonia solanacearum (strain GMI1000) GN=moaA PE=3 SV=2 35 336 3.0E-52
sp|A1SWQ3|MOAA_PSYIN Cyclic pyranopterin monophosphate synthase OS=Psychromonas ingrahamii (strain 37) GN=moaA PE=3 SV=1 39 347 3.0E-52
sp|Q7NCF5|MOAA_GLOVI Cyclic pyranopterin monophosphate synthase OS=Gloeobacter violaceus (strain PCC 7421) GN=moaA PE=3 SV=1 49 343 3.0E-52
sp|Q97HL8|MOAA_CLOAB Cyclic pyranopterin monophosphate synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=moaA PE=3 SV=1 40 347 4.0E-52
sp|A5UFB4|MOAA_HAEIG Cyclic pyranopterin monophosphate synthase OS=Haemophilus influenzae (strain PittGG) GN=moaA PE=3 SV=1 39 347 4.0E-52
sp|C0Z9B3|MOAA_BREBN Cyclic pyranopterin monophosphate synthase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=moaA PE=3 SV=1 39 337 4.0E-52
sp|A7Z9P0|MOAA_BACMF Cyclic pyranopterin monophosphate synthase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=moaA PE=3 SV=1 51 336 5.0E-52
sp|A3N054|MOAA_ACTP2 Cyclic pyranopterin monophosphate synthase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=moaA PE=3 SV=1 39 347 1.0E-51
sp|Q9I3K7|MOAA2_PSEAE Cyclic pyranopterin monophosphate synthase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=moaA2 PE=3 SV=1 39 352 1.0E-51
sp|A0KIL8|MOAA_AERHH Cyclic pyranopterin monophosphate synthase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=moaA PE=3 SV=1 36 347 1.0E-51
sp|C3LTS1|MOAA_VIBCM Cyclic pyranopterin monophosphate synthase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=moaA PE=3 SV=1 39 347 1.0E-51
sp|Q9KT81|MOAA_VIBCH Cyclic pyranopterin monophosphate synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=moaA PE=3 SV=1 39 347 1.0E-51
sp|A5F2Q5|MOAA_VIBC3 Cyclic pyranopterin monophosphate synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=moaA PE=3 SV=1 39 347 1.0E-51
sp|A5UBK4|MOAA_HAEIE Cyclic pyranopterin monophosphate synthase OS=Haemophilus influenzae (strain PittEE) GN=moaA PE=3 SV=1 39 347 2.0E-51
sp|P62589|MOAA3_MYCTO Cyclic pyranopterin monophosphate synthase 3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=moaA3 PE=3 SV=1 42 339 2.0E-51
sp|P62588|MOAA3_MYCBO Cyclic pyranopterin monophosphate synthase 3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=moaA3 PE=3 SV=1 42 339 2.0E-51
sp|A0LVG0|MOAA_ACIC1 Cyclic pyranopterin monophosphate synthase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=moaA PE=3 SV=1 42 340 3.0E-51
sp|B7VLU4|MOAA_VIBTL Cyclic pyranopterin monophosphate synthase OS=Vibrio tasmaniensis (strain LGP32) GN=moaA PE=3 SV=1 39 347 4.0E-51
sp|Q49ZI6|MOAA_STAS1 Cyclic pyranopterin monophosphate synthase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=moaA PE=3 SV=1 39 334 4.0E-51
sp|Q7N6P6|MOAA_PHOLL Cyclic pyranopterin monophosphate synthase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=moaA PE=3 SV=1 39 347 4.0E-51
sp|Q3V7S1|MOAA_RHOPA Cyclic pyranopterin monophosphate synthase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=moaA PE=3 SV=1 34 362 5.0E-51
sp|B0BNX2|MOAA_ACTPJ Cyclic pyranopterin monophosphate synthase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=moaA PE=3 SV=1 39 347 5.0E-51
sp|B3GXC5|MOAA_ACTP7 Cyclic pyranopterin monophosphate synthase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=moaA PE=3 SV=1 39 347 6.0E-51
sp|O67929|MOAA_AQUAE Cyclic pyranopterin monophosphate synthase OS=Aquifex aeolicus (strain VF5) GN=moaA PE=3 SV=1 41 315 6.0E-51
sp|Q7VLN1|MOAA_HAEDU Cyclic pyranopterin monophosphate synthase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=moaA PE=3 SV=1 35 312 7.0E-51
sp|B3QCQ7|MOAA_RHOPT Cyclic pyranopterin monophosphate synthase OS=Rhodopseudomonas palustris (strain TIE-1) GN=moaA PE=3 SV=1 34 362 1.0E-50
sp|Q7TX84|MOAA1_MYCBO Cyclic pyranopterin monophosphate synthase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=moaA1 PE=3 SV=1 42 336 1.0E-50
sp|Q92PB4|MOAA_RHIME Cyclic pyranopterin monophosphate synthase OS=Rhizobium meliloti (strain 1021) GN=moaA PE=3 SV=1 30 362 1.0E-50
sp|Q87MY0|MOAA_VIBPA Cyclic pyranopterin monophosphate synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=moaA PE=3 SV=1 39 347 1.0E-50
sp|P9WJS3|MOAA1_MYCTU Cyclic pyranopterin monophosphate synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=moaA1 PE=2 SV=1 51 336 1.0E-50
sp|P9WJS2|MOAA1_MYCTO Cyclic pyranopterin monophosphate synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=moaA1 PE=3 SV=1 51 336 1.0E-50
sp|C4LFK3|MOAA_TOLAT Cyclic pyranopterin monophosphate synthase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=moaA PE=3 SV=1 42 347 2.0E-50
sp|B1X0G3|MOAA_CYAA5 Cyclic pyranopterin monophosphate synthase OS=Cyanothece sp. (strain ATCC 51142) GN=moaA PE=3 SV=1 50 328 3.0E-50
sp|Q98MK6|MOAA_RHILO Cyclic pyranopterin monophosphate synthase OS=Rhizobium loti (strain MAFF303099) GN=moaA PE=3 SV=1 39 362 4.0E-50
sp|A7MJ10|MOAA_CROS8 Cyclic pyranopterin monophosphate synthase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=moaA PE=3 SV=1 39 347 1.0E-49
sp|Q21I62|MOAA_SACD2 Cyclic pyranopterin monophosphate synthase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=moaA PE=3 SV=1 40 347 1.0E-49
sp|P39757|MOAA_BACSU Cyclic pyranopterin monophosphate synthase OS=Bacillus subtilis (strain 168) GN=moaA PE=3 SV=1 39 336 2.0E-49
sp|A6Q5D0|MOAA_NITSB Cyclic pyranopterin monophosphate synthase OS=Nitratiruptor sp. (strain SB155-2) GN=moaA PE=3 SV=1 40 365 3.0E-49
sp|Q139F2|MOAA_RHOPS Cyclic pyranopterin monophosphate synthase OS=Rhodopseudomonas palustris (strain BisB5) GN=moaA PE=3 SV=1 42 362 3.0E-49
sp|Q30P92|MOAA_SULDN Cyclic pyranopterin monophosphate synthase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=moaA PE=3 SV=1 41 326 4.0E-49
sp|Q9K9W9|MOAA_BACHD Cyclic pyranopterin monophosphate synthase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=moaA PE=3 SV=1 32 334 4.0E-49
sp|A1VXP5|MOAA_CAMJJ Cyclic pyranopterin monophosphate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=moaA PE=3 SV=1 40 326 5.0E-49
sp|Q9PIW6|MOAA_CAMJE Cyclic pyranopterin monophosphate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=moaA PE=1 SV=1 40 326 5.0E-49
sp|A8FJX0|MOAA_CAMJ8 Cyclic pyranopterin monophosphate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=moaA PE=3 SV=1 40 326 5.0E-49
sp|Q89NT2|MOAA_BRADU Cyclic pyranopterin monophosphate synthase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=moaA PE=3 SV=1 36 362 6.0E-49
sp|Q7MM75|MOAA_VIBVY Cyclic pyranopterin monophosphate synthase OS=Vibrio vulnificus (strain YJ016) GN=moaA PE=3 SV=2 39 347 7.0E-49
sp|Q5HX04|MOAA_CAMJR Cyclic pyranopterin monophosphate synthase OS=Campylobacter jejuni (strain RM1221) GN=moaA PE=3 SV=1 40 326 1.0E-48
sp|Q8D894|MOAA_VIBVU Cyclic pyranopterin monophosphate synthase OS=Vibrio vulnificus (strain CMCP6) GN=moaA PE=3 SV=2 39 347 1.0E-48
sp|A7H1N9|MOAA_CAMJD Cyclic pyranopterin monophosphate synthase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=moaA PE=3 SV=1 41 326 1.0E-48
sp|B9KDV3|MOAA_CAMLR Cyclic pyranopterin monophosphate synthase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=moaA PE=3 SV=1 41 325 2.0E-48
sp|Q2NCE3|MOAA_ERYLH Cyclic pyranopterin monophosphate synthase OS=Erythrobacter litoralis (strain HTCC2594) GN=moaA PE=3 SV=1 39 347 2.0E-48
sp|C0PWZ0|MOAA_SALPC Cyclic pyranopterin monophosphate synthase OS=Salmonella paratyphi C (strain RKS4594) GN=moaA PE=3 SV=1 39 347 6.0E-48
sp|P65386|MOAA_SALTY Cyclic pyranopterin monophosphate synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=moaA PE=3 SV=1 39 347 6.0E-48
sp|P65387|MOAA_SALTI Cyclic pyranopterin monophosphate synthase OS=Salmonella typhi GN=moaA PE=3 SV=1 39 347 6.0E-48
sp|B4TQU6|MOAA_SALSV Cyclic pyranopterin monophosphate synthase OS=Salmonella schwarzengrund (strain CVM19633) GN=moaA PE=3 SV=1 39 347 6.0E-48
sp|B5BC24|MOAA_SALPK Cyclic pyranopterin monophosphate synthase OS=Salmonella paratyphi A (strain AKU_12601) GN=moaA PE=3 SV=1 39 347 6.0E-48
sp|Q5PG37|MOAA_SALPA Cyclic pyranopterin monophosphate synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=moaA PE=3 SV=1 39 347 6.0E-48
sp|B4SZK4|MOAA_SALNS Cyclic pyranopterin monophosphate synthase OS=Salmonella newport (strain SL254) GN=moaA PE=3 SV=1 39 347 6.0E-48
sp|B5F079|MOAA_SALA4 Cyclic pyranopterin monophosphate synthase OS=Salmonella agona (strain SL483) GN=moaA PE=3 SV=1 39 347 6.0E-48
sp|A9MTH7|MOAA_SALPB Cyclic pyranopterin monophosphate synthase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=moaA PE=3 SV=1 39 347 7.0E-48
sp|B5R769|MOAA_SALG2 Cyclic pyranopterin monophosphate synthase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=moaA PE=3 SV=1 39 347 8.0E-48
sp|B5QX73|MOAA_SALEP Cyclic pyranopterin monophosphate synthase OS=Salmonella enteritidis PT4 (strain P125109) GN=moaA PE=3 SV=1 39 347 8.0E-48
sp|B5FP68|MOAA_SALDC Cyclic pyranopterin monophosphate synthase OS=Salmonella dublin (strain CT_02021853) GN=moaA PE=3 SV=1 39 347 8.0E-48
sp|A7GWA5|MOAA_CAMC5 Cyclic pyranopterin monophosphate synthase OS=Campylobacter curvus (strain 525.92) GN=moaA PE=3 SV=1 41 326 1.0E-47
sp|A6VPY2|MOAA_ACTSZ Cyclic pyranopterin monophosphate synthase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=moaA PE=3 SV=1 39 347 1.0E-47
sp|A0RMJ2|MOAA_CAMFF Cyclic pyranopterin monophosphate synthase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=moaA PE=3 SV=1 40 347 2.0E-47
sp|Q8PNH1|MOAA_XANAC Cyclic pyranopterin monophosphate synthase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=moaA PE=3 SV=1 37 312 2.0E-47
sp|B4TC55|MOAA_SALHS Cyclic pyranopterin monophosphate synthase OS=Salmonella heidelberg (strain SL476) GN=moaA PE=3 SV=1 39 347 2.0E-47
sp|C3LA56|MOAA_BACAC Cyclic pyranopterin monophosphate synthase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=moaA PE=3 SV=1 41 348 2.0E-47
sp|A1B4A2|MOAA_PARDP Cyclic pyranopterin monophosphate synthase OS=Paracoccus denitrificans (strain Pd 1222) GN=moaA PE=3 SV=1 40 347 2.0E-47
sp|A8ERS0|MOAA_ARCB4 Cyclic pyranopterin monophosphate synthase OS=Arcobacter butzleri (strain RM4018) GN=moaA PE=3 SV=1 41 357 3.0E-47
sp|Q32I50|MOAA_SHIDS Cyclic pyranopterin monophosphate synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=moaA PE=3 SV=1 39 347 3.0E-47
sp|A7ZY37|MOAA_ECOHS Cyclic pyranopterin monophosphate synthase OS=Escherichia coli O9:H4 (strain HS) GN=moaA PE=3 SV=1 39 347 3.0E-47
sp|B7NA81|MOAA_ECOLU Cyclic pyranopterin monophosphate synthase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=moaA PE=3 SV=1 39 347 5.0E-47
sp|Q3Z403|MOAA_SHISS Cyclic pyranopterin monophosphate synthase OS=Shigella sonnei (strain Ss046) GN=moaA PE=3 SV=1 39 347 7.0E-47
sp|P30745|MOAA_ECOLI Cyclic pyranopterin monophosphate synthase OS=Escherichia coli (strain K12) GN=moaA PE=1 SV=1 39 347 7.0E-47
sp|B1X7B1|MOAA_ECODH Cyclic pyranopterin monophosphate synthase OS=Escherichia coli (strain K12 / DH10B) GN=moaA PE=3 SV=1 39 347 7.0E-47
sp|C4ZXV3|MOAA_ECOBW Cyclic pyranopterin monophosphate synthase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=moaA PE=3 SV=1 39 347 7.0E-47
sp|B7LJY1|MOAA_ESCF3 Cyclic pyranopterin monophosphate synthase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=moaA PE=3 SV=1 39 347 7.0E-47
sp|Q12T28|MOAA_SHEDO Cyclic pyranopterin monophosphate synthase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=moaA PE=3 SV=1 39 348 1.0E-46
sp|A8LIR8|MOAA_DINSH Cyclic pyranopterin monophosphate synthase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=moaA PE=3 SV=1 37 351 1.0E-46
sp|Q9CN21|MOAA_PASMU Cyclic pyranopterin monophosphate synthase OS=Pasteurella multocida (strain Pm70) GN=moaA PE=3 SV=1 41 347 1.0E-46
sp|Q83S40|MOAA_SHIFL Cyclic pyranopterin monophosphate synthase OS=Shigella flexneri GN=moaA PE=3 SV=4 39 347 1.0E-46
sp|Q324B1|MOAA_SHIBS Cyclic pyranopterin monophosphate synthase OS=Shigella boydii serotype 4 (strain Sb227) GN=moaA PE=3 SV=1 39 347 2.0E-46
sp|B1LM72|MOAA_ECOSM Cyclic pyranopterin monophosphate synthase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=moaA PE=3 SV=1 39 347 2.0E-46
sp|B6I7T6|MOAA_ECOSE Cyclic pyranopterin monophosphate synthase OS=Escherichia coli (strain SE11) GN=moaA PE=3 SV=1 39 347 2.0E-46
sp|P65382|MOAA_ECOL6 Cyclic pyranopterin monophosphate synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=moaA PE=3 SV=1 39 347 2.0E-46
sp|B7M753|MOAA_ECO8A Cyclic pyranopterin monophosphate synthase OS=Escherichia coli O8 (strain IAI1) GN=moaA PE=3 SV=1 39 347 2.0E-46
sp|B7MQN5|MOAA_ECO81 Cyclic pyranopterin monophosphate synthase OS=Escherichia coli O81 (strain ED1a) GN=moaA PE=3 SV=1 39 347 2.0E-46
sp|B5YRM0|MOAA_ECO5E Cyclic pyranopterin monophosphate synthase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=moaA PE=3 SV=1 39 347 2.0E-46
sp|P65383|MOAA_ECO57 Cyclic pyranopterin monophosphate synthase OS=Escherichia coli O157:H7 GN=moaA PE=3 SV=1 39 347 2.0E-46
sp|B7LC63|MOAA_ECO55 Cyclic pyranopterin monophosphate synthase OS=Escherichia coli (strain 55989 / EAEC) GN=moaA PE=3 SV=1 39 347 2.0E-46
sp|A7ZJJ0|MOAA_ECO24 Cyclic pyranopterin monophosphate synthase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=moaA PE=3 SV=1 39 347 2.0E-46
sp|C5B7H2|MOAA_EDWI9 Cyclic pyranopterin monophosphate synthase OS=Edwardsiella ictaluri (strain 93-146) GN=moaA PE=3 SV=1 39 347 2.0E-46
sp|A7ZB87|MOAA_CAMC1 Cyclic pyranopterin monophosphate synthase OS=Campylobacter concisus (strain 13826) GN=moaA PE=3 SV=1 41 336 2.0E-46
sp|Q6D3C7|MOAA_PECAS Cyclic pyranopterin monophosphate synthase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=moaA PE=3 SV=1 39 347 2.0E-46
sp|B7NNL1|MOAA_ECO7I Cyclic pyranopterin monophosphate synthase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=moaA PE=3 SV=1 39 347 3.0E-46
sp|B7MGN9|MOAA_ECO45 Cyclic pyranopterin monophosphate synthase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=moaA PE=3 SV=1 39 347 3.0E-46
sp|B2TVE9|MOAA_SHIB3 Cyclic pyranopterin monophosphate synthase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=moaA PE=3 SV=1 39 347 3.0E-46
sp|Q55369|MOAA_SYNY3 Cyclic pyranopterin monophosphate synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=moaA PE=3 SV=1 29 344 4.0E-46
sp|B7ULX8|MOAA_ECO27 Cyclic pyranopterin monophosphate synthase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=moaA PE=3 SV=1 39 347 4.0E-46
sp|B5XYW6|MOAA_KLEP3 Cyclic pyranopterin monophosphate synthase OS=Klebsiella pneumoniae (strain 342) GN=moaA PE=3 SV=1 39 347 7.0E-46
sp|A6Q6R2|MOAA_SULNB Cyclic pyranopterin monophosphate synthase OS=Sulfurovum sp. (strain NBC37-1) GN=moaA PE=3 SV=1 40 326 1.0E-45
sp|A6T6M5|MOAA_KLEP7 Cyclic pyranopterin monophosphate synthase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=moaA PE=3 SV=1 39 347 3.0E-45
sp|Q9ZL75|MOAA_HELPJ Cyclic pyranopterin monophosphate synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=moaA PE=3 SV=1 40 365 4.0E-45
sp|B6JM01|MOAA_HELP2 Cyclic pyranopterin monophosphate synthase OS=Helicobacter pylori (strain P12) GN=moaA PE=3 SV=1 40 365 2.0E-44
sp|P56414|MOAA_HELPY Cyclic pyranopterin monophosphate synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=moaA PE=3 SV=1 40 365 3.0E-44
sp|Q8PBX1|MOAA_XANCP Cyclic pyranopterin monophosphate synthase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=moaA PE=3 SV=1 42 312 2.0E-43
sp|Q4URN0|MOAA_XANC8 Cyclic pyranopterin monophosphate synthase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=moaA PE=3 SV=1 42 312 2.0E-43
sp|Q1CTA2|MOAA_HELPH Cyclic pyranopterin monophosphate synthase OS=Helicobacter pylori (strain HPAG1) GN=moaA PE=3 SV=1 40 365 2.0E-43
sp|B0RTE0|MOAA_XANCB Cyclic pyranopterin monophosphate synthase OS=Xanthomonas campestris pv. campestris (strain B100) GN=moaA PE=3 SV=1 42 312 3.0E-43
sp|Q8U4J5|MOAA_PYRFU Probable cyclic pyranopterin monophosphate synthase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=moaA PE=3 SV=1 40 344 8.0E-43
sp|O57854|MOAA_PYRHO Probable cyclic pyranopterin monophosphate synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=moaA PE=3 SV=2 40 344 9.0E-43
sp|Q3AVP9|MOAA_SYNS9 Cyclic pyranopterin monophosphate synthase OS=Synechococcus sp. (strain CC9902) GN=moaA PE=3 SV=1 41 338 1.0E-42
sp|Q5JHN5|MOAA_THEKO Probable cyclic pyranopterin monophosphate synthase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=moaA PE=3 SV=1 42 341 4.0E-42
sp|Q9V2G2|MOAA_PYRAB Probable cyclic pyranopterin monophosphate synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=moaA PE=3 SV=1 40 344 2.0E-40
sp|Q3AGB7|MOAA_SYNSC Cyclic pyranopterin monophosphate synthase OS=Synechococcus sp. (strain CC9605) GN=moaA PE=3 SV=1 40 338 3.0E-40
sp|Q9X5W3|MOAA_RHOCA Cyclic pyranopterin monophosphate synthase OS=Rhodobacter capsulatus GN=moaA PE=3 SV=1 40 348 8.0E-40
sp|Q0W3L5|MOAA_METAR Probable cyclic pyranopterin monophosphate synthase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=moaA PE=3 SV=1 40 340 9.0E-40
sp|O28273|MOAA_ARCFU Probable cyclic pyranopterin monophosphate synthase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=moaA PE=3 SV=1 42 349 4.0E-39
sp|B9LKK2|MOAC_CHLSY Cyclic pyranopterin monophosphate synthase accessory protein OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=moaC PE=3 SV=1 399 580 5.0E-38
sp|A9WG82|MOAC_CHLAA Cyclic pyranopterin monophosphate synthase accessory protein OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=moaC PE=3 SV=1 399 580 5.0E-38
sp|Q7U3H2|MOAA_SYNPX Cyclic pyranopterin monophosphate synthase OS=Synechococcus sp. (strain WH8102) GN=moaA PE=3 SV=1 40 312 6.0E-38
sp|A8FK41|MOAC_CAMJ8 Cyclic pyranopterin monophosphate synthase accessory protein OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=moaC PE=3 SV=1 400 580 1.0E-37
sp|Q5HWL3|MOAC_CAMJR Cyclic pyranopterin monophosphate synthase accessory protein OS=Campylobacter jejuni (strain RM1221) GN=moaC PE=3 SV=1 400 580 3.0E-37
sp|A7H1U7|MOAC_CAMJD Cyclic pyranopterin monophosphate synthase accessory protein OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=moaC PE=3 SV=1 400 580 9.0E-37
sp|B8G5X1|MOAC_CHLAD Cyclic pyranopterin monophosphate synthase accessory protein OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=moaC PE=3 SV=1 397 580 2.0E-36
sp|A1VXX6|MOAC_CAMJJ Cyclic pyranopterin monophosphate synthase accessory protein OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=moaC PE=3 SV=1 400 580 2.0E-36
sp|A8LMJ8|MOAC_DINSH Cyclic pyranopterin monophosphate synthase accessory protein OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=moaC PE=3 SV=1 399 578 3.0E-36
sp|B2UT33|MOAC_HELPS Cyclic pyranopterin monophosphate synthase accessory protein OS=Helicobacter pylori (strain Shi470) GN=moaC PE=3 SV=1 401 579 3.0E-36
sp|A9B327|MOAC_HERA2 Cyclic pyranopterin monophosphate synthase accessory protein OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=moaC PE=3 SV=1 401 582 4.0E-36
sp|A7HXZ9|MOAC_PARL1 Cyclic pyranopterin monophosphate synthase accessory protein OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=moaC PE=3 SV=1 397 578 5.0E-36
sp|Q9PIP3|MOAC_CAMJE Cyclic pyranopterin monophosphate synthase accessory protein OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=moaC PE=1 SV=1 400 580 7.0E-36
sp|B5Z7G0|MOAC_HELPG Cyclic pyranopterin monophosphate synthase accessory protein OS=Helicobacter pylori (strain G27) GN=moaC PE=3 SV=1 401 579 9.0E-36
sp|Q1CT72|MOAC_HELPH Cyclic pyranopterin monophosphate synthase accessory protein OS=Helicobacter pylori (strain HPAG1) GN=moaC PE=3 SV=1 401 579 1.0E-35
sp|B6JM29|MOAC_HELP2 Cyclic pyranopterin monophosphate synthase accessory protein OS=Helicobacter pylori (strain P12) GN=moaC PE=3 SV=1 401 579 1.0E-35
sp|C3MCF1|MOAC_RHISN Cyclic pyranopterin monophosphate synthase accessory protein OS=Rhizobium sp. (strain NGR234) GN=moaC PE=3 SV=1 397 580 1.0E-35
sp|P94328|MOAC_BRADU Cyclic pyranopterin monophosphate synthase accessory protein OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=moaC PE=3 SV=2 397 578 1.0E-35
sp|Q7VK40|MOAC_HELHP Cyclic pyranopterin monophosphate synthase accessory protein OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=moaC PE=3 SV=1 400 580 3.0E-35
sp|Q8UER6|MOAC_AGRFC Cyclic pyranopterin monophosphate synthase accessory protein OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=moaC PE=3 SV=1 396 580 3.0E-35
sp|A4WX66|MOAC_RHOS5 Cyclic pyranopterin monophosphate synthase accessory protein OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=moaC PE=3 SV=1 399 578 3.0E-35
sp|Q8CNE0|MOAC_STAES Cyclic pyranopterin monophosphate synthase accessory protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=moaC PE=3 SV=1 399 580 4.0E-35
sp|Q5HLX5|MOAC_STAEQ Cyclic pyranopterin monophosphate synthase accessory protein OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=moaC PE=3 SV=1 399 580 4.0E-35
sp|Q48260|MOAC_HELPY Cyclic pyranopterin monophosphate synthase accessory protein OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=moaC PE=3 SV=2 401 579 4.0E-35
sp|B9KMU9|MOAC_RHOSK Cyclic pyranopterin monophosphate synthase accessory protein OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=moaC PE=3 SV=1 399 578 5.0E-35
sp|Q9ZFA6|MOAC_RHOS4 Cyclic pyranopterin monophosphate synthase accessory protein OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=moaC PE=3 SV=1 399 578 5.0E-35
sp|Q3ADX7|MOAC_CARHZ Cyclic pyranopterin monophosphate synthase accessory protein OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=moaC PE=3 SV=1 400 580 5.0E-35
sp|Q3M7N0|MOAC_ANAVT Cyclic pyranopterin monophosphate synthase accessory protein OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=moaC PE=3 SV=1 397 578 7.0E-35
sp|Q9EYN8|MOAA_SYNPW Cyclic pyranopterin monophosphate synthase OS=Synechococcus sp. (strain WH7803) GN=moaA PE=3 SV=1 41 312 8.0E-35
sp|B8IPA1|MOAC_METNO Cyclic pyranopterin monophosphate synthase accessory protein OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=moaC PE=3 SV=1 401 578 8.0E-35
sp|Q8TUG2|MOAA_METAC Probable cyclic pyranopterin monophosphate synthase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=moaA PE=3 SV=1 40 344 1.0E-34
sp|Q3SL94|MOAC_THIDA Cyclic pyranopterin monophosphate synthase accessory protein OS=Thiobacillus denitrificans (strain ATCC 25259) GN=moaC PE=3 SV=1 399 578 2.0E-34
sp|B9E9E3|MOAC_MACCJ Cyclic pyranopterin monophosphate synthase accessory protein OS=Macrococcus caseolyticus (strain JCSC5402) GN=moaC PE=3 SV=1 399 580 2.0E-34
sp|A7INK0|MOAC_XANP2 Cyclic pyranopterin monophosphate synthase accessory protein OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=moaC PE=3 SV=1 399 578 2.0E-34
sp|A6U9C6|MOAC_SINMW Cyclic pyranopterin monophosphate synthase accessory protein OS=Sinorhizobium medicae (strain WSM419) GN=moaC PE=3 SV=1 397 580 2.0E-34
sp|Q92PR8|MOAC_RHIME Cyclic pyranopterin monophosphate synthase accessory protein OS=Rhizobium meliloti (strain 1021) GN=moaC PE=3 SV=1 397 580 4.0E-34
sp|A3PHK6|MOAC_RHOS1 Cyclic pyranopterin monophosphate synthase accessory protein OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=moaC PE=3 SV=1 399 578 5.0E-34
sp|A8I831|MOAC_AZOC5 Cyclic pyranopterin monophosphate synthase accessory protein OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=moaC PE=3 SV=1 399 578 5.0E-34
sp|B9KEM3|MOAC_CAMLR Cyclic pyranopterin monophosphate synthase accessory protein OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=moaC PE=3 SV=1 401 580 7.0E-34
sp|Q21R65|MOAC_RHOFT Cyclic pyranopterin monophosphate synthase accessory protein OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=moaC PE=3 SV=1 399 578 7.0E-34
sp|Q8PX29|MOAA_METMA Probable cyclic pyranopterin monophosphate synthase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=moaA PE=3 SV=1 40 312 9.0E-34
sp|Q9ZL46|MOAC_HELPJ Cyclic pyranopterin monophosphate synthase accessory protein OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=moaC PE=3 SV=1 401 579 1.0E-33
sp|Q8YHF9|MOAC_BRUME Cyclic pyranopterin monophosphate synthase accessory protein OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=moaC PE=3 SV=1 398 579 1.0E-33
sp|C0RJB2|MOAC_BRUMB Cyclic pyranopterin monophosphate synthase accessory protein OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=moaC PE=3 SV=1 398 579 1.0E-33
sp|A5UQR2|MOAC_ROSS1 Cyclic pyranopterin monophosphate synthase accessory protein OS=Roseiflexus sp. (strain RS-1) GN=moaC PE=3 SV=1 399 578 1.0E-33
sp|A5VQR6|MOAC_BRUO2 Cyclic pyranopterin monophosphate synthase accessory protein OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=moaC PE=3 SV=1 398 579 1.0E-33
sp|Q57CZ7|MOAC_BRUAB Cyclic pyranopterin monophosphate synthase accessory protein OS=Brucella abortus biovar 1 (strain 9-941) GN=moaC PE=3 SV=1 398 579 1.0E-33
sp|Q2YRR3|MOAC_BRUA2 Cyclic pyranopterin monophosphate synthase accessory protein OS=Brucella abortus (strain 2308) GN=moaC PE=3 SV=1 398 579 1.0E-33
sp|B2S5Z2|MOAC_BRUA1 Cyclic pyranopterin monophosphate synthase accessory protein OS=Brucella abortus (strain S19) GN=moaC PE=3 SV=1 398 579 1.0E-33
sp|B6IQ15|MOAC_RHOCS Cyclic pyranopterin monophosphate synthase accessory protein OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=moaC PE=3 SV=1 396 578 1.0E-33
sp|A7GTZ9|MOAC_BACCN Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=moaC PE=3 SV=1 399 580 1.0E-33
sp|Q111C2|MOAC_TRIEI Cyclic pyranopterin monophosphate synthase accessory protein OS=Trichodesmium erythraeum (strain IMS101) GN=moaC PE=3 SV=1 401 578 2.0E-33
sp|Q30NY7|MOAC_SULDN Cyclic pyranopterin monophosphate synthase accessory protein OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=moaC PE=3 SV=1 400 580 2.0E-33
sp|Q971H1|MOAA_SULTO Probable cyclic pyranopterin monophosphate synthase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=moaA PE=3 SV=1 41 339 2.0E-33
sp|C5D4E6|MOAC_GEOSW Cyclic pyranopterin monophosphate synthase accessory protein OS=Geobacillus sp. (strain WCH70) GN=moaC PE=3 SV=1 399 580 3.0E-33
sp|A6X0K9|MOAC_OCHA4 Cyclic pyranopterin monophosphate synthase accessory protein OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=moaC PE=3 SV=1 399 578 4.0E-33
sp|A9AFU0|MOAC_BURM1 Cyclic pyranopterin monophosphate synthase accessory protein OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=moaC PE=3 SV=1 399 578 5.0E-33
sp|A8EX06|MOAC_ARCB4 Cyclic pyranopterin monophosphate synthase accessory protein OS=Arcobacter butzleri (strain RM4018) GN=moaC PE=3 SV=1 400 580 5.0E-33
sp|B2IKL8|MOAC_BEII9 Cyclic pyranopterin monophosphate synthase accessory protein OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=moaC PE=3 SV=1 399 580 5.0E-33
sp|A4IJU6|MOAC_GEOTN Cyclic pyranopterin monophosphate synthase accessory protein OS=Geobacillus thermodenitrificans (strain NG80-2) GN=moaC PE=3 SV=1 399 580 5.0E-33
sp|B2UGE9|MOAC_RALPJ Cyclic pyranopterin monophosphate synthase accessory protein OS=Ralstonia pickettii (strain 12J) GN=moaC PE=3 SV=1 399 578 6.0E-33
sp|Q8YRR1|MOAC_NOSS1 Cyclic pyranopterin monophosphate synthase accessory protein OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=moaC PE=3 SV=1 397 578 6.0E-33
sp|Q979T0|MOAA_THEVO Probable cyclic pyranopterin monophosphate synthase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=moaA PE=3 SV=1 42 344 6.0E-33
sp|Q1H4W7|MOAC_METFK Cyclic pyranopterin monophosphate synthase accessory protein OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=moaC PE=3 SV=1 399 578 8.0E-33
sp|Q39056|CNX3_ARATH Cyclic pyranopterin monophosphate synthase accessory protein, mitochondrial OS=Arabidopsis thaliana GN=CNX3 PE=1 SV=1 375 581 8.0E-33
sp|A6UX30|MOAA_META3 Probable cyclic pyranopterin monophosphate synthase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=moaA PE=3 SV=1 42 323 9.0E-33
sp|B0T229|MOAC_CAUSK Cyclic pyranopterin monophosphate synthase accessory protein OS=Caulobacter sp. (strain K31) GN=moaC PE=3 SV=1 399 578 1.0E-32
sp|A7MJ08|MOAC_CROS8 Cyclic pyranopterin monophosphate synthase accessory protein OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=moaC PE=3 SV=1 399 578 2.0E-32
sp|B0U7Z3|MOAC_METS4 Cyclic pyranopterin monophosphate synthase accessory protein OS=Methylobacterium sp. (strain 4-46) GN=moaC PE=3 SV=1 399 579 2.0E-32
sp|Q8G0F3|MOAC_BRUSU Cyclic pyranopterin monophosphate synthase accessory protein OS=Brucella suis biovar 1 (strain 1330) GN=moaC PE=3 SV=1 398 579 2.0E-32
sp|B0CGU0|MOAC_BRUSI Cyclic pyranopterin monophosphate synthase accessory protein OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=moaC PE=3 SV=1 398 579 2.0E-32
sp|A9M5F5|MOAC_BRUC2 Cyclic pyranopterin monophosphate synthase accessory protein OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=moaC PE=3 SV=1 398 579 2.0E-32
sp|Q0VQ23|MOAC_ALCBS Cyclic pyranopterin monophosphate synthase accessory protein OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=moaC PE=3 SV=1 400 580 3.0E-32
sp|Q2RQI5|MOAC_RHORT Cyclic pyranopterin monophosphate synthase accessory protein OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=moaC PE=3 SV=1 396 579 3.0E-32
sp|Q5L3F4|MOAC_GEOKA Cyclic pyranopterin monophosphate synthase accessory protein OS=Geobacillus kaustophilus (strain HTA426) GN=moaC PE=1 SV=1 399 580 3.0E-32
sp|B1JY03|MOAC_BURCC Cyclic pyranopterin monophosphate synthase accessory protein OS=Burkholderia cenocepacia (strain MC0-3) GN=moaC PE=3 SV=1 399 578 4.0E-32
sp|O27593|MOAA_METTH Probable cyclic pyranopterin monophosphate synthase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=moaA PE=3 SV=2 42 312 4.0E-32
sp|P9WJR5|MOAC3_MYCTU Cyclic pyranopterin monophosphate synthase accessory protein 3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=moaC3 PE=3 SV=1 401 580 5.0E-32
sp|P9WJR4|MOAC3_MYCTO Cyclic pyranopterin monophosphate synthase accessory protein 3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=moaC3 PE=3 SV=1 401 580 5.0E-32
sp|P65393|MOAC3_MYCBO Cyclic pyranopterin monophosphate synthase accessory protein 3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=moaC3 PE=3 SV=1 401 580 5.0E-32
sp|Q980F0|MOAA_SULSO Probable cyclic pyranopterin monophosphate synthase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=moaA PE=3 SV=1 41 330 5.0E-32
sp|B1VTN7|MOAC_STRGG Cyclic pyranopterin monophosphate synthase accessory protein OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=moaC PE=3 SV=1 389 580 6.0E-32
sp|A5FXW0|MOAC_ACICJ Cyclic pyranopterin monophosphate synthase accessory protein OS=Acidiphilium cryptum (strain JF-5) GN=moaC PE=3 SV=1 399 578 9.0E-32
sp|B2JDC4|MOAC_BURP8 Cyclic pyranopterin monophosphate synthase accessory protein OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=moaC PE=3 SV=1 400 578 9.0E-32
sp|B5XYW4|MOAC_KLEP3 Cyclic pyranopterin monophosphate synthase accessory protein OS=Klebsiella pneumoniae (strain 342) GN=moaC PE=3 SV=1 399 578 1.0E-31
sp|A0KA61|MOAC_BURCH Cyclic pyranopterin monophosphate synthase accessory protein OS=Burkholderia cenocepacia (strain HI2424) GN=moaC PE=3 SV=1 399 578 1.0E-31
sp|Q1BTX7|MOAC_BURCA Cyclic pyranopterin monophosphate synthase accessory protein OS=Burkholderia cenocepacia (strain AU 1054) GN=moaC PE=3 SV=1 399 578 1.0E-31
sp|Q603S0|MOAC_METCA Cyclic pyranopterin monophosphate synthase accessory protein OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=moaC PE=3 SV=1 400 580 1.0E-31
sp|B1YVX4|MOAC_BURA4 Cyclic pyranopterin monophosphate synthase accessory protein OS=Burkholderia ambifaria (strain MC40-6) GN=moaC PE=3 SV=1 399 578 1.0E-31
sp|C5CRA3|MOAC_VARPS Cyclic pyranopterin monophosphate synthase accessory protein OS=Variovorax paradoxus (strain S110) GN=moaC PE=3 SV=1 399 578 1.0E-31
sp|C3MXF3|MOAA_SULIM Probable cyclic pyranopterin monophosphate synthase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=moaA PE=3 SV=1 41 330 1.0E-31
sp|C4KIH7|MOAA_SULIK Probable cyclic pyranopterin monophosphate synthase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=moaA PE=3 SV=1 41 330 1.0E-31
sp|C3MZ99|MOAA_SULIA Probable cyclic pyranopterin monophosphate synthase OS=Sulfolobus islandicus (strain M.16.27) GN=moaA PE=3 SV=1 41 330 1.0E-31
sp|A6T6M7|MOAC_KLEP7 Cyclic pyranopterin monophosphate synthase accessory protein OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=moaC PE=3 SV=1 399 578 1.0E-31
sp|Q9AC52|MOAC_CAUCR Cyclic pyranopterin monophosphate synthase accessory protein OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=moaC PE=3 SV=2 399 578 1.0E-31
sp|B8GWX1|MOAC_CAUCN Cyclic pyranopterin monophosphate synthase accessory protein OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=moaC PE=3 SV=1 399 578 1.0E-31
sp|A4JHJ1|MOAC_BURVG Cyclic pyranopterin monophosphate synthase accessory protein OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=moaC PE=3 SV=1 399 579 2.0E-31
sp|Q28R69|MOAC_JANSC Cyclic pyranopterin monophosphate synthase accessory protein OS=Jannaschia sp. (strain CCS1) GN=moaC PE=3 SV=1 399 578 2.0E-31
sp|Q4L8D8|MOAC_STAHJ Cyclic pyranopterin monophosphate synthase accessory protein OS=Staphylococcus haemolyticus (strain JCSC1435) GN=moaC PE=3 SV=1 399 580 2.0E-31
sp|A4W8C6|MOAC_ENT38 Cyclic pyranopterin monophosphate synthase accessory protein OS=Enterobacter sp. (strain 638) GN=moaC PE=3 SV=1 399 578 2.0E-31
sp|Q98ME2|MOAC_RHILO Cyclic pyranopterin monophosphate synthase accessory protein OS=Rhizobium loti (strain MAFF303099) GN=moaC PE=3 SV=1 399 578 2.0E-31
sp|B8FMV2|MOAC_DESAA Cyclic pyranopterin monophosphate synthase accessory protein OS=Desulfatibacillum alkenivorans (strain AK-01) GN=moaC PE=3 SV=1 399 578 3.0E-31
sp|A9MIU5|MOAC_SALAR Cyclic pyranopterin monophosphate synthase accessory protein OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=moaC PE=3 SV=1 399 578 3.0E-31
sp|A5UBK5|MOAC_HAEIE Cyclic pyranopterin monophosphate synthase accessory protein OS=Haemophilus influenzae (strain PittEE) GN=moaC PE=3 SV=1 401 578 3.0E-31
sp|A0L7R3|MOAC_MAGMM Cyclic pyranopterin monophosphate synthase accessory protein OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=moaC PE=3 SV=1 401 580 3.0E-31
sp|A8AJ02|MOAC_CITK8 Cyclic pyranopterin monophosphate synthase accessory protein OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=moaC PE=3 SV=1 399 578 3.0E-31
sp|Q0BC82|MOAC_BURCM Cyclic pyranopterin monophosphate synthase accessory protein OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=moaC PE=3 SV=1 399 578 4.0E-31
sp|A6VPY1|MOAC_ACTSZ Cyclic pyranopterin monophosphate synthase accessory protein OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=moaC PE=3 SV=1 399 578 4.0E-31
sp|Q0KE68|MOAC_CUPNH Cyclic pyranopterin monophosphate synthase accessory protein OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=moaC PE=3 SV=1 399 578 4.0E-31
sp|Q97HL9|MOAC_CLOAB Cyclic pyranopterin monophosphate synthase accessory protein OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=moaC PE=3 SV=1 401 581 4.0E-31
sp|B2AHC7|MOAC_CUPTR Cyclic pyranopterin monophosphate synthase accessory protein OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=moaC PE=3 SV=1 399 578 4.0E-31
sp|C3LTS3|MOAC_VIBCM Cyclic pyranopterin monophosphate synthase accessory protein OS=Vibrio cholerae serotype O1 (strain M66-2) GN=moaC PE=3 SV=1 399 578 5.0E-31
sp|Q9KT79|MOAC_VIBCH Cyclic pyranopterin monophosphate synthase accessory protein OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=moaC PE=3 SV=1 399 578 5.0E-31
sp|A5F2Q7|MOAC_VIBC3 Cyclic pyranopterin monophosphate synthase accessory protein OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=moaC PE=3 SV=1 399 578 5.0E-31
sp|Q8Y1X7|MOAC_RALSO Cyclic pyranopterin monophosphate synthase accessory protein OS=Ralstonia solanacearum (strain GMI1000) GN=moaC PE=3 SV=1 401 578 5.0E-31
sp|Q2NUJ1|MOAC_SODGM Cyclic pyranopterin monophosphate synthase accessory protein OS=Sodalis glossinidius (strain morsitans) GN=moaC PE=3 SV=1 399 579 6.0E-31
sp|P45310|MOAC_HAEIN Cyclic pyranopterin monophosphate synthase accessory protein OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=moaC PE=3 SV=1 401 578 6.0E-31
sp|Q6HCF7|MOAC_BACHK Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=moaC PE=3 SV=1 399 580 6.0E-31
sp|B0BNX3|MOAC_ACTPJ Cyclic pyranopterin monophosphate synthase accessory protein OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=moaC PE=3 SV=1 399 579 6.0E-31
sp|B3GXC6|MOAC_ACTP7 Cyclic pyranopterin monophosphate synthase accessory protein OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=moaC PE=3 SV=1 399 579 6.0E-31
sp|A3N055|MOAC_ACTP2 Cyclic pyranopterin monophosphate synthase accessory protein OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=moaC PE=3 SV=1 399 579 6.0E-31
sp|Q475L1|MOAC_CUPPJ Cyclic pyranopterin monophosphate synthase accessory protein OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=moaC PE=3 SV=1 399 578 7.0E-31
sp|A1SWP5|MOAC_PSYIN Cyclic pyranopterin monophosphate synthase accessory protein OS=Psychromonas ingrahamii (strain 37) GN=moaC PE=3 SV=1 401 579 7.0E-31
sp|C3NGB5|MOAA_SULIN Probable cyclic pyranopterin monophosphate synthase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=moaA PE=3 SV=1 41 330 7.0E-31
sp|A6Q6C1|MOAC_SULNB Cyclic pyranopterin monophosphate synthase accessory protein OS=Sulfurovum sp. (strain NBC37-1) GN=moaC PE=3 SV=1 401 580 8.0E-31
sp|B5R771|MOAC_SALG2 Cyclic pyranopterin monophosphate synthase accessory protein OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=moaC PE=3 SV=1 399 578 8.0E-31
sp|B5QX75|MOAC_SALEP Cyclic pyranopterin monophosphate synthase accessory protein OS=Salmonella enteritidis PT4 (strain P125109) GN=moaC PE=3 SV=1 399 578 8.0E-31
sp|B5FP70|MOAC_SALDC Cyclic pyranopterin monophosphate synthase accessory protein OS=Salmonella dublin (strain CT_02021853) GN=moaC PE=3 SV=1 399 578 8.0E-31
sp|Q13UI4|MOAC_BURXL Cyclic pyranopterin monophosphate synthase accessory protein OS=Burkholderia xenovorans (strain LB400) GN=moaC PE=3 SV=1 400 578 8.0E-31
sp|A7ZY39|MOAC_ECOHS Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli O9:H4 (strain HS) GN=moaC PE=3 SV=1 399 578 8.0E-31
sp|Q58234|MOAA_METJA Probable cyclic pyranopterin monophosphate synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=moaA PE=3 SV=1 42 323 9.0E-31
sp|Q93KD0|MOAC_EUBAC Cyclic pyranopterin monophosphate synthase accessory protein OS=Eubacterium acidaminophilum GN=moaC PE=3 SV=2 400 580 1.0E-30
sp|A5UFB3|MOAC_HAEIG Cyclic pyranopterin monophosphate synthase accessory protein OS=Haemophilus influenzae (strain PittGG) GN=moaC PE=3 SV=1 401 578 1.0E-30
sp|C3N7B9|MOAA_SULIY Probable cyclic pyranopterin monophosphate synthase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=moaA PE=3 SV=1 41 330 1.0E-30
sp|C3MR64|MOAA_SULIL Probable cyclic pyranopterin monophosphate synthase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=moaA PE=3 SV=1 41 330 1.0E-30
sp|B2VBW5|MOAC_ERWT9 Cyclic pyranopterin monophosphate synthase accessory protein OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=moaC PE=3 SV=1 399 581 1.0E-30
sp|Q816U4|MOAC_BACCR Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=moaC PE=3 SV=1 399 580 1.0E-30
sp|B7H782|MOAC_BACC4 Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus cereus (strain B4264) GN=moaC PE=3 SV=1 399 580 1.0E-30
sp|B7IKZ0|MOAC_BACC2 Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus cereus (strain G9842) GN=moaC PE=3 SV=1 399 580 1.0E-30
sp|Q8ZQQ1|MOAC_SALTY Cyclic pyranopterin monophosphate synthase accessory protein OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=moaC PE=3 SV=3 399 578 1.0E-30
sp|B4TQU8|MOAC_SALSV Cyclic pyranopterin monophosphate synthase accessory protein OS=Salmonella schwarzengrund (strain CVM19633) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|B5BC22|MOAC_SALPK Cyclic pyranopterin monophosphate synthase accessory protein OS=Salmonella paratyphi A (strain AKU_12601) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|C0PWZ2|MOAC_SALPC Cyclic pyranopterin monophosphate synthase accessory protein OS=Salmonella paratyphi C (strain RKS4594) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|A9MTH5|MOAC_SALPB Cyclic pyranopterin monophosphate synthase accessory protein OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|Q5PG39|MOAC_SALPA Cyclic pyranopterin monophosphate synthase accessory protein OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|B4SZK6|MOAC_SALNS Cyclic pyranopterin monophosphate synthase accessory protein OS=Salmonella newport (strain SL254) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|B4TC57|MOAC_SALHS Cyclic pyranopterin monophosphate synthase accessory protein OS=Salmonella heidelberg (strain SL476) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|Q57RF3|MOAC_SALCH Cyclic pyranopterin monophosphate synthase accessory protein OS=Salmonella choleraesuis (strain SC-B67) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|B5F081|MOAC_SALA4 Cyclic pyranopterin monophosphate synthase accessory protein OS=Salmonella agona (strain SL483) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|P0A741|MOAC_SHIFL Cyclic pyranopterin monophosphate synthase accessory protein OS=Shigella flexneri GN=moaC PE=3 SV=2 399 578 1.0E-30
sp|Q0T6H7|MOAC_SHIF8 Cyclic pyranopterin monophosphate synthase accessory protein OS=Shigella flexneri serotype 5b (strain 8401) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|Q32I52|MOAC_SHIDS Cyclic pyranopterin monophosphate synthase accessory protein OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|Q324A9|MOAC_SHIBS Cyclic pyranopterin monophosphate synthase accessory protein OS=Shigella boydii serotype 4 (strain Sb227) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|B2TVE7|MOAC_SHIB3 Cyclic pyranopterin monophosphate synthase accessory protein OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|B7LJX9|MOAC_ESCF3 Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|Q1REE5|MOAC_ECOUT Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli (strain UTI89 / UPEC) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|B1LM74|MOAC_ECOSM Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|B6I7T8|MOAC_ECOSE Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli (strain SE11) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|B7NA83|MOAC_ECOLU Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|P0A738|MOAC_ECOLI Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli (strain K12) GN=moaC PE=1 SV=2 399 578 1.0E-30
sp|B1IXI5|MOAC_ECOLC Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|P0A739|MOAC_ECOL6 Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=moaC PE=3 SV=2 399 578 1.0E-30
sp|Q0TJR5|MOAC_ECOL5 Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|A1A925|MOAC_ECOK1 Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli O1:K1 / APEC GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|B1X7B3|MOAC_ECODH Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli (strain K12 / DH10B) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|C4ZXV5|MOAC_ECOBW Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|B7M755|MOAC_ECO8A Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli O8 (strain IAI1) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|B7MQN7|MOAC_ECO81 Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli O81 (strain ED1a) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|B7NNL3|MOAC_ECO7I Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|B5YRM2|MOAC_ECO5E Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|P0A740|MOAC_ECO57 Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli O157:H7 GN=moaC PE=3 SV=2 399 578 1.0E-30
sp|B7LC65|MOAC_ECO55 Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli (strain 55989 / EAEC) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|B7MGP1|MOAC_ECO45 Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|B7ULY0|MOAC_ECO27 Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|A7ZJJ2|MOAC_ECO24 Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|B4ESV1|MOAC_PROMH Cyclic pyranopterin monophosphate synthase accessory protein OS=Proteus mirabilis (strain HI4320) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|Q0AVU7|MOAC_SYNWW Cyclic pyranopterin monophosphate synthase accessory protein OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=moaC PE=3 SV=1 401 580 1.0E-30
sp|Q7MM73|MOAC_VIBVY Cyclic pyranopterin monophosphate synthase accessory protein OS=Vibrio vulnificus (strain YJ016) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|B1HQT3|MOAC_LYSSC Cyclic pyranopterin monophosphate synthase accessory protein OS=Lysinibacillus sphaericus (strain C3-41) GN=moaC PE=3 SV=1 399 579 1.0E-30
sp|B5FCP1|MOAC_VIBFM Cyclic pyranopterin monophosphate synthase accessory protein OS=Vibrio fischeri (strain MJ11) GN=moaC PE=3 SV=1 399 578 2.0E-30
sp|Q5E6B0|MOAC_VIBF1 Cyclic pyranopterin monophosphate synthase accessory protein OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=moaC PE=3 SV=1 399 578 2.0E-30
sp|Q65TT1|MOAC_MANSM Cyclic pyranopterin monophosphate synthase accessory protein OS=Mannheimia succiniciproducens (strain MBEL55E) GN=moaC PE=3 SV=1 399 578 2.0E-30
sp|B2V3T7|MOAC_CLOBA Cyclic pyranopterin monophosphate synthase accessory protein OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=moaC PE=3 SV=1 399 578 2.0E-30
sp|B9J1C6|MOAC_BACCQ Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus cereus (strain Q1) GN=moaC PE=3 SV=1 399 580 2.0E-30
sp|B7HSR1|MOAC_BACC7 Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus cereus (strain AH187) GN=moaC PE=3 SV=1 399 580 2.0E-30
sp|Q72Z05|MOAC_BACC1 Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=moaC PE=3 SV=1 399 580 2.0E-30
sp|Q632W7|MOAC_BACCZ Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus cereus (strain ZK / E33L) GN=moaC PE=3 SV=1 399 580 2.0E-30
sp|C1EVZ1|MOAC_BACC3 Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus cereus (strain 03BB102) GN=moaC PE=3 SV=1 399 580 2.0E-30
sp|B7JSY7|MOAC_BACC0 Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus cereus (strain AH820) GN=moaC PE=3 SV=1 399 580 2.0E-30
sp|Q81KM1|MOAC_BACAN Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus anthracis GN=moaC PE=3 SV=1 399 580 2.0E-30
sp|A0RJV9|MOAC_BACAH Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus thuringiensis (strain Al Hakam) GN=moaC PE=3 SV=1 399 580 2.0E-30
sp|C3LA30|MOAC_BACAC Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=moaC PE=3 SV=1 399 580 2.0E-30
sp|C3PBI3|MOAC_BACAA Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus anthracis (strain A0248) GN=moaC PE=3 SV=1 399 580 2.0E-30
sp|Q87MY2|MOAC_VIBPA Cyclic pyranopterin monophosphate synthase accessory protein OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=moaC PE=3 SV=1 399 578 2.0E-30
sp|A7MVD3|MOAC_VIBCB Cyclic pyranopterin monophosphate synthase accessory protein OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=moaC PE=3 SV=1 399 578 2.0E-30
sp|Q82H75|MOAC_STRAW Cyclic pyranopterin monophosphate synthase accessory protein OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=moaC PE=3 SV=1 400 580 2.0E-30
sp|B0TI15|MOAC_HELMI Cyclic pyranopterin monophosphate synthase accessory protein OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=moaC PE=3 SV=1 401 580 2.0E-30
sp|A6US67|MOAA_METVS Probable cyclic pyranopterin monophosphate synthase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=moaA PE=3 SV=1 42 312 2.0E-30
sp|B4EBZ2|MOAC_BURCJ Cyclic pyranopterin monophosphate synthase accessory protein OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=moaC PE=3 SV=1 399 578 2.0E-30
sp|Q39DA3|MOAC_BURL3 Cyclic pyranopterin monophosphate synthase accessory protein OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=moaC PE=3 SV=1 399 578 2.0E-30
sp|B8GPA2|MOAC_THISH Cyclic pyranopterin monophosphate synthase accessory protein OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=moaC PE=3 SV=1 399 578 2.0E-30
sp|Q8D896|MOAC_VIBVU Cyclic pyranopterin monophosphate synthase accessory protein OS=Vibrio vulnificus (strain CMCP6) GN=moaC PE=3 SV=1 399 578 2.0E-30
sp|Q1LR54|MOAC_CUPMC Cyclic pyranopterin monophosphate synthase accessory protein OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=moaC PE=3 SV=1 399 578 2.0E-30
sp|A7NQR0|MOAC_ROSCS Cyclic pyranopterin monophosphate synthase accessory protein OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=moaC PE=3 SV=1 399 578 2.0E-30
sp|Q9RKA8|MOAC_STRCO Cyclic pyranopterin monophosphate synthase accessory protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=moaC PE=3 SV=1 389 580 3.0E-30
sp|B0K0F7|MOAC_THEPX Cyclic pyranopterin monophosphate synthase accessory protein OS=Thermoanaerobacter sp. (strain X514) GN=moaC PE=3 SV=1 401 580 3.0E-30
sp|A8GBD6|MOAC_SERP5 Cyclic pyranopterin monophosphate synthase accessory protein OS=Serratia proteamaculans (strain 568) GN=moaC PE=3 SV=1 399 578 3.0E-30
sp|B0K8Q5|MOAC_THEP3 Cyclic pyranopterin monophosphate synthase accessory protein OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=moaC PE=3 SV=1 401 580 4.0E-30
sp|B2THM0|MOAC_CLOBB Cyclic pyranopterin monophosphate synthase accessory protein OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=moaC PE=3 SV=1 399 578 4.0E-30
sp|Q8Z887|MOAC_SALTI Cyclic pyranopterin monophosphate synthase accessory protein OS=Salmonella typhi GN=moaC PE=3 SV=3 399 578 5.0E-30
sp|Q3Z401|MOAC_SHISS Cyclic pyranopterin monophosphate synthase accessory protein OS=Shigella sonnei (strain Ss046) GN=moaC PE=3 SV=1 399 578 5.0E-30
sp|Q49ZJ2|MOAC_STAS1 Cyclic pyranopterin monophosphate synthase accessory protein OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=moaC PE=3 SV=1 399 580 5.0E-30
sp|C0QKG6|MOAC_DESAH Cyclic pyranopterin monophosphate synthase accessory protein OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=moaC PE=3 SV=1 399 578 6.0E-30
sp|A9BQ97|MOAC_DELAS Cyclic pyranopterin monophosphate synthase accessory protein OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=moaC PE=3 SV=1 399 575 6.0E-30
sp|B9L0K8|MOAC_THERP Cyclic pyranopterin monophosphate synthase accessory protein OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=moaC PE=3 SV=1 399 580 7.0E-30
sp|B2SYE3|MOAC_BURPP Cyclic pyranopterin monophosphate synthase accessory protein OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=moaC PE=3 SV=1 400 578 7.0E-30
sp|Q7WB92|MOAC_BORPA Cyclic pyranopterin monophosphate synthase accessory protein OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=moaC PE=3 SV=1 396 578 8.0E-30
sp|B8FNT2|MOAC_DESHD Cyclic pyranopterin monophosphate synthase accessory protein OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=moaC PE=3 SV=1 400 580 9.0E-30
sp|B1JSR4|MOAC_YERPY Cyclic pyranopterin monophosphate synthase accessory protein OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=moaC PE=3 SV=1 399 578 1.0E-29
sp|A1JSH7|MOAC_YERE8 Cyclic pyranopterin monophosphate synthase accessory protein OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=moaC PE=3 SV=1 399 578 1.0E-29
sp|Q66D58|MOAC_YERPS Cyclic pyranopterin monophosphate synthase accessory protein OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=moaC PE=3 SV=1 399 578 1.0E-29
sp|B2K8U0|MOAC_YERPB Cyclic pyranopterin monophosphate synthase accessory protein OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=moaC PE=3 SV=1 399 578 1.0E-29
sp|Q3AVP2|MOAC_SYNS9 Cyclic pyranopterin monophosphate synthase accessory protein OS=Synechococcus sp. (strain CC9902) GN=moaC PE=3 SV=1 397 580 1.0E-29
sp|B6EGI3|MOAC_ALISL Cyclic pyranopterin monophosphate synthase accessory protein OS=Aliivibrio salmonicida (strain LFI1238) GN=moaC PE=3 SV=1 399 578 1.0E-29
sp|Q0HQ78|MOAC_SHESR Cyclic pyranopterin monophosphate synthase accessory protein OS=Shewanella sp. (strain MR-7) GN=moaC PE=3 SV=1 401 578 2.0E-29
sp|Q0HNL3|MOAC_SHESM Cyclic pyranopterin monophosphate synthase accessory protein OS=Shewanella sp. (strain MR-4) GN=moaC PE=3 SV=1 401 578 2.0E-29
sp|A0KRU9|MOAC_SHESA Cyclic pyranopterin monophosphate synthase accessory protein OS=Shewanella sp. (strain ANA-3) GN=moaC PE=3 SV=1 401 578 2.0E-29
sp|Q8E942|MOAC_SHEON Cyclic pyranopterin monophosphate synthase accessory protein OS=Shewanella oneidensis (strain MR-1) GN=moaC PE=3 SV=1 401 578 2.0E-29
sp|A1AWX5|MOAC_RUTMC Cyclic pyranopterin monophosphate synthase accessory protein OS=Ruthia magnifica subsp. Calyptogena magnifica GN=moaC PE=3 SV=1 400 578 2.0E-29
sp|A7Z200|MOAC_BACMF Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=moaC PE=3 SV=1 401 580 2.0E-29
sp|Q9CN22|MOAC_PASMU Cyclic pyranopterin monophosphate synthase accessory protein OS=Pasteurella multocida (strain Pm70) GN=moaC PE=3 SV=1 399 578 2.0E-29
sp|A4TNP7|MOAC_YERPP Cyclic pyranopterin monophosphate synthase accessory protein OS=Yersinia pestis (strain Pestoides F) GN=moaC PE=3 SV=1 399 578 2.0E-29
sp|Q1CFR2|MOAC_YERPN Cyclic pyranopterin monophosphate synthase accessory protein OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=moaC PE=3 SV=1 399 578 2.0E-29
sp|A9R3D8|MOAC_YERPG Cyclic pyranopterin monophosphate synthase accessory protein OS=Yersinia pestis bv. Antiqua (strain Angola) GN=moaC PE=3 SV=1 399 578 2.0E-29
sp|Q8ZGW4|MOAC_YERPE Cyclic pyranopterin monophosphate synthase accessory protein OS=Yersinia pestis GN=moaC PE=3 SV=1 399 578 2.0E-29
sp|Q1C938|MOAC_YERPA Cyclic pyranopterin monophosphate synthase accessory protein OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=moaC PE=3 SV=1 399 578 2.0E-29
sp|A7FKM0|MOAC_YERP3 Cyclic pyranopterin monophosphate synthase accessory protein OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=moaC PE=3 SV=1 399 578 2.0E-29
sp|Q6GEG0|MOAC_STAAR Cyclic pyranopterin monophosphate synthase accessory protein OS=Staphylococcus aureus (strain MRSA252) GN=moaC PE=3 SV=1 399 582 2.0E-29
sp|Q6LT40|MOAC_PHOPR Cyclic pyranopterin monophosphate synthase accessory protein OS=Photobacterium profundum GN=moaC PE=3 SV=1 399 578 2.0E-29
sp|Q50746|MOAA_METTM Probable cyclic pyranopterin monophosphate synthase OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=moaA PE=3 SV=2 39 312 2.0E-29
sp|Q4QJS0|MOAC_HAEI8 Cyclic pyranopterin monophosphate synthase accessory protein OS=Haemophilus influenzae (strain 86-028NP) GN=moaC PE=3 SV=1 399 578 3.0E-29
sp|A1REK0|MOAC_SHESW Cyclic pyranopterin monophosphate synthase accessory protein OS=Shewanella sp. (strain W3-18-1) GN=moaC PE=3 SV=1 401 578 3.0E-29
sp|A4Y2D9|MOAC_SHEPC Cyclic pyranopterin monophosphate synthase accessory protein OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=moaC PE=3 SV=1 401 578 3.0E-29
sp|A6WI10|MOAC_SHEB8 Cyclic pyranopterin monophosphate synthase accessory protein OS=Shewanella baltica (strain OS185) GN=moaC PE=3 SV=1 401 578 3.0E-29
sp|A3CZA5|MOAC_SHEB5 Cyclic pyranopterin monophosphate synthase accessory protein OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=moaC PE=3 SV=1 401 578 3.0E-29
sp|A9KX72|MOAC_SHEB9 Cyclic pyranopterin monophosphate synthase accessory protein OS=Shewanella baltica (strain OS195) GN=moaC PE=3 SV=1 401 578 3.0E-29
sp|B8E478|MOAC_SHEB2 Cyclic pyranopterin monophosphate synthase accessory protein OS=Shewanella baltica (strain OS223) GN=moaC PE=3 SV=1 401 578 3.0E-29
sp|A6VJM2|MOAA_METM7 Probable cyclic pyranopterin monophosphate synthase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=moaA PE=3 SV=1 42 326 3.0E-29
sp|Q2YYS2|MOAC_STAAB Cyclic pyranopterin monophosphate synthase accessory protein OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=moaC PE=3 SV=1 399 580 3.0E-29
sp|B1J176|MOAC_PSEPW Cyclic pyranopterin monophosphate synthase accessory protein OS=Pseudomonas putida (strain W619) GN=moaC PE=3 SV=1 401 578 4.0E-29
sp|Q2G6Q7|MOAC_NOVAD Cyclic pyranopterin monophosphate synthase accessory protein OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=moaC PE=3 SV=1 399 578 4.0E-29
sp|Q8NVA0|MOAC_STAAW Cyclic pyranopterin monophosphate synthase accessory protein OS=Staphylococcus aureus (strain MW2) GN=moaC PE=3 SV=1 399 580 4.0E-29
sp|Q6G748|MOAC_STAAS Cyclic pyranopterin monophosphate synthase accessory protein OS=Staphylococcus aureus (strain MSSA476) GN=moaC PE=3 SV=1 399 580 4.0E-29
sp|A8G1M9|MOAC_SHESH Cyclic pyranopterin monophosphate synthase accessory protein OS=Shewanella sediminis (strain HAW-EB3) GN=moaC PE=3 SV=1 398 578 4.0E-29
sp|A9VL86|MOAC_BACWK Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus weihenstephanensis (strain KBAB4) GN=moaC PE=3 SV=1 399 580 4.0E-29
sp|Q7VVF8|MOAC_BORPE Cyclic pyranopterin monophosphate synthase accessory protein OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=moaC PE=3 SV=1 396 578 5.0E-29
[Show less]

GO

GO Term Description Terminal node
GO:0019008 molybdopterin synthase complex Yes
GO:0051536 iron-sulfur cluster binding Yes
GO:0006777 Mo-molybdopterin cofactor biosynthetic process Yes
GO:0051539 4 iron, 4 sulfur cluster binding Yes
GO:0003824 catalytic activity Yes
GO:0051189 prosthetic group metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0005488 binding No
GO:1901576 organic substance biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0032991 protein-containing complex No
GO:1901564 organonitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0019637 organophosphate metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0009058 biosynthetic process No
GO:0019720 Mo-molybdopterin cofactor metabolic process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0043545 molybdopterin cofactor metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0051540 metal cluster binding No
GO:0008150 biological_process No
GO:0006793 phosphorus metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|004180
MLYRLANTLPRVRALSSLAHIRAKERINVIDSTRPFTGQFIDTFNRKHTYLRISLTERCNLRCFYCMPSEGVELS
PPGHLLTNEEILRLATLFVKSGITKIRLTGGEPSVRKDLLQLMGGLNQLKQYGLTSLAMTTNGIALHRRLPQLVE
NGLTHLNLSLDTLDPFKFEIITRRRGHEAVLKALDTALSLPIQMVKLNVVVIQGLNDSEVLDFIKLTEDRPISVR
FIEFMPFTGNKWDKKKMVPSAQLLERIRTHYPDVTRSSDELNDTARSWYIPGHQGTFGFISSMSDHFCGTCNRLR
LTADGQIKVCLFDPKEISLCDIMRSGASDDELLQVIHQAVVGKKAKHAGMDSIDVTTNRPMILIGHGLVPRARRS
KHDLRALSSATFQSNQRRTYSSASKLTHLDAHGRASMVDVSDKLPSKRAATAKGRIYLTKSAYDLVTFTYPENAQ
LSEAMEKARRKGDVLTTAQIAGIMGAKRTAELVPLCHSLPLSKVDVKLIPETNLQAGADSVEREYSYSILCTATV
TCEGKTGVEMEALMAVSISLLTVWDMLKAVAGKEMEIGKIIVSEKSGGRSGDFSRVL*
Coding >Agabi119p4|004180
ATGCTCTACAGACTGGCCAATACTTTGCCCCGTGTGCGCGCACTGTCCTCTTTGGCTCATATTCGTGCAAAAGAA
CGCATCAATGTCATTGACTCAACTAGACCATTCACAGGCCAATTCATAGATACTTTCAACAGAAAGCATACTTAT
CTACGCATCTCTCTTACCGAGAGGTGCAATCTACGATGTTTCTATTGCATGCCGAGTGAAGGCGTAGAGCTTTCA
CCCCCAGGCCATCTCTTGACCAATGAAGAGATCTTACGACTTGCTACACTGTTTGTCAAAAGTGGAATCACAAAG
ATTCGTCTGACTGGTGGAGAACCCTCCGTCCGCAAGGATTTATTGCAGTTGATGGGCGGCTTGAATCAACTGAAG
CAATACGGTCTTACATCCTTAGCCATGACAACAAATGGGATCGCCTTACACAGACGATTACCACAGTTGGTCGAG
AACGGACTAACCCACCTTAACCTCAGTTTGGATACTCTTGACCCCTTCAAATTTGAAATTATAACCCGTCGCCGA
GGCCATGAGGCTGTGCTGAAGGCACTCGACACCGCTCTCAGCTTGCCAATACAAATGGTCAAACTGAACGTAGTC
GTAATCCAGGGATTAAATGACTCCGAAGTCCTCGATTTTATCAAGCTTACCGAAGACAGGCCCATATCTGTCCGG
TTCATTGAATTCATGCCTTTCACTGGAAACAAGTGGGACAAGAAAAAAATGGTTCCATCTGCTCAGCTTCTAGAA
CGCATCAGAACGCATTACCCAGACGTCACGCGCAGCTCAGATGAGTTGAATGACACGGCGCGTTCATGGTATATA
CCTGGTCACCAAGGTACTTTTGGATTTATTAGTAGCATGTCGGACCACTTTTGTGGTACATGCAATCGACTTCGA
CTCACTGCGGATGGCCAGATCAAAGTGTGTCTTTTCGACCCCAAGGAAATTTCGTTATGCGATATCATGCGGTCA
GGTGCTTCCGACGATGAGCTGCTCCAAGTCATCCACCAAGCGGTAGTTGGCAAGAAGGCGAAACATGCGGGCATG
GATTCCATCGATGTGACTACGAACCGGCCTATGATACTTATAGGTCATGGTCTTGTGCCCCGAGCTAGACGCTCA
AAACATGATCTAAGAGCTTTATCCTCAGCTACTTTTCAATCAAATCAGCGACGTACATATAGCTCTGCATCTAAG
CTGACCCATCTTGATGCGCACGGCAGAGCTTCTATGGTAGATGTGTCCGACAAGTTACCCTCAAAGCGAGCTGCG
ACCGCAAAGGGTCGCATTTACCTAACCAAGTCCGCATATGACCTTGTCACATTCACGTACCCAGAAAATGCTCAA
CTGAGCGAGGCTATGGAAAAAGCGAGGAGAAAGGGTGATGTGTTGACCACCGCACAAATTGCCGGTATTATGGGG
GCCAAGCGAACGGCAGAACTCGTTCCCCTATGCCATTCACTGCCTTTGTCGAAAGTTGATGTTAAACTTATTCCG
GAAACCAACCTTCAAGCTGGCGCAGATTCCGTCGAAAGGGAATACAGTTACAGTATACTTTGTACGGCAACTGTG
ACCTGTGAAGGAAAGACAGGTGTGGAGATGGAAGCATTAATGGCTGTATCCATCAGTTTGTTGACGGTCTGGGAC
ATGCTGAAGGCCGTAGCTGGGAAGGAGATGGAAATCGGGAAGATCATCGTTAGCGAGAAAAGCGGCGGAAGAAGC
GGTGACTTCAGCAGAGTACTGTGA
Transcript >Agabi119p4|004180
ATGCTCTACAGACTGGCCAATACTTTGCCCCGTGTGCGCGCACTGTCCTCTTTGGCTCATATTCGTGCAAAAGAA
CGCATCAATGTCATTGACTCAACTAGACCATTCACAGGCCAATTCATAGATACTTTCAACAGAAAGCATACTTAT
CTACGCATCTCTCTTACCGAGAGGTGCAATCTACGATGTTTCTATTGCATGCCGAGTGAAGGCGTAGAGCTTTCA
CCCCCAGGCCATCTCTTGACCAATGAAGAGATCTTACGACTTGCTACACTGTTTGTCAAAAGTGGAATCACAAAG
ATTCGTCTGACTGGTGGAGAACCCTCCGTCCGCAAGGATTTATTGCAGTTGATGGGCGGCTTGAATCAACTGAAG
CAATACGGTCTTACATCCTTAGCCATGACAACAAATGGGATCGCCTTACACAGACGATTACCACAGTTGGTCGAG
AACGGACTAACCCACCTTAACCTCAGTTTGGATACTCTTGACCCCTTCAAATTTGAAATTATAACCCGTCGCCGA
GGCCATGAGGCTGTGCTGAAGGCACTCGACACCGCTCTCAGCTTGCCAATACAAATGGTCAAACTGAACGTAGTC
GTAATCCAGGGATTAAATGACTCCGAAGTCCTCGATTTTATCAAGCTTACCGAAGACAGGCCCATATCTGTCCGG
TTCATTGAATTCATGCCTTTCACTGGAAACAAGTGGGACAAGAAAAAAATGGTTCCATCTGCTCAGCTTCTAGAA
CGCATCAGAACGCATTACCCAGACGTCACGCGCAGCTCAGATGAGTTGAATGACACGGCGCGTTCATGGTATATA
CCTGGTCACCAAGGTACTTTTGGATTTATTAGTAGCATGTCGGACCACTTTTGTGGTACATGCAATCGACTTCGA
CTCACTGCGGATGGCCAGATCAAAGTGTGTCTTTTCGACCCCAAGGAAATTTCGTTATGCGATATCATGCGGTCA
GGTGCTTCCGACGATGAGCTGCTCCAAGTCATCCACCAAGCGGTAGTTGGCAAGAAGGCGAAACATGCGGGCATG
GATTCCATCGATGTGACTACGAACCGGCCTATGATACTTATAGGTCATGGTCTTGTGCCCCGAGCTAGACGCTCA
AAACATGATCTAAGAGCTTTATCCTCAGCTACTTTTCAATCAAATCAGCGACGTACATATAGCTCTGCATCTAAG
CTGACCCATCTTGATGCGCACGGCAGAGCTTCTATGGTAGATGTGTCCGACAAGTTACCCTCAAAGCGAGCTGCG
ACCGCAAAGGGTCGCATTTACCTAACCAAGTCCGCATATGACCTTGTCACATTCACGTACCCAGAAAATGCTCAA
CTGAGCGAGGCTATGGAAAAAGCGAGGAGAAAGGGTGATGTGTTGACCACCGCACAAATTGCCGGTATTATGGGG
GCCAAGCGAACGGCAGAACTCGTTCCCCTATGCCATTCACTGCCTTTGTCGAAAGTTGATGTTAAACTTATTCCG
GAAACCAACCTTCAAGCTGGCGCAGATTCCGTCGAAAGGGAATACAGTTACAGTATACTTTGTACGGCAACTGTG
ACCTGTGAAGGAAAGACAGGTGTGGAGATGGAAGCATTAATGGCTGTATCCATCAGTTTGTTGACGGTCTGGGAC
ATGCTGAAGGCCGTAGCTGGGAAGGAGATGGAAATCGGGAAGATCATCGTTAGCGAGAAAAGCGGCGGAAGAAGC
GGTGACTTCAGCAGAGTACTGTGA
Gene >Agabi119p4|004180
ATGCTCTACAGACTGGCCAATACTTTGCCCCGTGTGCGCGCACTGTCCTCTTTGGCTCATATTCGTGCAAAAGTA
AGCCTGCTCGTGACTTTCGACGCAGATTTCATGAACAACAAATAGGAACGCATCAATGTCATTGACTCAACTAGA
CCATTCACAGGCCAATTCATAGATACTTTCAACAGAAAGCATACTTATCTACGCATCTCTCTTACCGAGAGGTGC
AATCTACGATGTGAGCTTTTAGTCATTGAGTCACCCAGACTCCGTTACGACGCGACATATCAGGTTTCTATTGCA
TGCCGAGTGAAGGCGTAGAGCTTTCACCCCCAGGCCATCTCTTGACCAATGAAGAGATCTTACGACTTGCTACAC
TGTTTGTCAAAAGTGGAATCACAAAGATTCGTCTGACTGGTGGAGAACCCTCCGTCCGCAAGGATTTATTGCAGT
TGATGGGTATGCTGGAATCAGGGATCGATACTTCCCGCTACTCATAATCTTGTCAGGCGGCTTGAATCAACTGAA
GCAATACGGTCTTACATCCTTAGCCATGACAACAAATGGGATCGCCTTACACAGACGATTACCACAGTTGGTCGA
GAACGGACTAACCCACCTTAACCTCAGTTTGGATACTCTTGACCCCTTCAAATTTGAAATTATAACCCGTCGCCG
AGGCCATGAGGCTGTGCTGAAGGCACTCGACACCGCTCTCAGCTTGCCAATACAAATGGTCAAACTGAACGTAGT
CGTAATCCAGGGATTAAATGACTCCGAAGTCCTCGATTTTATCAAGCTTACCGAAGACAGGCCCATATCTGTCCG
GTTCATTGAATTCATGCCTTTCACTGGTTAGCTCCTCCGTTTCACATGTTCAAGTTGAACTGACCAAACTCTACA
GGAAACAAGTGGGACAAGAAAAAAATGGTTCCATCTGCTCAGCTTCTAGAACGCATCAGAACGCATTACCCAGAC
GTCACGCGCAGCTCAGATGAGTTGAATGACACGGCGCGTTCATGGTATATACCTGGTCACCAAGGTACTTTTGGA
TTTATTAGTAGCATGTCGGACCACTTTTGTGGTACATGCAATCGACTTCGACTCACTGCGGATGGCCAGATCAAA
GTGAGTCGATCAAATCCTCTTTTTATTCAGCCTTTACATTCATGCAGGTGTGTCTTTTCGACCCCAAGGAAATTT
CGTTATGCGATATCATGCGGTCAGGTGCTTCCGACGATGAGCTGCTCCAAGTCATCCACCAAGCGGTAGTTGGCA
AGAAGGCGAAACATGCGGGCATGGATTCCATCGATGTGACTACGAACCGGCCTATGATACTTATAGGTGGATAAC
GCTTCTCATCTTATCTATATACAAAAAAATACAAGCCTGATCCCTCCTCTCACTGCTCAGGTCATGGTCTTGTGC
CCCGAGCTAGACGCTCAAAACATGATCTAAGAGCTTTATCCTCAGCTACTTTTCAATCAAATCAGCGACGTACAT
ATAGCTCTGCATCTAAGCTGACCCATCTTGATGCGCACGGCAGAGCTTCTATGGTAGATGTGTCCGACAAGTTAC
CCTCAAAGCGAGCTGCGACCGCAAAGGGTCGCATTTACCTAACCAAGTCCGCATATGACCTTGTCACATTCACGT
ACCCAGAAAATGCTCAACTGAGCGAGGCTATGGAAAAAGCGAGGAGAAAGGGTGATGTGTTGACCACCGCACAAA
TTGCCGGTATTATGGGGGCCAAGCGAACGGCAGAACTCGTTCCCCTATGCCATTCACTGCCTTTGTCGAAAGTTG
ATGTTAAACTTATTCCGGAAACCAACCTTCAAGCTGGCGCAGATTCCGTCGAAAGGGAATACAGTTACAGTATAC
TTTGTACGGCAACTGTGACCTGTGAAGGAAAGACAGGTGTGGAGATGGAAGCATTAATGGCTGTATCCATCAGTT
TGTTGACGGTCTGGGACATGCTGAAGGCCGTAGCTGGGAAGGAGATGGAAATCGGGAAGATCATCGTTAGCGAGA
AAAGCGGCGGAAGAAGCGGTGACTTCAGCAGAGTACTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail