Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|004150
Gene name
Locationscaffold_01a:1064084..1065254
Strand-
Gene length (bp)1170
Transcript length (bp)804
Coding sequence length (bp)804
Protein length (aa) 268

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07978 NIPSNAP NIPSNAP 2.2E-27 168 265

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VXK0|NIPSN_DROME Protein NipSnap OS=Drosophila melanogaster GN=Nipsnap PE=2 SV=2 44 265 7.0E-41
sp|O55125|NIPS1_MOUSE Protein NipSnap homolog 1 OS=Mus musculus GN=Nipsnap1 PE=1 SV=1 46 267 8.0E-38
sp|Q9PU58|NIPS2_DANRE Protein NipSnap homolog 2 OS=Danio rerio GN=gbas PE=2 SV=2 46 267 1.0E-37
sp|Q9BPW8|NIPS1_HUMAN Protein NipSnap homolog 1 OS=Homo sapiens GN=NIPSNAP1 PE=1 SV=1 46 267 2.0E-37
sp|O75323|NIPS2_HUMAN Protein NipSnap homolog 2 OS=Homo sapiens GN=GBAS PE=1 SV=1 46 267 3.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VXK0|NIPSN_DROME Protein NipSnap OS=Drosophila melanogaster GN=Nipsnap PE=2 SV=2 44 265 7.0E-41
sp|O55125|NIPS1_MOUSE Protein NipSnap homolog 1 OS=Mus musculus GN=Nipsnap1 PE=1 SV=1 46 267 8.0E-38
sp|Q9PU58|NIPS2_DANRE Protein NipSnap homolog 2 OS=Danio rerio GN=gbas PE=2 SV=2 46 267 1.0E-37
sp|Q9BPW8|NIPS1_HUMAN Protein NipSnap homolog 1 OS=Homo sapiens GN=NIPSNAP1 PE=1 SV=1 46 267 2.0E-37
sp|O75323|NIPS2_HUMAN Protein NipSnap homolog 2 OS=Homo sapiens GN=GBAS PE=1 SV=1 46 267 3.0E-37
sp|O55126|NIPS2_MOUSE Protein NipSnap homolog 2 OS=Mus musculus GN=Gbas PE=1 SV=1 13 267 1.0E-34
sp|P34492|YMQ1_CAEEL Putative NipSnap protein K02D10.1 OS=Caenorhabditis elegans GN=K02D10.1 PE=2 SV=4 42 267 3.0E-28
sp|Q54I58|NIPSN_DICDI Protein NipSnap homolog OS=Dictyostelium discoideum GN=nipsnap PE=3 SV=1 95 261 5.0E-14
sp|Q9UFN0|NPS3A_HUMAN Protein NipSnap homolog 3A OS=Homo sapiens GN=NIPSNAP3A PE=1 SV=2 56 267 3.0E-07
sp|Q5RAA9|NPS3A_PONAB Protein NipSnap homolog 3A OS=Pongo abelii GN=NIPSNAP3A PE=2 SV=1 56 267 1.0E-06
sp|Q9BS92|NPS3B_HUMAN Protein NipSnap homolog 3B OS=Homo sapiens GN=NIPSNAP3B PE=2 SV=1 151 267 2.0E-06
sp|Q9BS92|NPS3B_HUMAN Protein NipSnap homolog 3B OS=Homo sapiens GN=NIPSNAP3B PE=2 SV=1 56 267 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|004150
MLNTVTRRTFSSTSATSIAKRSISVQSLLHGSPEARRVGEIETQQHSKLVGRGKYIHAFETHRVKPDRIGEYKKA
AETYYKGLLADSRLQVKLSGSWETAIGELDTFLHILEYENYAGYDKATQIIRTSEHLDGYRAMLPYLNSRVTQLN
QEFAFFPTAPPHAQGGLFEMRTYQLLPGALLEWENIWRRGIEARRKFIVPVGAWFSQVGRLHEVHHMWQYPSFQE
RREKREQLWQIDGWAETVSKTAKLAKYMDSHVLTPLPFSPLK*
Coding >Agabi119p4|004150
ATGCTCAATACTGTCACTCGCCGTACTTTTTCTTCGACCTCTGCTACGTCTATTGCGAAAAGATCTATCTCTGTG
CAATCGTTACTGCATGGCTCACCAGAGGCAAGGAGGGTCGGGGAGATCGAAACCCAGCAGCATTCGAAGCTGGTC
GGCAGGGGGAAGTACATTCACGCTTTCGAGACCCATCGTGTGAAGCCGGACAGGATAGGGGAGTACAAGAAGGCT
GCGGAGACCTACTACAAAGGTCTCCTCGCCGACTCCCGTCTGCAAGTGAAACTGTCGGGGAGCTGGGAAACAGCC
ATCGGCGAACTCGACACCTTTCTCCATATTCTCGAGTACGAAAACTATGCTGGGTATGATAAGGCTACTCAGATC
ATTAGAACATCCGAACACCTGGATGGATATCGCGCCATGCTCCCATACTTAAACTCACGTGTAACACAGCTTAAC
CAAGAATTTGCTTTTTTCCCCACTGCGCCTCCTCATGCTCAGGGTGGATTGTTTGAAATGAGGACTTACCAACTT
CTGCCAGGGGCACTCCTGGAGTGGGAGAATATTTGGCGGAGAGGGATCGAGGCCCGTCGGAAATTCATCGTGCCT
GTAGGTGCATGGTTCTCGCAGGTCGGACGACTTCATGAAGTTCACCACATGTGGCAATACCCGAGCTTCCAGGAA
CGCAGGGAGAAACGAGAGCAACTTTGGCAAATCGATGGGTGGGCAGAAACAGTGTCCAAGACCGCGAAACTGGCC
AAGTACATGGATTCGCATGTTCTGACACCTCTCCCATTCAGCCCTCTTAAATGA
Transcript >Agabi119p4|004150
ATGCTCAATACTGTCACTCGCCGTACTTTTTCTTCGACCTCTGCTACGTCTATTGCGAAAAGATCTATCTCTGTG
CAATCGTTACTGCATGGCTCACCAGAGGCAAGGAGGGTCGGGGAGATCGAAACCCAGCAGCATTCGAAGCTGGTC
GGCAGGGGGAAGTACATTCACGCTTTCGAGACCCATCGTGTGAAGCCGGACAGGATAGGGGAGTACAAGAAGGCT
GCGGAGACCTACTACAAAGGTCTCCTCGCCGACTCCCGTCTGCAAGTGAAACTGTCGGGGAGCTGGGAAACAGCC
ATCGGCGAACTCGACACCTTTCTCCATATTCTCGAGTACGAAAACTATGCTGGGTATGATAAGGCTACTCAGATC
ATTAGAACATCCGAACACCTGGATGGATATCGCGCCATGCTCCCATACTTAAACTCACGTGTAACACAGCTTAAC
CAAGAATTTGCTTTTTTCCCCACTGCGCCTCCTCATGCTCAGGGTGGATTGTTTGAAATGAGGACTTACCAACTT
CTGCCAGGGGCACTCCTGGAGTGGGAGAATATTTGGCGGAGAGGGATCGAGGCCCGTCGGAAATTCATCGTGCCT
GTAGGTGCATGGTTCTCGCAGGTCGGACGACTTCATGAAGTTCACCACATGTGGCAATACCCGAGCTTCCAGGAA
CGCAGGGAGAAACGAGAGCAACTTTGGCAAATCGATGGGTGGGCAGAAACAGTGTCCAAGACCGCGAAACTGGCC
AAGTACATGGATTCGCATGTTCTGACACCTCTCCCATTCAGCCCTCTTAAATGA
Gene >Agabi119p4|004150
ATGCTCAATACTGTCACTCGCCGTACTTTTTCTTCGACCTCTGCTACGTCTATTGCGAAAAGATCTATCTCTGTG
CAAGTCAGTGGGATGTGGCAACTCTCTTTCATTGATTGACGCTCATCTTGCAGTCGTTACTGCATGGCTCACCAG
AGGCAAGGAGGGTCGGGGAGATCGAAACCCAGCAGCATTCGAAGCTGGTCGGCAGGGGGAAGTACATTCACGCTT
TCGAGAGTGCGTATGGCTGTGCTTCGCAGGCGGGAAATGTTATGACGCCGGTTTGTAGCCCATCGTGTGAAGCCG
GACAGGATAGGGGAGTACAAGAAGGCTGCGTGAGTAACACTACTAGGAATCCCGCTCCTCCAATCCTTACAGTTC
CTATGGTTTAGGGAGACCTACTACAAAGGTCTCCTCGCCGACTCCCGTCTGCAAGTGAAACTGTCGGGGAGCTGG
GAAACAGCCATCGGCGAACTCGACACCTTTCTCCATATTCTCGAGTACGAAAACTATGCTGGGTATGATAAGGCT
ACTCAGATCATTAGAACATCCGAAGTAAGTATTGGGTCATTCTATGAGTATTTTTCGGCTGGATTTGATATGATT
TCTAGCACCTGGATGGATATCGCGCCATGCTCCCATACTTAAACTCACGTGTAACACAGCTTAACCAAGAATTTG
CTTTTTTCCCCACTGCGCCTCCTCATGCTCAGGGTGGATTGTTTGAAATGAGGACTTACCAACTTCTGCCAGGGG
CACTCCTGGAGTGGGAGAATATTTGGTACGCATTTGCAACGCTAGAGTTATGTGTACGTTGACGCGATTCAGGCG
GAGAGGGATCGAGGCCCGTCGGAAATTCATCGTGCCTGTAGGTGCATGGTTCTCGCAGGTCGGACGACTTCATGA
AGTTCACCACATGTGGCAATACCCGTATGTTTGATTGTCGGCTTTTTACCGACATGGCATGACCTCTTCCTATGT
AGGAGCTTCCAGGAACGCAGGGAGAAACGAGAGCAACTTTGGCAAATCGATGGGTGGGCAGAAACAGTGTCCAAG
GTTCGTTTTCAATTCAAGTGGCGGCTGCGGTGGTGCTCATAACGTTAACAGACCGCGAAACTGGCCAAGTACATG
GATTCGCATGTTCTGACACCTCTCCCATTCAGCCCTCTTAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail