Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|004140
Gene name
Locationscaffold_01a:1059784..1063745
Strand-
Gene length (bp)3961
Transcript length (bp)2772
Coding sequence length (bp)2772
Protein length (aa) 924

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04082 Fungal_trans Fungal specific transcription factor domain 4.5E-27 336 608
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 5.6E-05 24 62

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P28348|NIRA_EMENI Nitrogen assimilation transcription factor nirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nirA PE=3 SV=1 335 752 8.0E-31
sp|P28349|NIT4_NEUCR Nitrogen assimilation transcription factor nit-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-4 PE=3 SV=2 335 752 3.0E-29
sp|O74915|YJ74_SCHPO Uncharacterized transcriptional regulatory protein C757.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.04 PE=3 SV=2 308 751 6.0E-22
sp|P52958|CTF1A_FUSSO Cutinase transcription factor 1 alpha OS=Fusarium solani subsp. pisi GN=CTF1-ALPHA PE=2 SV=1 326 754 2.0E-21
sp|O14130|YF54_SCHPO Uncharacterized transcriptional regulatory protein C3C7.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3C7.04 PE=3 SV=1 256 737 1.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P28348|NIRA_EMENI Nitrogen assimilation transcription factor nirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nirA PE=3 SV=1 335 752 8.0E-31
sp|P28349|NIT4_NEUCR Nitrogen assimilation transcription factor nit-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-4 PE=3 SV=2 335 752 3.0E-29
sp|O74915|YJ74_SCHPO Uncharacterized transcriptional regulatory protein C757.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.04 PE=3 SV=2 308 751 6.0E-22
sp|P52958|CTF1A_FUSSO Cutinase transcription factor 1 alpha OS=Fusarium solani subsp. pisi GN=CTF1-ALPHA PE=2 SV=1 326 754 2.0E-21
sp|O14130|YF54_SCHPO Uncharacterized transcriptional regulatory protein C3C7.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3C7.04 PE=3 SV=1 256 737 1.0E-19
sp|O74541|YCV2_SCHPO Uncharacterized transcriptional regulatory protein C777.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC777.02 PE=3 SV=4 336 751 3.0E-18
sp|G2TRN9|YAOB_SCHPO Uncharacterized transcriptional regulatory protein C11D3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.11c PE=1 SV=1 336 541 1.0E-17
sp|Q9P7H9|YIT3_SCHPO Uncharacterized transcriptional regulatory protein C105.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC105.03c PE=3 SV=1 310 784 2.0E-17
sp|P47988|TEA1_YEAST TY1 enhancer activator OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TEA1 PE=1 SV=2 390 659 4.0E-17
sp|Q9P6I9|YHDD_SCHPO Uncharacterized transcriptional regulatory protein C1683.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.13c PE=1 SV=1 439 755 4.0E-16
sp|P87000|ACU15_NEUCR Transcriptional activator protein acu-15 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-15 PE=1 SV=2 268 753 7.0E-15
sp|Q9UTA7|YL8B_SCHPO Uncharacterized transcriptional regulatory protein C25B8.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.11 PE=3 SV=1 335 658 3.0E-13
sp|Q4WK35|AMDR_ASPFU Acetamidase regulatory protein OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=amdR PE=3 SV=1 326 789 2.0E-12
sp|O60130|YH7G_SCHPO Putative transcriptional regulatory protein C16G5.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16G5.16 PE=1 SV=1 440 798 2.0E-11
sp|O59741|YN25_SCHPO Uncharacterized transcriptional regulatory protein C530.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.05 PE=3 SV=2 251 684 3.0E-11
sp|Q06157|AMDR_ASPOR Acetamidase regulatory protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=amdR PE=2 SV=2 326 755 7.0E-11
sp|P40467|ASG1_YEAST Activator of stress genes 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASG1 PE=1 SV=1 414 649 7.0E-11
sp|P52959|CTF1B_FUSSO Cutinase transcription factor 1 beta OS=Fusarium solani subsp. pisi GN=CTF1-BETA PE=2 SV=1 326 753 1.0E-10
sp|P43634|CHA4_YEAST Activatory protein CHA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHA4 PE=1 SV=1 437 536 4.0E-09
sp|Q59LV8|ASG1_CANAL Activator of stress genes protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASG1 PE=3 SV=1 414 649 5.0E-08
sp|P10563|QUTA_EMENI Quinic acid utilization activator OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutA PE=3 SV=2 441 697 3.0E-07
sp|Q1MTM9|YFN1_SCHPO Uncharacterized transcriptional regulatory protein C1327.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1327.01c PE=1 SV=2 305 536 3.0E-07
sp|C5DGQ7|RGT1_LACTC Glucose transport transcription regulator RGT1 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=RGT1 PE=3 SV=1 2 76 5.0E-07
sp|P10563|QUTA_EMENI Quinic acid utilization activator OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutA PE=3 SV=2 19 82 7.0E-07
sp|Q6CIL8|RGT1_KLULA Glucose transport transcription regulator RGT1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RGT1 PE=3 SV=1 4 77 2.0E-06
sp|A6ZZS7|RGT1_YEAS7 Glucose transport transcription regulator RGT1 OS=Saccharomyces cerevisiae (strain YJM789) GN=RGT1 PE=3 SV=1 6 71 3.0E-06
sp|C7GP35|RGT1_YEAS2 Glucose transport transcription regulator RGT1 OS=Saccharomyces cerevisiae (strain JAY291) GN=RGT1 PE=3 SV=1 6 71 3.0E-06
sp|P32862|RGT1_YEAST Glucose transport transcription regulator RGT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGT1 PE=1 SV=1 6 71 3.0E-06
sp|B3LR49|RGT1_YEAS1 Glucose transport transcription regulator RGT1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RGT1 PE=3 SV=1 6 71 3.0E-06
sp|P39113|CAT8_YEAST Regulatory protein CAT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAT8 PE=1 SV=2 15 98 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0008270 zinc ion binding Yes
GO:0003677 DNA binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0065007 biological regulation No
GO:0019222 regulation of metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0005488 binding No
GO:0009889 regulation of biosynthetic process No
GO:0140110 transcription regulator activity No
GO:0044238 primary metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0046872 metal ion binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0090304 nucleic acid metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0003676 nucleic acid binding No
GO:0031323 regulation of cellular metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0044249 cellular biosynthetic process No
GO:0008152 metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0003674 molecular_function No
GO:0018130 heterocycle biosynthetic process No
GO:0080090 regulation of primary metabolic process No
GO:0010468 regulation of gene expression No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0046914 transition metal ion binding No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0050789 regulation of biological process No
GO:0043170 macromolecule metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0044237 cellular metabolic process No
GO:0003700 DNA-binding transcription factor activity No
GO:0019438 aromatic compound biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0050794 regulation of cellular process No
GO:0016070 RNA metabolic process No
GO:0009987 cellular process No
GO:0051252 regulation of RNA metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0009058 biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0043169 cation binding No
GO:1903506 regulation of nucleic acid-templated transcription No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|004140
MEWKDSDPSDDENSLATSRKRSSRACDQCRKTKSKCERPSGSATQCKSCALTGTLCTFLGPSYKRGPPKGYIHAI
EQRWHQVESLLGAILQCPDARVQAFVNDLKQDDLASEIIDRVDMGPYGPAGRRSQPAGATKEDFFASILRSNGSN
TRDNSRSRRQSRVSREIVSSTQDHGLSVVPTKEWQDNLSRRLASAGRNSTTSNTSYGTYRAPSSSNVPLAQRRRL
NDTVEPPYSPDWSGMYTFNQEEPLESDEAKEATECMGSLSLDENQEIRYHGRISGLSLLERNKRTDDRMDGGIWR
LPMARVWPPARYGLASPPIGEMEEHLPPWDIQDRLLELYFTYIHPVYPLIYKRRFLLEYQYKRQGTRRESQPNSP
RLPRPEPTQEVTPLLLLAIFAIAARFCEDEMPLPPTGKMWEAGCGYLDTARGLLAKVFHVSRPSTVQALLLLGYR
EFGIGSMEQGWIFIGMAIRMAFDLGLNCDSSKWKVRGHDLFSAEDSQTRGHIWWACVLADRYGSIYMGRPTMIKD
NDSDMSLPGIEPEEDIAPWQPHPSDGLSYSPTPGRIMSSFAAASRLSLISGTVINRVYPVQSISRVAKQAVLNEC
EAQLDQWLISLPDYLRCDSGNRRCSPSPQVIFLHIRYWGCVLLLYRAFIPNWKSSEDVARNSPIGSKALDLAQSA
ASHISSLVTMYRETFTLKRSSPFLTAYLLSASIMHILTLSLRSTHVEATLGLQQCMSALKDMEILWPSASRAWEL
LNGVKLSDGICAVPLPQLHGQQTERQKRPADDAFGQEKNPEYPQSGVYERGNGTTNQNASGSQTGVHDLSTRIMA
HMLGLDIQGIEPSSMSYYPGYQWWPGSSGQGESSTQHTSEPIHPPMSDPTQLAALPVGPRGTINTPANRNSHENW
TYQQGQSKRVSESYSYDFSQFGP*
Coding >Agabi119p4|004140
ATGGAGTGGAAAGACTCAGATCCCTCGGACGATGAGAATAGTCTGGCGACCTCTCGCAAGCGCAGCAGCAGAGCA
TGTGATCAGTGTCGGAAAACTAAGAGCAAATGCGAGCGACCTTCAGGCAGCGCAACACAATGCAAGAGCTGTGCA
CTTACTGGCACTCTCTGCACCTTCTTAGGTCCGAGTTACAAACGCGGTCCCCCGAAAGGCTATATCCATGCAATA
GAACAACGTTGGCATCAGGTCGAATCCTTGCTGGGCGCCATTCTTCAGTGCCCAGATGCACGAGTACAGGCGTTT
GTCAATGATTTGAAACAAGACGATTTAGCTTCCGAAATCATTGATAGAGTTGACATGGGTCCATACGGTCCTGCT
GGACGGCGCAGTCAGCCTGCAGGAGCCACCAAAGAAGACTTTTTCGCCTCTATCCTCCGAAGCAATGGGTCGAAT
ACTCGCGATAATTCTCGCTCTAGGCGACAATCAAGAGTGTCTCGTGAAATTGTTTCATCGACACAAGATCATGGC
CTTTCTGTCGTACCGACAAAGGAGTGGCAAGACAATCTTTCACGACGTCTTGCTTCAGCAGGCCGAAACTCCACT
ACTTCAAATACTTCCTACGGTACTTACCGTGCACCGAGCTCTTCAAATGTACCCCTAGCGCAACGACGGCGCCTG
AATGACACAGTTGAACCGCCTTATTCTCCAGATTGGAGTGGAATGTATACATTTAATCAAGAAGAACCGTTGGAA
TCCGACGAAGCGAAGGAAGCCACAGAATGTATGGGATCACTTTCCCTTGACGAGAACCAAGAGATACGATATCAC
GGGCGTATTAGTGGTCTATCCTTACTGGAACGGAATAAGCGGACAGATGATCGAATGGACGGTGGGATATGGCGA
TTACCTATGGCAAGGGTCTGGCCCCCGGCTCGCTATGGGCTCGCTTCGCCTCCTATTGGAGAGATGGAAGAACAC
TTGCCACCATGGGATATTCAAGACCGTCTACTCGAACTCTATTTCACCTATATCCATCCAGTTTATCCTCTGATC
TATAAACGCCGCTTCCTGTTGGAGTATCAGTATAAAAGACAAGGGACTAGGCGTGAATCCCAACCAAATAGCCCA
CGATTGCCAAGGCCCGAGCCGACGCAAGAAGTTACACCGCTTCTACTTCTTGCTATTTTTGCAATAGCTGCCCGT
TTCTGTGAGGATGAAATGCCTTTGCCGCCGACGGGTAAGATGTGGGAAGCTGGATGTGGGTATCTTGATACCGCC
AGAGGCCTTTTGGCAAAAGTGTTCCATGTTTCCCGACCCTCAACTGTCCAAGCACTCCTACTTCTCGGTTATCGA
GAATTTGGCATAGGTTCCATGGAGCAAGGTTGGATTTTCATCGGGATGGCTATTCGAATGGCCTTTGATTTAGGG
TTGAATTGCGATTCCTCAAAATGGAAGGTTCGCGGACATGATCTATTTTCGGCAGAGGACAGTCAAACGAGGGGA
CATATCTGGTGGGCGTGTGTTTTGGCTGACCGTTATGGCTCTATCTACATGGGGCGTCCAACAATGATCAAAGAC
AACGACAGCGATATGTCATTGCCTGGTATTGAACCTGAAGAAGACATTGCTCCGTGGCAGCCGCACCCCTCCGAT
GGGCTCTCTTACAGTCCGACACCTGGACGGATTATGAGCAGCTTTGCCGCTGCGTCGCGGCTGTCTCTCATTTCT
GGCACGGTCATTAACCGGGTGTACCCTGTGCAGAGTATTAGTAGAGTAGCAAAGCAAGCAGTCTTGAACGAATGC
GAGGCCCAGTTGGATCAATGGTTGATAAGTTTGCCAGATTATCTGCGGTGCGATTCAGGTAATCGACGTTGCTCT
CCATCACCACAAGTCATATTTCTTCATATTCGCTACTGGGGTTGTGTTTTACTTCTCTATCGCGCATTTATTCCT
AATTGGAAGAGTAGCGAGGACGTGGCGCGTAATTCTCCTATAGGGTCCAAGGCTCTTGATCTTGCCCAAAGTGCT
GCGAGCCACATCAGTTCCTTAGTCACCATGTACCGGGAAACATTTACACTCAAGAGGTCTTCCCCGTTCCTCACA
GCATATTTGCTAAGTGCTTCCATTATGCATATCTTGACCCTGTCACTTCGCTCTACGCATGTTGAGGCAACGTTG
GGCTTGCAACAGTGTATGTCGGCTCTCAAAGATATGGAGATCCTATGGCCGAGCGCTTCTCGGGCCTGGGAATTA
CTTAACGGGGTCAAATTATCGGATGGCATATGTGCGGTGCCGTTACCGCAATTACACGGGCAACAAACCGAAAGA
CAAAAGCGGCCAGCCGATGATGCATTTGGCCAAGAGAAAAATCCAGAATATCCGCAAAGTGGTGTTTACGAACGG
GGGAATGGCACCACTAACCAAAATGCTTCTGGGAGCCAAACAGGTGTTCATGATCTGAGTACACGCATCATGGCT
CATATGCTCGGGCTTGATATCCAAGGCATTGAACCGTCGTCAATGTCATACTACCCTGGATATCAATGGTGGCCA
GGATCTTCAGGGCAAGGAGAGTCGTCGACTCAGCACACCTCAGAACCTATACACCCACCCATGTCTGATCCTACT
CAATTAGCCGCCCTTCCTGTTGGTCCTCGTGGTACTATCAACACTCCAGCGAACAGGAACTCCCATGAGAATTGG
ACCTATCAACAAGGTCAATCGAAGCGCGTATCAGAAAGTTATTCTTATGATTTCAGCCAATTCGGTCCTTGA
Transcript >Agabi119p4|004140
ATGGAGTGGAAAGACTCAGATCCCTCGGACGATGAGAATAGTCTGGCGACCTCTCGCAAGCGCAGCAGCAGAGCA
TGTGATCAGTGTCGGAAAACTAAGAGCAAATGCGAGCGACCTTCAGGCAGCGCAACACAATGCAAGAGCTGTGCA
CTTACTGGCACTCTCTGCACCTTCTTAGGTCCGAGTTACAAACGCGGTCCCCCGAAAGGCTATATCCATGCAATA
GAACAACGTTGGCATCAGGTCGAATCCTTGCTGGGCGCCATTCTTCAGTGCCCAGATGCACGAGTACAGGCGTTT
GTCAATGATTTGAAACAAGACGATTTAGCTTCCGAAATCATTGATAGAGTTGACATGGGTCCATACGGTCCTGCT
GGACGGCGCAGTCAGCCTGCAGGAGCCACCAAAGAAGACTTTTTCGCCTCTATCCTCCGAAGCAATGGGTCGAAT
ACTCGCGATAATTCTCGCTCTAGGCGACAATCAAGAGTGTCTCGTGAAATTGTTTCATCGACACAAGATCATGGC
CTTTCTGTCGTACCGACAAAGGAGTGGCAAGACAATCTTTCACGACGTCTTGCTTCAGCAGGCCGAAACTCCACT
ACTTCAAATACTTCCTACGGTACTTACCGTGCACCGAGCTCTTCAAATGTACCCCTAGCGCAACGACGGCGCCTG
AATGACACAGTTGAACCGCCTTATTCTCCAGATTGGAGTGGAATGTATACATTTAATCAAGAAGAACCGTTGGAA
TCCGACGAAGCGAAGGAAGCCACAGAATGTATGGGATCACTTTCCCTTGACGAGAACCAAGAGATACGATATCAC
GGGCGTATTAGTGGTCTATCCTTACTGGAACGGAATAAGCGGACAGATGATCGAATGGACGGTGGGATATGGCGA
TTACCTATGGCAAGGGTCTGGCCCCCGGCTCGCTATGGGCTCGCTTCGCCTCCTATTGGAGAGATGGAAGAACAC
TTGCCACCATGGGATATTCAAGACCGTCTACTCGAACTCTATTTCACCTATATCCATCCAGTTTATCCTCTGATC
TATAAACGCCGCTTCCTGTTGGAGTATCAGTATAAAAGACAAGGGACTAGGCGTGAATCCCAACCAAATAGCCCA
CGATTGCCAAGGCCCGAGCCGACGCAAGAAGTTACACCGCTTCTACTTCTTGCTATTTTTGCAATAGCTGCCCGT
TTCTGTGAGGATGAAATGCCTTTGCCGCCGACGGGTAAGATGTGGGAAGCTGGATGTGGGTATCTTGATACCGCC
AGAGGCCTTTTGGCAAAAGTGTTCCATGTTTCCCGACCCTCAACTGTCCAAGCACTCCTACTTCTCGGTTATCGA
GAATTTGGCATAGGTTCCATGGAGCAAGGTTGGATTTTCATCGGGATGGCTATTCGAATGGCCTTTGATTTAGGG
TTGAATTGCGATTCCTCAAAATGGAAGGTTCGCGGACATGATCTATTTTCGGCAGAGGACAGTCAAACGAGGGGA
CATATCTGGTGGGCGTGTGTTTTGGCTGACCGTTATGGCTCTATCTACATGGGGCGTCCAACAATGATCAAAGAC
AACGACAGCGATATGTCATTGCCTGGTATTGAACCTGAAGAAGACATTGCTCCGTGGCAGCCGCACCCCTCCGAT
GGGCTCTCTTACAGTCCGACACCTGGACGGATTATGAGCAGCTTTGCCGCTGCGTCGCGGCTGTCTCTCATTTCT
GGCACGGTCATTAACCGGGTGTACCCTGTGCAGAGTATTAGTAGAGTAGCAAAGCAAGCAGTCTTGAACGAATGC
GAGGCCCAGTTGGATCAATGGTTGATAAGTTTGCCAGATTATCTGCGGTGCGATTCAGGTAATCGACGTTGCTCT
CCATCACCACAAGTCATATTTCTTCATATTCGCTACTGGGGTTGTGTTTTACTTCTCTATCGCGCATTTATTCCT
AATTGGAAGAGTAGCGAGGACGTGGCGCGTAATTCTCCTATAGGGTCCAAGGCTCTTGATCTTGCCCAAAGTGCT
GCGAGCCACATCAGTTCCTTAGTCACCATGTACCGGGAAACATTTACACTCAAGAGGTCTTCCCCGTTCCTCACA
GCATATTTGCTAAGTGCTTCCATTATGCATATCTTGACCCTGTCACTTCGCTCTACGCATGTTGAGGCAACGTTG
GGCTTGCAACAGTGTATGTCGGCTCTCAAAGATATGGAGATCCTATGGCCGAGCGCTTCTCGGGCCTGGGAATTA
CTTAACGGGGTCAAATTATCGGATGGCATATGTGCGGTGCCGTTACCGCAATTACACGGGCAACAAACCGAAAGA
CAAAAGCGGCCAGCCGATGATGCATTTGGCCAAGAGAAAAATCCAGAATATCCGCAAAGTGGTGTTTACGAACGG
GGGAATGGCACCACTAACCAAAATGCTTCTGGGAGCCAAACAGGTGTTCATGATCTGAGTACACGCATCATGGCT
CATATGCTCGGGCTTGATATCCAAGGCATTGAACCGTCGTCAATGTCATACTACCCTGGATATCAATGGTGGCCA
GGATCTTCAGGGCAAGGAGAGTCGTCGACTCAGCACACCTCAGAACCTATACACCCACCCATGTCTGATCCTACT
CAATTAGCCGCCCTTCCTGTTGGTCCTCGTGGTACTATCAACACTCCAGCGAACAGGAACTCCCATGAGAATTGG
ACCTATCAACAAGGTCAATCGAAGCGCGTATCAGAAAGTTATTCTTATGATTTCAGCCAATTCGGTCCTTGA
Gene >Agabi119p4|004140
ATGGAGTGGAAAGACTCAGATCCCTCGGACGATGAGAATAGTCTGGCGACCTCTCGCAAGCGCAGCAGCAGAGGT
TCGTCTTTGCCCTCGATTCTTCCGTGTTAAGCCCTCTAATGACTTTATTGTTCAGCATGTGATCAGTGTCGGAAA
ACTAAGAGCAAATGCGAGCGACCTTCAGGCAGCGCAACACAATGCAAGAGCTGTGCACTTACTGGCACTCGTACG
TCTTGATCTCCACTTGAATTTATCGTGCTCATTTTCCCCATATTGTAGTCTGCACCTTCTTAGGTATATGTATTC
CATCAGTTAGCAGACAAGTCATTTATCCATTTTGCCCAAGGTCCGAGTTACAAACGCGGTCCCCCGAAAGGCTAT
ATCCATGCAATAGAACAACGTTGGCATCAGGTCGAATCCTTGCTGGGCGCCATTCTTCAGTGCCCAGATGCACGA
GTACAGGCGTTTGTCAATGATTTGAAACAAGACGATTTAGCTTCCGAAATCATTGATAGAGTTGACATGGGTCCA
TACGTACGTCCGATTTTCCTCACATGATAGTTGCTTTGTCTCAGCTGGTCTGTTCAGGGTCCTGCTGGACGGCGC
AGTCAGCCTGCAGGAGCCACCAAAGAAGACTTTTTCGCCTCTATCCTCCGAAGCAATGGGTCGAATACTCGCGAT
AATTCTCGCTCTAGGCGACAATCAAGAGTGTCTCGTGAAATTGTTTCATCGACACAAGGTAAGTCGTGGCCAAGC
GTTGTCTTGCTGCCATCGTTGATAACCTCATATCTATAGATCATGGCCTTTCTGTCGTACCGACAAAGGAGTGGC
AAGACAATCTTTCACGACGTCTTGCTTCAGCAGGCCGAAACTCCACTACTTCAAATACTTCCTACGGTACTTACC
GTGCACCGAGCTCTTCAAATGTACCCCTAGCGCAACGACGGCGCCTGAATGACACAGTTGAACCGCCTTATTCTC
CAGATTGGAGTGGAATGTATACATTTAATCAAGAAGGTACTCAAAATCGTCTACGTGTTCCTGCTAATCACTCAC
GTCTTTTAGAACCGTTGGAATCCGACGAAGCGAAGGAAGCCACAGAATGTATGGGATCACTTTCCCTTGACGAGA
ACCAAGAGGTATATTCCTGTTCAACCTGGGATTGATCTGGTTACAAGCCGTTTCAGATACGATATCACGGGCGTA
TTAGTGGTCTATCCTTACTGGAACGGAATAAGCGGACAGATGATCGAATGGACGGTGGGATATGGTAAGATTTTC
GAGCCTTTGTCGCCCAAGGTATATCTGACCTTTGCATTCGTAGGCGATTACCTATGGCAAGGGTCTGGCCCCCGG
CTCGCTATGGGCTCGCTTCGCCTCCTATTGGAGAGATGGAAGAACACTTGCCACCATGGGATATTCAAGACCGTC
TACTCGAACTCTATTTCACCTATATCCATCCAGTTTATCCTCTGATCTATAAACGCCGCTTCCTGTTGGAGTATC
AGTATAAGTAAGTCATGTCACATATCTTTTATGGAAAATTGTTAAGCAAGTCCGCAGAAGACAAGGGTACGGTTG
ATCAGGTTTCAAGTTTTATTTCCCTCTGACTGCTCCTAATAGGACTAGGCGTGAATCCCAACCAAATAGCCCACG
ATTGCCAAGGCCCGAGCCGACGCAAGAAGTTACACCGCTTCTACTTCTTGCTATTTTTGCAATAGCTGCCCGTTT
CTGTGAGGATGAAATGCCTTTGCCGCCGACGGGTAAGATGTGGGAAGCTGGATGTGGGTATCTTGATACCGCCAG
AGGCCTTTTGGGTAAGTGAGACGAACTCTTTACCTTAGATTTTTCGCTCATCGAGCCCTGCAGCAAAAGTGTTCC
ATGTTTCCCGACCCTCAACTGTCCAAGCACTCCTACTTCTCGGTTATCGAGAATTTGGCATAGGTAGATTCCCAA
AATATTGTCTGAAGCTTTGTTCATCGATTTCCGTAGGTTCCATGGAGCAAGGTTGGATTTTCATCGGTGAGTCCT
ACCTTGTCATGATCACATCAACGTCTACTCATCGAGACCAGGGATGGCTATTCGAATGGTGATTAGCATCATTTT
CTCGTTGGTGGGTTTAACTAAATCAGCTTCGATTCAGGCCTTTGATTTAGGGTTGAATTGCGATTCCTCAAAATG
GAAGGTTCGCGGACATGATCTATTTTCGGCAGAGGACAGTCAAACGAGGGGACATATCTGGTGGGCGTGTGTTTT
GGCTGACCGGTGCGTCAGCTTGATCCTGTCCTTGACACAATTATCCTATTGGTGGCCCTGTGTTTTCTAGTTATG
GCTCTATCTACATGGGGCGTCCAACAATGATCAAAGACAACGACAGCGATATGTCATTGCCTGGTATTGAACCTG
TGAGTGCTTTACTAAATGACGAAGTTTCACTGAAGCGATCTGAATCTAGGAAGAAGACATTGCTCCGTGGCAGCC
GCACCCCTCCGATGGGCTCTCTTACAGTCCGACACCTGGACGGATTATGAGCAGCTTTGCCGCTGCGTCGCGGCT
GTGTGAGTGTCTGGACCTACGCTTAGCTGGTTCTTATTCATTTCCCTCATATAGCTCTCATTTCTGGCACGGTCA
TTAACCGGGTGTACCCTGTGCAGAGTATTAGTAGAGTAGCAAAGCAAGCAGTCTTGAACGAATGCGAGGCCCAGT
TGGATCAATGGTTGATAAGTTTGCCAGATTATCTGCGGTGCGATTCAGGTAATCGACGTTGCTCTCCATCACCAC
AAGTCATATTTCTTCATATTCGCTACTGGGGTTGTGTTTTACTTCTCTATCGCGCATTGTGAGTTTCTTTAGCAT
AATTCTTTTCCACTGACTGACGCTGGAGTACAGTATTCCTAATTGGAAGAGGTATAAACCCCCGGTTTCGTCGAA
TATACATGTGACTCTGACCTACCTACAGTAGCGAGGACGTGGCGCGTAATTCTCCTATAGGGTCCAAGGCTCTTG
ATCTTGCCCAAAGTGCTGCGAGCCACATCAGTTCCTTAGGTAGGCCCTTGTGTCCCCCTTATTTTTCTGACCTCA
TTTCTGGGCAGTCACCATGTACCGGGAAACATTTACACTCAAGAGGTCTTCCCCGTTCCTCACAGCATATTTGCT
AAGTGCTTCGTTAGTCGTTCATCATCTACCAAATCTCCATATATGCTCATTGCCCTCCAGCATTATGCATATCTT
GACCCGTCAGTCTTTAAAATAGTCACTTTTCTCGATTTTAACAGCGGTCTAGTGTCACTTCGCTCTACGCATGTT
GAGGCAACGTTGGGCTTGCAACAGTGTATGTCGGCTCTCAAAGATATGGAGGTTCGGGTTTGGCTAAACGATTTT
GATGATGCCTAAAATAATCTCCTCACAGATCCTATGGCCGAGCGCTTCTCGGGCCTGGGAATTACTTAACGGGGT
CAAATTATCGGATGGCATATGTGCGGTGCCGTTACCGCAATTACACGGGCAACAAACCGAAAGACAAAAGCGGCC
AGCCGATGATGCATTTGGCCAAGAGAAAAATCCAGAATATCCGCAAAGTGGTGTTTACGAACGGGGGAATGGCAC
CACTAACCAAAATGCTTCTGGGAGCCAAACAGGTGTTCATGATCTGAGTACACGCATCATGGCTCATATGCTCGG
GCTTGATATCCAAGGCATTGAACCGTCGTCAATGTCATACTACCCTGGATATCAATGGTGGCCAGGATCTTCAGG
GCAAGGAGAGTCGTCGACTCAGCACACCTCAGAACCTATACACCCACCCATGTCTGATCCTACTCAATTAGCCGC
CCTTCCTGTTGGTCCTCGTGGTACTATCAACACTCCAGCGAACAGGAACTCCCATGAGAATTGGACCTATCAACA
AGGTCAATCGAAGCGCGTATCAGAAAGTTATTCTTATGATTTCAGCCAATTCGGTCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail