Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|003830
Gene name
Locationscaffold_01a:988712..990981
Strand-
Gene length (bp)2269
Transcript length (bp)1965
Coding sequence length (bp)1965
Protein length (aa) 655

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family 1.5E-08 6 192
PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase 1.0E-06 10 199

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5BAA2|RHA1_EMENI Rhamnogalacturonan acetylesterase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN2528 PE=1 SV=1 8 221 8.0E-52
sp|Q00017|RHA1_ASPAC Rhamnogalacturonan acetylesterase OS=Aspergillus aculeatus GN=rha1 PE=1 SV=1 16 216 7.0E-47
sp|O31528|RHGT2_BACSU Probable rhamnogalacturonan acetylesterase YesY OS=Bacillus subtilis (strain 168) GN=yesY PE=1 SV=1 5 203 8.0E-08

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|003830
MAVGGGGSGTQGWGVFLAQFLTIPVVNNAIGGESARSYSDQGLFTNLIENTQKGDYVIIEFGHNDGSAGAIDNGK
QDAVGDGYNITSVVTTSSGSQILIHSFAFYIENAITALLRKGAIPIISSQTPDNIWIDGAIAGPNRFVTYARSIG
SRRNVTYVDHYAYVASAFNTLGQTQTTTFYPNDHLHTNAAGALVVAEAFVRGLLCGNNSLRSRVNSAGQAVPGGM
AKATMLHNASRWPTSTLRSMDDRSSTLRPDARSIDANTARSSLDRRSTAKPSAGGLDRLKEGALPTRSLVALSTP
HDQVLERMYSHPRRSESALALPFPSSLDARHPPLRVRSKTGGSEMASTQARIVNEPANSGEGPLGATPPVSSASN
TLPAPTLYDPFDGSPLGTVLPPEAPTHEDGMSVHIEGSNEELWAHLSRVLDLQKQIARMHVDMEGLGQGKPTDGK
GKGAAFAFPRATSTGSEPEHEIGDEEGVGVVDEEAEKLIARESEFKKLATQFEGRKEAINEVMSKLDDLSDALTE
FHHLQAPKIEFRSTSRNNSADPSYGEQPQTHARSQSGTSSFVNTSDSSVRSPPAPKPTPAFHFQPMSHVHTAISA
EPDAERQLLIPSLGRKESMVLPLIIEPESDSPGRMVDSPLSSASLKLPSENNPQ*
Coding >Agabi119p4|003830
ATGGCGGTAGGAGGAGGCGGTAGCGGTACGCAAGGTTGGGGCGTATTCCTGGCACAGTTCTTGACTATCCCCGTC
GTCAACAATGCTATTGGGGGTGAAAGTGCTAGGTCATATAGTGACCAAGGGTTATTCACAAATCTGATTGAAAAC
ACTCAGAAGGGCGACTATGTCATAATCGAATTTGGTCACAATGATGGGAGTGCAGGCGCAATTGACAACGGAAAG
CAGGATGCCGTCGGCGACGGCTACAATATAACAAGTGTTGTCACTACATCGAGTGGTTCCCAAATCTTGATCCAC
AGCTTTGCCTTCTACATCGAAAATGCTATAACTGCTTTACTCCGGAAGGGTGCTATACCCATCATCTCGTCACAG
ACCCCAGACAACATTTGGATCGACGGTGCCATTGCAGGCCCCAACAGGTTTGTAACTTACGCTCGGAGCATTGGG
TCTCGAAGAAATGTCACCTATGTCGACCATTATGCATATGTTGCTTCCGCCTTCAATACCCTCGGCCAAACACAA
ACCACGACATTCTATCCGAATGATCATCTTCATACAAATGCTGCTGGCGCCCTTGTCGTAGCCGAAGCCTTTGTG
CGCGGGTTGTTGTGTGGAAACAATTCCTTAAGGTCAAGGGTCAATTCAGCTGGACAAGCCGTTCCAGGAGGCATG
GCGAAGGCGACGATGCTCCACAACGCCTCTCGATGGCCGACATCGACATTGAGGTCCATGGACGATCGCAGCTCA
ACTCTCAGACCAGATGCCCGTTCAATAGATGCCAATACTGCGCGATCGTCTCTTGACCGTCGCTCTACAGCGAAA
CCGAGTGCAGGCGGCTTAGATCGACTGAAGGAGGGCGCACTACCAACAAGGAGCTTGGTTGCTCTGAGCACACCT
CATGACCAGGTTCTAGAGAGAATGTACAGCCATCCGCGCAGGTCTGAAAGTGCCCTTGCCCTTCCTTTTCCCAGC
TCGCTGGATGCCAGGCACCCGCCACTCCGTGTTCGATCTAAAACGGGTGGAAGTGAGATGGCTTCCACCCAAGCA
CGCATCGTAAATGAACCTGCGAATTCCGGTGAAGGCCCTTTGGGTGCAACTCCTCCTGTCTCCTCTGCCAGCAAC
ACCCTGCCAGCACCTACACTATACGACCCCTTCGACGGTTCTCCCCTTGGTACCGTCCTCCCACCAGAAGCCCCC
ACACACGAAGACGGCATGTCCGTACATATAGAAGGATCCAACGAGGAATTATGGGCACACCTTTCCCGAGTGCTC
GACCTTCAGAAACAGATCGCTCGGATGCATGTCGACATGGAGGGTCTTGGTCAGGGAAAGCCGACGGATGGCAAG
GGGAAAGGGGCCGCTTTCGCTTTCCCGAGAGCAACCAGTACTGGTTCTGAGCCTGAGCATGAAATAGGTGACGAA
GAGGGCGTTGGAGTTGTCGATGAGGAGGCAGAGAAACTGATAGCTAGGGAAAGTGAATTCAAGAAGTTGGCAACA
CAATTCGAGGGCAGAAAGGAAGCAATTAACGAAGTGATGTCCAAGCTCGATGACCTCTCTGATGCTCTGACAGAA
TTTCACCACCTACAAGCCCCGAAAATCGAATTTCGAAGCACGTCGCGTAACAACTCAGCTGATCCCAGCTACGGC
GAACAGCCTCAGACTCACGCTAGGTCACAGAGTGGTACTTCATCCTTCGTCAATACCAGCGATTCTAGCGTCCGG
TCTCCTCCTGCACCTAAGCCTACTCCCGCGTTTCACTTTCAACCAATGTCACACGTGCACACCGCCATATCAGCC
GAACCTGATGCAGAACGTCAACTTCTCATCCCTTCCTTGGGCCGTAAAGAATCTATGGTTCTTCCTCTCATCATT
GAGCCTGAATCTGATTCCCCGGGTCGCATGGTTGACAGTCCACTTTCTTCCGCTAGTCTGAAGTTGCCATCTGAG
AACAACCCTCAGTGA
Transcript >Agabi119p4|003830
ATGGCGGTAGGAGGAGGCGGTAGCGGTACGCAAGGTTGGGGCGTATTCCTGGCACAGTTCTTGACTATCCCCGTC
GTCAACAATGCTATTGGGGGTGAAAGTGCTAGGTCATATAGTGACCAAGGGTTATTCACAAATCTGATTGAAAAC
ACTCAGAAGGGCGACTATGTCATAATCGAATTTGGTCACAATGATGGGAGTGCAGGCGCAATTGACAACGGAAAG
CAGGATGCCGTCGGCGACGGCTACAATATAACAAGTGTTGTCACTACATCGAGTGGTTCCCAAATCTTGATCCAC
AGCTTTGCCTTCTACATCGAAAATGCTATAACTGCTTTACTCCGGAAGGGTGCTATACCCATCATCTCGTCACAG
ACCCCAGACAACATTTGGATCGACGGTGCCATTGCAGGCCCCAACAGGTTTGTAACTTACGCTCGGAGCATTGGG
TCTCGAAGAAATGTCACCTATGTCGACCATTATGCATATGTTGCTTCCGCCTTCAATACCCTCGGCCAAACACAA
ACCACGACATTCTATCCGAATGATCATCTTCATACAAATGCTGCTGGCGCCCTTGTCGTAGCCGAAGCCTTTGTG
CGCGGGTTGTTGTGTGGAAACAATTCCTTAAGGTCAAGGGTCAATTCAGCTGGACAAGCCGTTCCAGGAGGCATG
GCGAAGGCGACGATGCTCCACAACGCCTCTCGATGGCCGACATCGACATTGAGGTCCATGGACGATCGCAGCTCA
ACTCTCAGACCAGATGCCCGTTCAATAGATGCCAATACTGCGCGATCGTCTCTTGACCGTCGCTCTACAGCGAAA
CCGAGTGCAGGCGGCTTAGATCGACTGAAGGAGGGCGCACTACCAACAAGGAGCTTGGTTGCTCTGAGCACACCT
CATGACCAGGTTCTAGAGAGAATGTACAGCCATCCGCGCAGGTCTGAAAGTGCCCTTGCCCTTCCTTTTCCCAGC
TCGCTGGATGCCAGGCACCCGCCACTCCGTGTTCGATCTAAAACGGGTGGAAGTGAGATGGCTTCCACCCAAGCA
CGCATCGTAAATGAACCTGCGAATTCCGGTGAAGGCCCTTTGGGTGCAACTCCTCCTGTCTCCTCTGCCAGCAAC
ACCCTGCCAGCACCTACACTATACGACCCCTTCGACGGTTCTCCCCTTGGTACCGTCCTCCCACCAGAAGCCCCC
ACACACGAAGACGGCATGTCCGTACATATAGAAGGATCCAACGAGGAATTATGGGCACACCTTTCCCGAGTGCTC
GACCTTCAGAAACAGATCGCTCGGATGCATGTCGACATGGAGGGTCTTGGTCAGGGAAAGCCGACGGATGGCAAG
GGGAAAGGGGCCGCTTTCGCTTTCCCGAGAGCAACCAGTACTGGTTCTGAGCCTGAGCATGAAATAGGTGACGAA
GAGGGCGTTGGAGTTGTCGATGAGGAGGCAGAGAAACTGATAGCTAGGGAAAGTGAATTCAAGAAGTTGGCAACA
CAATTCGAGGGCAGAAAGGAAGCAATTAACGAAGTGATGTCCAAGCTCGATGACCTCTCTGATGCTCTGACAGAA
TTTCACCACCTACAAGCCCCGAAAATCGAATTTCGAAGCACGTCGCGTAACAACTCAGCTGATCCCAGCTACGGC
GAACAGCCTCAGACTCACGCTAGGTCACAGAGTGGTACTTCATCCTTCGTCAATACCAGCGATTCTAGCGTCCGG
TCTCCTCCTGCACCTAAGCCTACTCCCGCGTTTCACTTTCAACCAATGTCACACGTGCACACCGCCATATCAGCC
GAACCTGATGCAGAACGTCAACTTCTCATCCCTTCCTTGGGCCGTAAAGAATCTATGGTTCTTCCTCTCATCATT
GAGCCTGAATCTGATTCCCCGGGTCGCATGGTTGACAGTCCACTTTCTTCCGCTAGTCTGAAGTTGCCATCTGAG
AACAACCCTCAGTGA
Gene >Agabi119p4|003830
ATGGCGGTAGGAGGAGGCGGTAGCGGTACGCAAGGTACGCATTACTGCATGTCAATTCTCTTCAGGTGGACGTTT
ACCTTTGAAGTTAGGTTGGGGCGTATTCCTGGCACAGTTCTTGACTATCCCCGTCGTCAACAATGCTATTGGGGG
TGAAAGTGCTAGGTCATATAGTGACCAAGGGTTATTCACAAATCTGATTGAAAACACTCAGAAGGGCGACTATGT
CATAATCGAATTTGGTCACAATGATGGGAGTGCAGGCGCAATTGACAACGGAAAGCAGGATGCCGTCGGCGACGG
CTACAATATAACAAGTGTTGTCACTACATCGAGGCAAGTGGTTCAATACATGACGTTCATGCTGAGATTCACATA
TGATCAAGTCAGTGGTTCCCAAATCTTGATCCACAGCTTTGCCTTCTACATCGAAAATGCTATAACTGCTTTACT
CCGGAAGGGTGCTATACCCATCATCTCGTCACAGACCCCAGACAACATTTGGATCGACGGTGCCATTGCAGGCCC
CAACAGGTTTGTAACTTACGCTCGGAGCATTGGGTCTCGAAGAAATGTCACCTATGTCGACCATTATGCATATGT
TGCTTCCGCCTTCAATACCCTCGGCCAAACACAAACCACGACATTCTATCCGAATGATCATCTTCATACAAATGC
TGCTGGCGCCCTTGTCGTAGCCGAAGCCTTTGTGCGCGGGTTGTTGTGTGGAAACAATTCCTTAAGGTCAAGGGT
CAATTCAGCTGGACAAGCCGTTCCAGGTACCACTTGCCTTGTACTGAGTCTATATTTTGGGCTATCTGACTCGCG
TTACAGGAGGGTGTGTGTGATCAGCGTACTCGGTTGTATCGTAAAGTACTCGAATAGATACTCTCTGAAGGTCCA
CGTGATATAATGATGGGCTAAGCATGGCGAAGGCGACGATGCTCCACAACGCCTCTCGATGGCCGACATCGACAT
TGAGGTCCATGGACGATCGCAGCTCAACTCTCAGACCAGATGCCCGTTCAATAGATGCCAATACTGCGCGATCGT
CTCTTGACCGTCGCTCTACAGCGAAACCGAGTGCAGGCGGCTTAGATCGACTGAAGGAGGGCGCACTACCAACAA
GGAGCTTGGTTGCTCTGAGCACACCTCATGACCAGGTTCTAGAGAGAATGTACAGCCATCCGCGCAGGTCTGAAA
GTGCCCTTGCCCTTCCTTTTCCCAGCTCGCTGGATGCCAGGCACCCGCCACTCCGTGTTCGATCTAAAACGGGTG
GAAGTGAGATGGCTTCCACCCAAGCACGCATCGTAAATGAACCTGCGAATTCCGGTGAAGGCCCTTTGGGTGCAA
CTCCTCCTGTCTCCTCTGCCAGCAACACCCTGCCAGCACCTACACTATACGACCCCTTCGACGGTTCTCCCCTTG
GTACCGTCCTCCCACCAGAAGCCCCCACACACGAAGACGGCATGTCCGTACATATAGAAGGATCCAACGAGGAAT
TATGGGCACACCTTTCCCGAGTGCTCGACCTTCAGAAACAGATCGCTCGGATGCATGTCGACATGGAGGGTCTTG
GTCAGGGAAAGCCGACGGATGGCAAGGGGAAAGGGGCCGCTTTCGCTTTCCCGAGAGCAACCAGTACTGGTTCTG
AGCCTGAGCATGAAATAGGTGACGAAGAGGGCGTTGGAGTTGTCGATGAGGAGGCAGAGAAACTGATAGCTAGGG
AAAGTGAATTCAAGAAGTTGGCAACACAATTCGAGGGCAGAAAGGAAGCAATTAACGAAGTGATGTCCAAGGTCA
ATATTCCACTCATAACATTCAACTACATCTAACTAATAGCTCTTTCCAGCTCGATGACCTCTCTGATGCTCTGAC
AGAATTTCACCACCTACAAGCCCCGAAAATCGAATTTCGAAGCACGTCGCGTAACAACTCAGCTGATCCCAGCTA
CGGCGAACAGCCTCAGACTCACGCTAGGTCACAGAGTGGTACTTCATCCTTCGTCAATACCAGCGATTCTAGCGT
CCGGTCTCCTCCTGCACCTAAGCCTACTCCCGCGTTTCACTTTCAACCAATGTCACACGTGCACACCGCCATATC
AGCCGAACCTGATGCAGAACGTCAACTTCTCATCCCTTCCTTGGGCCGTAAAGAATCTATGGTTCTTCCTCTCAT
CATTGAGCCTGAATCTGATTCCCCGGGTCGCATGGTTGACAGTCCACTTTCTTCCGCTAGTCTGAAGTTGCCATC
TGAGAACAACCCTCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail