Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|003770
Gene name
Locationscaffold_01a:975684..979126
Strand+
Gene length (bp)3442
Transcript length (bp)3387
Coding sequence length (bp)3387
Protein length (aa) 1129

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O43156|TTI1_HUMAN TELO2-interacting protein 1 homolog OS=Homo sapiens GN=TTI1 PE=1 SV=3 6 1097 2.0E-19
sp|Q91V83|TTI1_MOUSE TELO2-interacting protein 1 homolog OS=Mus musculus GN=Tti1 PE=1 SV=2 690 1097 8.0E-19
sp|O94600|TTI1_SCHPO TEL2-interacting protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tti1 PE=1 SV=1 692 1041 9.0E-18
sp|P36097|TTI1_YEAST TEL2-interacting protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TTI1 PE=1 SV=1 692 993 1.0E-09
sp|P36097|TTI1_YEAST TEL2-interacting protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TTI1 PE=1 SV=1 6 424 2.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|003770
MSGSLFHLVKPTCVALLGSATLTPSSVPSCIKHLDDLVRILRAHSSELPQLSPSLVSYIFFPLSSILQRNDPPTI
PDQILEKVLILLGFLSESWWWHCEVAIWEQIFMLCGSVLSDGATAGRKSPRDDQVKQAAAQCLYTLLRQREASEL
LSPNNFQQAKARSAEFQRLARLPRFIPILGRTLGAVVESSESRTFSLQQTSLNVVQLLLESYAPDQVFPMILPGV
ISSMSKVALATKLDKQWANGDSVVSALHVMQIAIVRSVGDTICLAEGALRSADNLEDLTEIVAPSVDEPLEADAT
SSPTRRTPSWLKGTVSQLHIAINNLNVLTVHPNPVVLRALASFSGHVLKETTLTLPQTQPLLLAFLLSASMSPFQ
SVSSEAHSHLSVLLPIGHKSRVSFLRILLRNMSEYLSALPRLVSVQEESKVQHLASLIEAICRLASPSKDSVSTA
APAISQGIGKLLGPSGEVEKWGWNLLSVFEFSEVAVAVQMTPERLMLEGNPNTSQLPVFPTMQLRSMGITTLEAV
ERMFRALGDAGGDACLYAVEWFIGIGKGGTGRDAVAAMWCACRLLEGVSNIHLSVEESYDHITPRSTKRLEKLAR
SLAKTLPELWGLQAGDTDQYPQPNNTSQDLGEASLVERKIGLKQLHANLKIIRSSPAVIVDTYDQPINHRALALQ
IISVCVGILQSRSTLLLIHVLYPVLHSLVSQVSFLASTAYASLQFMTAAASYASPANLLLSNFDYALDAISRRLT
RRRLDVVATQVLVLLVRLVGSDVVEKAGDVVEECFDRLDEFHGYDVVVEGLVNVLVEVTKCLRNEAPQNAKPVKE
PRYTPYARVSDITGFFQWYRQRHDLKAEEEDVNYGPAPRRAWGEDKEKSTEEEEDAAIRKTENPSDEPPPTPTQA
LTKQIVSRSLYFLTHGSPVIRARILKLLAFSIPNIPSSALMPAIHSAWPFILNRLSDQETFVVSATAFLIEMLST
HMGEYMFRRIWDDVWPKFKTLLAELQAGDQKNALVQRGRDFVGAESAYTHSHRLYRALLDTMTAALQDVHLHERS
FWDVLVLFRRFLSSAAHPELQQCARRLYSAAMTQDADTVWLVLSATFTHDHTVLAFLYNTKWDIIGNARIVLGIS
PTD*
Coding >Agabi119p4|003770
ATGTCTGGCAGTCTCTTCCACCTCGTTAAGCCCACATGTGTGGCTCTCCTGGGCTCCGCCACTCTTACCCCGTCT
TCAGTTCCCAGCTGCATCAAACACCTCGACGATCTAGTCCGCATCCTTCGCGCTCACTCCTCGGAACTCCCACAA
CTTTCACCTTCTCTCGTCTCCTATATCTTCTTTCCGCTCTCATCGATTCTCCAAAGGAATGATCCTCCTACCATC
CCTGACCAGATTCTGGAAAAGGTCCTCATTTTACTTGGCTTCCTTTCGGAAAGCTGGTGGTGGCATTGCGAAGTC
GCCATTTGGGAGCAAATTTTTATGCTTTGCGGGTCCGTTCTTAGTGATGGGGCAACTGCAGGCAGGAAGAGTCCC
CGTGATGATCAAGTGAAACAGGCTGCCGCACAATGCTTGTATACATTACTCCGTCAACGCGAAGCCAGTGAATTA
CTGTCACCGAACAACTTCCAACAAGCCAAGGCTCGCTCAGCCGAGTTCCAACGTCTTGCTCGTCTGCCTCGTTTC
ATTCCCATCCTTGGACGAACTCTAGGTGCTGTTGTCGAATCTTCGGAATCACGCACTTTTTCCCTCCAACAGACT
TCCCTCAACGTTGTACAGCTCCTATTGGAATCCTACGCTCCAGATCAGGTCTTCCCTATGATTCTTCCCGGCGTT
ATCAGTTCTATGTCGAAAGTTGCATTGGCCACTAAACTAGATAAGCAATGGGCTAATGGCGATAGTGTGGTTTCA
GCCCTCCATGTAATGCAAATTGCCATTGTTAGATCCGTCGGCGACACTATCTGTCTTGCGGAAGGAGCTTTGCGC
TCTGCTGATAACTTGGAAGATTTGACCGAAATCGTCGCACCGTCCGTCGACGAACCACTAGAAGCGGATGCAACT
TCTTCCCCTACGAGGAGAACTCCATCCTGGCTCAAAGGCACAGTCTCACAGCTCCATATTGCCATCAATAACTTG
AATGTTTTAACTGTTCATCCAAATCCAGTTGTTCTTCGTGCCTTAGCGTCTTTTTCTGGGCATGTTCTCAAAGAG
ACGACTCTAACTTTACCTCAAACCCAACCTCTCCTCCTCGCTTTCCTCCTCTCCGCATCAATGTCCCCTTTTCAG
TCAGTATCATCGGAAGCGCATTCACACCTGTCAGTTCTACTGCCAATTGGACACAAATCACGGGTGTCCTTTCTG
CGGATATTATTGCGAAACATGAGCGAATACTTATCGGCTCTCCCTCGCTTAGTCTCCGTCCAGGAAGAAAGTAAG
GTACAACATCTGGCTAGTCTAATTGAGGCTATCTGCCGATTAGCCTCTCCCAGCAAAGACTCTGTGAGTACAGCA
GCCCCAGCAATAAGCCAAGGCATCGGGAAGCTGTTGGGGCCGTCTGGGGAAGTTGAGAAGTGGGGCTGGAATCTT
TTATCGGTTTTCGAATTTTCCGAGGTCGCGGTCGCAGTCCAAATGACTCCGGAGCGACTCATGCTTGAGGGAAAT
CCTAATACTTCACAACTCCCGGTATTTCCCACTATGCAGCTCAGAAGTATGGGTATTACTACGCTGGAAGCTGTT
GAACGTATGTTTCGGGCTCTAGGCGATGCAGGCGGTGACGCTTGTTTGTACGCTGTAGAGTGGTTTATTGGGATA
GGTAAGGGCGGAACAGGGAGAGACGCAGTCGCTGCTATGTGGTGCGCTTGTCGCCTCCTAGAGGGTGTCTCGAAC
ATACATCTATCAGTCGAAGAAAGTTATGATCACATTACGCCGAGGTCGACCAAAAGGTTAGAGAAACTCGCTCGA
TCCCTCGCCAAAACTCTCCCCGAGCTTTGGGGTCTTCAAGCTGGTGACACTGATCAGTATCCTCAGCCAAATAAC
ACTTCTCAGGACCTCGGAGAGGCGTCATTAGTCGAGCGTAAGATAGGACTCAAACAACTTCATGCAAATTTGAAA
ATCATCAGGTCGTCTCCCGCAGTCATAGTTGACACCTATGATCAGCCTATAAACCACCGCGCTTTGGCACTCCAG
ATCATCTCTGTCTGTGTTGGCATCCTCCAATCTCGTTCGACTTTGCTTTTGATCCATGTCCTTTATCCAGTCCTA
CACTCTTTAGTCTCCCAAGTCTCCTTTCTTGCATCAACTGCATATGCTAGCTTACAGTTTATGACCGCTGCTGCC
TCTTACGCCTCTCCTGCCAACCTTCTGCTTTCAAATTTCGATTACGCACTTGATGCGATCTCACGCAGACTTACG
CGTCGACGGCTTGACGTAGTGGCAACTCAAGTACTCGTCTTACTTGTGCGTCTGGTTGGAAGCGATGTAGTCGAA
AAAGCAGGGGATGTTGTAGAGGAATGTTTTGATCGGTTGGATGAATTTCATGGCTATGATGTTGTGGTTGAAGGT
CTTGTGAATGTCCTTGTAGAAGTCACGAAATGCCTTCGGAACGAAGCACCACAAAATGCTAAACCCGTGAAAGAG
CCGAGATACACCCCCTACGCTCGAGTATCTGATATCACAGGCTTCTTTCAGTGGTACCGTCAGCGTCACGATCTC
AAAGCCGAGGAAGAAGATGTTAATTACGGACCCGCTCCTAGAAGAGCCTGGGGCGAAGACAAAGAGAAAAGTACT
GAAGAGGAAGAGGATGCGGCGATAAGAAAAACTGAAAATCCGAGCGACGAGCCGCCCCCCACTCCAACCCAAGCC
TTGACGAAACAGATCGTCTCTCGATCATTATATTTCCTGACGCATGGATCTCCCGTCATACGAGCGCGCATCCTG
AAACTATTAGCATTCTCGATTCCAAACATACCTTCATCAGCACTCATGCCAGCCATCCACTCGGCCTGGCCTTTC
ATATTGAACCGGTTGAGCGACCAGGAGACCTTTGTCGTCAGTGCTACGGCCTTCTTGATTGAAATGCTATCGACT
CATATGGGAGAATATATGTTCCGAAGGATATGGGATGACGTTTGGCCTAAATTTAAAACCCTTTTAGCAGAATTA
CAGGCAGGAGACCAGAAAAACGCACTGGTTCAGAGAGGTCGAGATTTCGTAGGAGCTGAATCTGCTTATACGCAT
TCGCATCGCTTATACCGTGCACTCCTTGACACCATGACGGCTGCGCTACAAGATGTACACTTGCACGAACGCTCT
TTTTGGGATGTCCTTGTGCTGTTTCGTCGATTTCTGAGTAGCGCTGCGCATCCCGAATTACAGCAATGTGCGCGG
AGACTGTACAGTGCTGCAATGACACAAGATGCGGATACAGTGTGGCTCGTTCTATCAGCGACTTTCACACATGAC
CACACCGTCTTAGCGTTTTTGTATAACACGAAGTGGGATATCATTGGCAATGCTCGAATAGTACTGGGTATCTCG
CCTACAGATTAG
Transcript >Agabi119p4|003770
ATGTCTGGCAGTCTCTTCCACCTCGTTAAGCCCACATGTGTGGCTCTCCTGGGCTCCGCCACTCTTACCCCGTCT
TCAGTTCCCAGCTGCATCAAACACCTCGACGATCTAGTCCGCATCCTTCGCGCTCACTCCTCGGAACTCCCACAA
CTTTCACCTTCTCTCGTCTCCTATATCTTCTTTCCGCTCTCATCGATTCTCCAAAGGAATGATCCTCCTACCATC
CCTGACCAGATTCTGGAAAAGGTCCTCATTTTACTTGGCTTCCTTTCGGAAAGCTGGTGGTGGCATTGCGAAGTC
GCCATTTGGGAGCAAATTTTTATGCTTTGCGGGTCCGTTCTTAGTGATGGGGCAACTGCAGGCAGGAAGAGTCCC
CGTGATGATCAAGTGAAACAGGCTGCCGCACAATGCTTGTATACATTACTCCGTCAACGCGAAGCCAGTGAATTA
CTGTCACCGAACAACTTCCAACAAGCCAAGGCTCGCTCAGCCGAGTTCCAACGTCTTGCTCGTCTGCCTCGTTTC
ATTCCCATCCTTGGACGAACTCTAGGTGCTGTTGTCGAATCTTCGGAATCACGCACTTTTTCCCTCCAACAGACT
TCCCTCAACGTTGTACAGCTCCTATTGGAATCCTACGCTCCAGATCAGGTCTTCCCTATGATTCTTCCCGGCGTT
ATCAGTTCTATGTCGAAAGTTGCATTGGCCACTAAACTAGATAAGCAATGGGCTAATGGCGATAGTGTGGTTTCA
GCCCTCCATGTAATGCAAATTGCCATTGTTAGATCCGTCGGCGACACTATCTGTCTTGCGGAAGGAGCTTTGCGC
TCTGCTGATAACTTGGAAGATTTGACCGAAATCGTCGCACCGTCCGTCGACGAACCACTAGAAGCGGATGCAACT
TCTTCCCCTACGAGGAGAACTCCATCCTGGCTCAAAGGCACAGTCTCACAGCTCCATATTGCCATCAATAACTTG
AATGTTTTAACTGTTCATCCAAATCCAGTTGTTCTTCGTGCCTTAGCGTCTTTTTCTGGGCATGTTCTCAAAGAG
ACGACTCTAACTTTACCTCAAACCCAACCTCTCCTCCTCGCTTTCCTCCTCTCCGCATCAATGTCCCCTTTTCAG
TCAGTATCATCGGAAGCGCATTCACACCTGTCAGTTCTACTGCCAATTGGACACAAATCACGGGTGTCCTTTCTG
CGGATATTATTGCGAAACATGAGCGAATACTTATCGGCTCTCCCTCGCTTAGTCTCCGTCCAGGAAGAAAGTAAG
GTACAACATCTGGCTAGTCTAATTGAGGCTATCTGCCGATTAGCCTCTCCCAGCAAAGACTCTGTGAGTACAGCA
GCCCCAGCAATAAGCCAAGGCATCGGGAAGCTGTTGGGGCCGTCTGGGGAAGTTGAGAAGTGGGGCTGGAATCTT
TTATCGGTTTTCGAATTTTCCGAGGTCGCGGTCGCAGTCCAAATGACTCCGGAGCGACTCATGCTTGAGGGAAAT
CCTAATACTTCACAACTCCCGGTATTTCCCACTATGCAGCTCAGAAGTATGGGTATTACTACGCTGGAAGCTGTT
GAACGTATGTTTCGGGCTCTAGGCGATGCAGGCGGTGACGCTTGTTTGTACGCTGTAGAGTGGTTTATTGGGATA
GGTAAGGGCGGAACAGGGAGAGACGCAGTCGCTGCTATGTGGTGCGCTTGTCGCCTCCTAGAGGGTGTCTCGAAC
ATACATCTATCAGTCGAAGAAAGTTATGATCACATTACGCCGAGGTCGACCAAAAGGTTAGAGAAACTCGCTCGA
TCCCTCGCCAAAACTCTCCCCGAGCTTTGGGGTCTTCAAGCTGGTGACACTGATCAGTATCCTCAGCCAAATAAC
ACTTCTCAGGACCTCGGAGAGGCGTCATTAGTCGAGCGTAAGATAGGACTCAAACAACTTCATGCAAATTTGAAA
ATCATCAGGTCGTCTCCCGCAGTCATAGTTGACACCTATGATCAGCCTATAAACCACCGCGCTTTGGCACTCCAG
ATCATCTCTGTCTGTGTTGGCATCCTCCAATCTCGTTCGACTTTGCTTTTGATCCATGTCCTTTATCCAGTCCTA
CACTCTTTAGTCTCCCAAGTCTCCTTTCTTGCATCAACTGCATATGCTAGCTTACAGTTTATGACCGCTGCTGCC
TCTTACGCCTCTCCTGCCAACCTTCTGCTTTCAAATTTCGATTACGCACTTGATGCGATCTCACGCAGACTTACG
CGTCGACGGCTTGACGTAGTGGCAACTCAAGTACTCGTCTTACTTGTGCGTCTGGTTGGAAGCGATGTAGTCGAA
AAAGCAGGGGATGTTGTAGAGGAATGTTTTGATCGGTTGGATGAATTTCATGGCTATGATGTTGTGGTTGAAGGT
CTTGTGAATGTCCTTGTAGAAGTCACGAAATGCCTTCGGAACGAAGCACCACAAAATGCTAAACCCGTGAAAGAG
CCGAGATACACCCCCTACGCTCGAGTATCTGATATCACAGGCTTCTTTCAGTGGTACCGTCAGCGTCACGATCTC
AAAGCCGAGGAAGAAGATGTTAATTACGGACCCGCTCCTAGAAGAGCCTGGGGCGAAGACAAAGAGAAAAGTACT
GAAGAGGAAGAGGATGCGGCGATAAGAAAAACTGAAAATCCGAGCGACGAGCCGCCCCCCACTCCAACCCAAGCC
TTGACGAAACAGATCGTCTCTCGATCATTATATTTCCTGACGCATGGATCTCCCGTCATACGAGCGCGCATCCTG
AAACTATTAGCATTCTCGATTCCAAACATACCTTCATCAGCACTCATGCCAGCCATCCACTCGGCCTGGCCTTTC
ATATTGAACCGGTTGAGCGACCAGGAGACCTTTGTCGTCAGTGCTACGGCCTTCTTGATTGAAATGCTATCGACT
CATATGGGAGAATATATGTTCCGAAGGATATGGGATGACGTTTGGCCTAAATTTAAAACCCTTTTAGCAGAATTA
CAGGCAGGAGACCAGAAAAACGCACTGGTTCAGAGAGGTCGAGATTTCGTAGGAGCTGAATCTGCTTATACGCAT
TCGCATCGCTTATACCGTGCACTCCTTGACACCATGACGGCTGCGCTACAAGATGTACACTTGCACGAACGCTCT
TTTTGGGATGTCCTTGTGCTGTTTCGTCGATTTCTGAGTAGCGCTGCGCATCCCGAATTACAGCAATGTGCGCGG
AGACTGTACAGTGCTGCAATGACACAAGATGCGGATACAGTGTGGCTCGTTCTATCAGCGACTTTCACACATGAC
CACACCGTCTTAGCGTTTTTGTATAACACGAAGTGGGATATCATTGGCAATGCTCGAATAGTACTGGGTATCTCG
CCTACAGATTAG
Gene >Agabi119p4|003770
ATGTCTGGCAGTCTCTTCCACCTCGTAAGACCTGCGCTGCGCTTTCGTCGGTTCAGTTCACTCACGAACGTGAAC
TCAGGTTAAGCCCACATGTGTGGCTCTCCTGGGCTCCGCCACTCTTACCCCGTCTTCAGTTCCCAGCTGCATCAA
ACACCTCGACGATCTAGTCCGCATCCTTCGCGCTCACTCCTCGGAACTCCCACAACTTTCACCTTCTCTCGTCTC
CTATATCTTCTTTCCGCTCTCATCGATTCTCCAAAGGAATGATCCTCCTACCATCCCTGACCAGATTCTGGAAAA
GGTCCTCATTTTACTTGGCTTCCTTTCGGAAAGCTGGTGGTGGCATTGCGAAGTCGCCATTTGGGAGCAAATTTT
TATGCTTTGCGGGTCCGTTCTTAGTGATGGGGCAACTGCAGGCAGGAAGAGTCCCCGTGATGATCAAGTGAAACA
GGCTGCCGCACAATGCTTGTATACATTACTCCGTCAACGCGAAGCCAGTGAATTACTGTCACCGAACAACTTCCA
ACAAGCCAAGGCTCGCTCAGCCGAGTTCCAACGTCTTGCTCGTCTGCCTCGTTTCATTCCCATCCTTGGACGAAC
TCTAGGTGCTGTTGTCGAATCTTCGGAATCACGCACTTTTTCCCTCCAACAGACTTCCCTCAACGTTGTACAGCT
CCTATTGGAATCCTACGCTCCAGATCAGGTCTTCCCTATGATTCTTCCCGGCGTTATCAGTTCTATGTCGAAAGT
TGCATTGGCCACTAAACTAGATAAGCAATGGGCTAATGGCGATAGTGTGGTTTCAGCCCTCCATGTAATGCAAAT
TGCCATTGTTAGATCCGTCGGCGACACTATCTGTCTTGCGGAAGGAGCTTTGCGCTCTGCTGATAACTTGGAAGA
TTTGACCGAAATCGTCGCACCGTCCGTCGACGAACCACTAGAAGCGGATGCAACTTCTTCCCCTACGAGGAGAAC
TCCATCCTGGCTCAAAGGCACAGTCTCACAGCTCCATATTGCCATCAATAACTTGAATGTTTTAACTGTTCATCC
AAATCCAGTTGTTCTTCGTGCCTTAGCGTCTTTTTCTGGGCATGTTCTCAAAGAGACGACTCTAACTTTACCTCA
AACCCAACCTCTCCTCCTCGCTTTCCTCCTCTCCGCATCAATGTCCCCTTTTCAGTCAGTATCATCGGAAGCGCA
TTCACACCTGTCAGTTCTACTGCCAATTGGACACAAATCACGGGTGTCCTTTCTGCGGATATTATTGCGAAACAT
GAGCGAATACTTATCGGCTCTCCCTCGCTTAGTCTCCGTCCAGGAAGAAAGTAAGGTACAACATCTGGCTAGTCT
AATTGAGGCTATCTGCCGATTAGCCTCTCCCAGCAAAGACTCTGTGAGTACAGCAGCCCCAGCAATAAGCCAAGG
CATCGGGAAGCTGTTGGGGCCGTCTGGGGAAGTTGAGAAGTGGGGCTGGAATCTTTTATCGGTTTTCGAATTTTC
CGAGGTCGCGGTCGCAGTCCAAATGACTCCGGAGCGACTCATGCTTGAGGGAAATCCTAATACTTCACAACTCCC
GGTATTTCCCACTATGCAGCTCAGAAGTATGGGTATTACTACGCTGGAAGCTGTTGAACGTATGTTTCGGGCTCT
AGGCGATGCAGGCGGTGACGCTTGTTTGTACGCTGTAGAGTGGTTTATTGGGATAGGTAAGGGCGGAACAGGGAG
AGACGCAGTCGCTGCTATGTGGTGCGCTTGTCGCCTCCTAGAGGGTGTCTCGAACATACATCTATCAGTCGAAGA
AAGTTATGATCACATTACGCCGAGGTCGACCAAAAGGTTAGAGAAACTCGCTCGATCCCTCGCCAAAACTCTCCC
CGAGCTTTGGGGTCTTCAAGCTGGTGACACTGATCAGTATCCTCAGCCAAATAACACTTCTCAGGACCTCGGAGA
GGCGTCATTAGTCGAGCGTAAGATAGGACTCAAACAACTTCATGCAAATTTGAAAATCATCAGGTCGTCTCCCGC
AGTCATAGTTGACACCTATGATCAGCCTATAAACCACCGCGCTTTGGCACTCCAGATCATCTCTGTCTGTGTTGG
CATCCTCCAATCTCGTTCGACTTTGCTTTTGATCCATGTCCTTTATCCAGTCCTACACTCTTTAGTCTCCCAAGT
CTCCTTTCTTGCATCAACTGCATATGCTAGCTTACAGTTTATGACCGCTGCTGCCTCTTACGCCTCTCCTGCCAA
CCTTCTGCTTTCAAATTTCGATTACGCACTTGATGCGATCTCACGCAGACTTACGCGTCGACGGCTTGACGTAGT
GGCAACTCAAGTACTCGTCTTACTTGTGCGTCTGGTTGGAAGCGATGTAGTCGAAAAAGCAGGGGATGTTGTAGA
GGAATGTTTTGATCGGTTGGATGAATTTCATGGCTATGATGTTGTGGTTGAAGGTCTTGTGAATGTCCTTGTAGA
AGTCACGAAATGCCTTCGGAACGAAGCACCACAAAATGCTAAACCCGTGAAAGAGCCGAGATACACCCCCTACGC
TCGAGTATCTGATATCACAGGCTTCTTTCAGTGGTACCGTCAGCGTCACGATCTCAAAGCCGAGGAAGAAGATGT
TAATTACGGACCCGCTCCTAGAAGAGCCTGGGGCGAAGACAAAGAGAAAAGTACTGAAGAGGAAGAGGATGCGGC
GATAAGAAAAACTGAAAATCCGAGCGACGAGCCGCCCCCCACTCCAACCCAAGCCTTGACGAAACAGATCGTCTC
TCGATCATTATATTTCCTGACGCATGGATCTCCCGTCATACGAGCGCGCATCCTGAAACTATTAGCATTCTCGAT
TCCAAACATACCTTCATCAGCACTCATGCCAGCCATCCACTCGGCCTGGCCTTTCATATTGAACCGGTTGAGCGA
CCAGGAGACCTTTGTCGTCAGTGCTACGGCCTTCTTGATTGAAATGCTATCGACTCATATGGGAGAATATATGTT
CCGAAGGATATGGGATGACGTTTGGCCTAAATTTAAAACCCTTTTAGCAGAATTACAGGCAGGAGACCAGAAAAA
CGCACTGGTTCAGAGAGGTCGAGATTTCGTAGGAGCTGAATCTGCTTATACGCATTCGCATCGCTTATACCGTGC
ACTCCTTGACACCATGACGGCTGCGCTACAAGATGTACACTTGCACGAACGCTCTTTTTGGGATGTCCTTGTGCT
GTTTCGTCGATTTCTGAGTAGCGCTGCGCATCCCGAATTACAGCAATGTGCGCGGAGACTGTACAGTGCTGCAAT
GACACAAGATGCGGATACAGTGTGGCTCGTTCTATCAGCGACTTTCACACATGACCACACCGTCTTAGCGTTTTT
GTATAACACGAAGTGGGATATCATTGGCAATGCTCGAATAGTACTGGGTATCTCGCCTACAGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail